Fungal Genomics

at Utrecht University

General Properties

Protein IDOphauB2|7336
Gene name
LocationContig_78:16728..18467
Strand-
Gene length (bp)1739
Transcript length (bp)1671
Coding sequence length (bp)1671
Protein length (aa) 557

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00977 His_biosynth Histidine biosynthesis protein 6.1E-45 229 524
PF00117 GATase Glutamine amidotransferase class-I 4.3E-20 6 189
PF01174 SNO SNO glutamine amidotransferase family 1.3E-07 11 189

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q9P4P9|HIS5_EMENI Imidazole glycerol phosphate synthase hisHF OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=hisHF PE=3 SV=2 1 547 0.0E+00
sp|P33734|HIS5_YEAST Imidazole glycerol phosphate synthase hisHF OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=HIS7 PE=1 SV=2 1 544 0.0E+00
sp|O94303|HIS5_SCHPO Imidazole glycerol phosphate synthase hisHF OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=his4 PE=3 SV=3 4 541 0.0E+00
sp|Q9SZ30|HIS4_ARATH Imidazole glycerol phosphate synthase hisHF, chloroplastic OS=Arabidopsis thaliana GN=HISN4 PE=2 SV=1 3 541 0.0E+00
sp|Q5V2C9|HIS6_HALMA Imidazole glycerol phosphate synthase subunit HisF OS=Haloarcula marismortui (strain ATCC 43049 / DSM 3752 / JCM 8966 / VKM B-1809) GN=hisF PE=3 SV=1 226 541 7.0E-57
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q9P4P9|HIS5_EMENI Imidazole glycerol phosphate synthase hisHF OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=hisHF PE=3 SV=2 1 547 0.0E+00
sp|P33734|HIS5_YEAST Imidazole glycerol phosphate synthase hisHF OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=HIS7 PE=1 SV=2 1 544 0.0E+00
sp|O94303|HIS5_SCHPO Imidazole glycerol phosphate synthase hisHF OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=his4 PE=3 SV=3 4 541 0.0E+00
sp|Q9SZ30|HIS4_ARATH Imidazole glycerol phosphate synthase hisHF, chloroplastic OS=Arabidopsis thaliana GN=HISN4 PE=2 SV=1 3 541 0.0E+00
sp|Q5V2C9|HIS6_HALMA Imidazole glycerol phosphate synthase subunit HisF OS=Haloarcula marismortui (strain ATCC 43049 / DSM 3752 / JCM 8966 / VKM B-1809) GN=hisF PE=3 SV=1 226 541 7.0E-57
sp|Q8TYW8|HIS6_METKA Imidazole glycerol phosphate synthase subunit HisF OS=Methanopyrus kandleri (strain AV19 / DSM 6324 / JCM 9639 / NBRC 100938) GN=hisF PE=3 SV=1 226 542 1.0E-56
sp|Q2NI84|HIS6_METST Imidazole glycerol phosphate synthase subunit HisF OS=Methanosphaera stadtmanae (strain ATCC 43021 / DSM 3091 / JCM 11832 / MCB-3) GN=hisF PE=3 SV=1 226 541 3.0E-56
sp|A5UMZ1|HIS6_METS3 Imidazole glycerol phosphate synthase subunit HisF OS=Methanobrevibacter smithii (strain PS / ATCC 35061 / DSM 861) GN=hisF PE=3 SV=1 226 541 5.0E-56
sp|Q18JI3|HIS6_HALWD Imidazole glycerol phosphate synthase subunit HisF OS=Haloquadratum walsbyi (strain DSM 16790 / HBSQ001) GN=hisF PE=3 SV=1 226 541 1.0E-55
sp|Q57854|HIS6_METJA Imidazole glycerol phosphate synthase subunit HisF OS=Methanocaldococcus jannaschii (strain ATCC 43067 / DSM 2661 / JAL-1 / JCM 10045 / NBRC 100440) GN=hisF PE=3 SV=1 226 541 1.0E-55
sp|O27398|HIS6_METTH Imidazole glycerol phosphate synthase subunit HisF OS=Methanothermobacter thermautotrophicus (strain ATCC 29096 / DSM 1053 / JCM 10044 / NBRC 100330 / Delta H) GN=hisF PE=3 SV=2 226 541 2.0E-55
sp|A2STB8|HIS6_METLZ Imidazole glycerol phosphate synthase subunit HisF OS=Methanocorpusculum labreanum (strain ATCC 43576 / DSM 4855 / Z) GN=hisF PE=3 SV=1 225 541 2.0E-54
sp|Q8TT96|HIS6_METAC Imidazole glycerol phosphate synthase subunit HisF OS=Methanosarcina acetivorans (strain ATCC 35395 / DSM 2834 / JCM 12185 / C2A) GN=hisF PE=3 SV=1 226 541 5.0E-54
sp|Q8R885|HIS6_CALS4 Imidazole glycerol phosphate synthase subunit HisF OS=Caldanaerobacter subterraneus subsp. tengcongensis (strain DSM 15242 / JCM 11007 / NBRC 100824 / MB4) GN=hisF PE=3 SV=1 226 541 1.0E-53
sp|Q8PW92|HIS6_METMA Imidazole glycerol phosphate synthase subunit HisF OS=Methanosarcina mazei (strain ATCC BAA-159 / DSM 3647 / Goe1 / Go1 / JCM 11833 / OCM 88) GN=hisF PE=3 SV=1 226 541 2.0E-53
sp|B0K629|HIS6_THEPX Imidazole glycerol phosphate synthase subunit HisF OS=Thermoanaerobacter sp. (strain X514) GN=hisF PE=3 SV=1 226 541 4.0E-53
sp|A3CT78|HIS6_METMJ Imidazole glycerol phosphate synthase subunit HisF OS=Methanoculleus marisnigri (strain ATCC 35101 / DSM 1498 / JR1) GN=hisF PE=3 SV=1 226 541 6.0E-53
sp|Q8FNZ9|HIS6_COREF Imidazole glycerol phosphate synthase subunit HisF OS=Corynebacterium efficiens (strain DSM 44549 / YS-314 / AJ 12310 / JCM 11189 / NBRC 100395) GN=hisF PE=3 SV=1 225 542 9.0E-53
sp|Q46CC5|HIS6_METBF Imidazole glycerol phosphate synthase subunit HisF OS=Methanosarcina barkeri (strain Fusaro / DSM 804) GN=hisF PE=3 SV=1 226 541 1.0E-52
sp|Q820Q0|HIS6_NITEU Imidazole glycerol phosphate synthase subunit HisF OS=Nitrosomonas europaea (strain ATCC 19718 / NBRC 14298) GN=hisF PE=3 SV=1 225 541 1.0E-52
sp|Q2FPV1|HIS6_METHJ Imidazole glycerol phosphate synthase subunit HisF OS=Methanospirillum hungatei JF-1 (strain ATCC 27890 / DSM 864 / NBRC 100397 / JF-1) GN=hisF PE=3 SV=1 226 541 1.0E-52
sp|Q0AEU1|HIS6_NITEC Imidazole glycerol phosphate synthase subunit HisF OS=Nitrosomonas eutropha (strain C91) GN=hisF PE=3 SV=1 225 541 2.0E-52
sp|Q12UY6|HIS6_METBU Imidazole glycerol phosphate synthase subunit HisF OS=Methanococcoides burtonii (strain DSM 6242 / NBRC 107633 / OCM 468 / ACE-M) GN=hisF PE=3 SV=1 226 541 3.0E-52
sp|A4J707|HIS6_DESRM Imidazole glycerol phosphate synthase subunit HisF OS=Desulfotomaculum reducens (strain MI-1) GN=hisF PE=3 SV=1 226 541 3.0E-52
sp|Q4JW52|HIS6_CORJK Imidazole glycerol phosphate synthase subunit HisF OS=Corynebacterium jeikeium (strain K411) GN=hisF PE=3 SV=1 226 541 3.0E-52
sp|P60714|HIS6_CORDI Imidazole glycerol phosphate synthase subunit HisF OS=Corynebacterium diphtheriae (strain ATCC 700971 / NCTC 13129 / Biotype gravis) GN=hisF PE=3 SV=1 229 541 4.0E-52
sp|Q47AM3|HIS6_DECAR Imidazole glycerol phosphate synthase subunit HisF OS=Dechloromonas aromatica (strain RCB) GN=hisF PE=3 SV=1 226 541 1.0E-51
sp|O29439|HIS6_ARCFU Imidazole glycerol phosphate synthase subunit HisF OS=Archaeoglobus fulgidus (strain ATCC 49558 / VC-16 / DSM 4304 / JCM 9628 / NBRC 100126) GN=hisF PE=3 SV=1 226 541 1.0E-51
sp|Q7W2X9|HIS6_BORPA Imidazole glycerol phosphate synthase subunit HisF OS=Bordetella parapertussis (strain 12822 / ATCC BAA-587 / NCTC 13253) GN=hisF PE=3 SV=1 223 541 1.0E-51
sp|A0QX87|HIS6_MYCS2 Imidazole glycerol phosphate synthase subunit HisF OS=Mycobacterium smegmatis (strain ATCC 700084 / mc(2)155) GN=hisF PE=3 SV=1 223 541 1.0E-51
sp|Q7VSY6|HIS6_BORPE Imidazole glycerol phosphate synthase subunit HisF OS=Bordetella pertussis (strain Tohama I / ATCC BAA-589 / NCTC 13251) GN=hisF PE=3 SV=1 223 541 2.0E-51
sp|Q7WDX9|HIS6_BORBR Imidazole glycerol phosphate synthase subunit HisF OS=Bordetella bronchiseptica (strain ATCC BAA-588 / NCTC 13252 / RB50) GN=hisF PE=3 SV=1 223 541 2.0E-51
sp|A0QHH6|HIS6_MYCA1 Imidazole glycerol phosphate synthase subunit HisF OS=Mycobacterium avium (strain 104) GN=hisF PE=3 SV=1 223 542 2.0E-51
sp|Q01ZU6|HIS6_SOLUE Imidazole glycerol phosphate synthase subunit HisF OS=Solibacter usitatus (strain Ellin6076) GN=hisF PE=3 SV=1 226 541 4.0E-51
sp|Q2KTT1|HIS6_BORA1 Imidazole glycerol phosphate synthase subunit HisF OS=Bordetella avium (strain 197N) GN=hisF PE=3 SV=1 223 541 5.0E-51
sp|P60666|HIS6_MYCPA Imidazole glycerol phosphate synthase subunit HisF OS=Mycobacterium paratuberculosis (strain ATCC BAA-968 / K-10) GN=hisF PE=3 SV=1 223 542 5.0E-51
sp|Q2YAV0|HIS6_NITMU Imidazole glycerol phosphate synthase subunit HisF OS=Nitrosospira multiformis (strain ATCC 25196 / NCIMB 11849) GN=hisF PE=3 SV=1 225 541 6.0E-51
sp|O66567|HIS6_AQUAE Imidazole glycerol phosphate synthase subunit HisF OS=Aquifex aeolicus (strain VF5) GN=hisF PE=3 SV=1 226 544 6.0E-51
sp|A7I616|HIS6_METB6 Imidazole glycerol phosphate synthase subunit HisF OS=Methanoregula boonei (strain 6A8) GN=hisF PE=3 SV=2 226 541 6.0E-51
sp|B8D116|HIS6_HALOH Imidazole glycerol phosphate synthase subunit HisF OS=Halothermothrix orenii (strain H 168 / OCM 544 / DSM 9562) GN=hisF PE=3 SV=1 226 541 1.0E-50
sp|B8GEX3|HIS6_METPE Imidazole glycerol phosphate synthase subunit HisF OS=Methanosphaerula palustris (strain ATCC BAA-1556 / DSM 19958 / E1-9c) GN=hisF PE=3 SV=1 226 541 2.0E-50
sp|A6UUZ9|HIS6_META3 Imidazole glycerol phosphate synthase subunit HisF OS=Methanococcus aeolicus (strain Nankai-3 / ATCC BAA-1280) GN=hisF PE=3 SV=1 226 541 2.0E-50
sp|A4SV20|HIS6_POLSQ Imidazole glycerol phosphate synthase subunit HisF OS=Polynucleobacter necessarius subsp. asymbioticus (strain DSM 18221 / CIP 109841 / QLW-P1DMWA-1) GN=hisF PE=3 SV=1 226 541 3.0E-50
sp|Q0W358|HIS6_METAR Imidazole glycerol phosphate synthase subunit HisF OS=Methanocella arvoryzae (strain DSM 22066 / NBRC 105507 / MRE50) GN=hisF PE=3 SV=1 226 541 5.0E-50
sp|Q3INY2|HIS6_NATPD Imidazole glycerol phosphate synthase subunit HisF OS=Natronomonas pharaonis (strain ATCC 35678 / DSM 2160) GN=hisF PE=3 SV=1 226 541 8.0E-50
sp|A4Y083|HIS6_PSEMY Imidazole glycerol phosphate synthase subunit HisF OS=Pseudomonas mendocina (strain ymp) GN=hisF PE=3 SV=1 226 541 8.0E-50
sp|Q13TR0|HIS6_BURXL Imidazole glycerol phosphate synthase subunit HisF OS=Burkholderia xenovorans (strain LB400) GN=hisF PE=3 SV=1 226 541 1.0E-49
sp|C3PHA6|HIS6_CORA7 Imidazole glycerol phosphate synthase subunit HisF OS=Corynebacterium aurimucosum (strain ATCC 700975 / DSM 44827 / CN-1) GN=hisF PE=3 SV=1 226 542 1.0E-49
sp|B2JHX9|HIS6_BURP8 Imidazole glycerol phosphate synthase subunit HisF OS=Burkholderia phymatum (strain DSM 17167 / STM815) GN=hisF PE=3 SV=1 226 541 2.0E-49
sp|B2SZ59|HIS6_BURPP Imidazole glycerol phosphate synthase subunit HisF OS=Burkholderia phytofirmans (strain DSM 17436 / PsJN) GN=hisF PE=3 SV=1 226 541 2.0E-49
sp|Q1D4M4|HIS6_MYXXD Imidazole glycerol phosphate synthase subunit HisF OS=Myxococcus xanthus (strain DK 1622) GN=hisF PE=3 SV=1 226 543 3.0E-49
sp|Q603K3|HIS6_METCA Imidazole glycerol phosphate synthase subunit HisF OS=Methylococcus capsulatus (strain ATCC 33009 / NCIMB 11132 / Bath) GN=hisF PE=3 SV=1 226 542 3.0E-49
sp|C1DAK5|HIS6_LARHH Imidazole glycerol phosphate synthase subunit HisF OS=Laribacter hongkongensis (strain HLHK9) GN=hisF PE=3 SV=1 226 541 3.0E-49
sp|A4YI34|HIS6_METS5 Imidazole glycerol phosphate synthase subunit HisF OS=Metallosphaera sedula (strain ATCC 51363 / DSM 5348) GN=hisF PE=3 SV=1 227 541 4.0E-49
sp|A6VDQ9|HIS6_PSEA7 Imidazole glycerol phosphate synthase subunit HisF OS=Pseudomonas aeruginosa (strain PA7) GN=hisF PE=3 SV=1 226 541 4.0E-49
sp|C0Z6P4|HIS6_BREBN Imidazole glycerol phosphate synthase subunit HisF OS=Brevibacillus brevis (strain 47 / JCM 6285 / NBRC 100599) GN=hisF PE=3 SV=1 226 541 4.0E-49
sp|B4E641|HIS6_BURCJ Imidazole glycerol phosphate synthase subunit HisF OS=Burkholderia cenocepacia (strain ATCC BAA-245 / DSM 16553 / LMG 16656 / NCTC 13227 / J2315 / CF5610) GN=hisF PE=3 SV=1 226 541 4.0E-49
sp|Q2SUA8|HIS6_BURTA Imidazole glycerol phosphate synthase subunit HisF OS=Burkholderia thailandensis (strain E264 / ATCC 700388 / DSM 13276 / CIP 106301) GN=hisF PE=3 SV=2 226 541 5.0E-49
sp|P62454|HIS6_METMP Imidazole glycerol phosphate synthase subunit HisF OS=Methanococcus maripaludis (strain S2 / LL) GN=hisF PE=3 SV=1 226 541 5.0E-49
sp|A5G8S9|HIS6_GEOUR Imidazole glycerol phosphate synthase subunit HisF OS=Geobacter uraniireducens (strain Rf4) GN=hisF PE=3 SV=1 226 541 5.0E-49
sp|Q0BIW4|HIS6_BURCM Imidazole glycerol phosphate synthase subunit HisF OS=Burkholderia ambifaria (strain ATCC BAA-244 / AMMD) GN=hisF PE=3 SV=1 226 541 6.0E-49
sp|A0K3V8|HIS6_BURCH Imidazole glycerol phosphate synthase subunit HisF OS=Burkholderia cenocepacia (strain HI2424) GN=hisF PE=3 SV=1 226 541 6.0E-49
sp|B1JUA5|HIS6_BURCC Imidazole glycerol phosphate synthase subunit HisF OS=Burkholderia cenocepacia (strain MC0-3) GN=hisF PE=3 SV=1 226 541 6.0E-49
sp|Q1BS31|HIS6_BURCA Imidazole glycerol phosphate synthase subunit HisF OS=Burkholderia cenocepacia (strain AU 1054) GN=hisF PE=3 SV=1 226 541 6.0E-49
sp|Q63Q92|HIS6_BURPS Imidazole glycerol phosphate synthase subunit HisF OS=Burkholderia pseudomallei (strain K96243) GN=hisF PE=3 SV=2 226 541 7.0E-49
sp|A3NE93|HIS6_BURP6 Imidazole glycerol phosphate synthase subunit HisF OS=Burkholderia pseudomallei (strain 668) GN=hisF PE=3 SV=2 226 541 7.0E-49
sp|Q3JN02|HIS6_BURP1 Imidazole glycerol phosphate synthase subunit HisF OS=Burkholderia pseudomallei (strain 1710b) GN=hisF PE=3 SV=1 226 541 7.0E-49
sp|A3P027|HIS6_BURP0 Imidazole glycerol phosphate synthase subunit HisF OS=Burkholderia pseudomallei (strain 1106a) GN=hisF PE=3 SV=2 226 541 7.0E-49
sp|B9M0M0|HIS6_GEODF Imidazole glycerol phosphate synthase subunit HisF OS=Geobacter daltonii (strain DSM 22248 / JCM 15807 / FRC-32) GN=hisF PE=3 SV=1 226 541 8.0E-49
sp|Q02EM6|HIS6_PSEAB Imidazole glycerol phosphate synthase subunit HisF OS=Pseudomonas aeruginosa (strain UCBPP-PA14) GN=hisF PE=3 SV=1 226 541 8.0E-49
sp|B7V3N3|HIS6_PSEA8 Imidazole glycerol phosphate synthase subunit HisF OS=Pseudomonas aeruginosa (strain LESB58) GN=hisF PE=3 SV=1 226 541 8.0E-49
sp|Q9HU44|HIS61_PSEAE Imidazole glycerol phosphate synthase subunit hisF1 OS=Pseudomonas aeruginosa (strain ATCC 15692 / PAO1 / 1C / PRS 101 / LMG 12228) GN=hisF1 PE=3 SV=1 226 541 8.0E-49
sp|Q97KH8|HIS6_CLOAB Imidazole glycerol phosphate synthase subunit HisF OS=Clostridium acetobutylicum (strain ATCC 824 / DSM 792 / JCM 1419 / LMG 5710 / VKM B-1787) GN=hisF PE=3 SV=1 226 541 9.0E-49
sp|B1YRW1|HIS6_BURA4 Imidazole glycerol phosphate synthase subunit HisF OS=Burkholderia ambifaria (strain MC40-6) GN=hisF PE=3 SV=1 226 541 9.0E-49
sp|A8AAK3|HIS6_IGNH4 Imidazole glycerol phosphate synthase subunit HisF OS=Ignicoccus hospitalis (strain KIN4/I / DSM 18386 / JCM 14125) GN=hisF PE=3 SV=1 226 541 1.0E-48
sp|Q1B7H0|HIS6_MYCSS Imidazole glycerol phosphate synthase subunit HisF OS=Mycobacterium sp. (strain MCS) GN=hisF PE=3 SV=1 225 541 1.0E-48
sp|A1UHK2|HIS6_MYCSK Imidazole glycerol phosphate synthase subunit HisF OS=Mycobacterium sp. (strain KMS) GN=hisF PE=3 SV=1 225 541 1.0E-48
sp|A3Q125|HIS6_MYCSJ Imidazole glycerol phosphate synthase subunit HisF OS=Mycobacterium sp. (strain JLS) GN=hisF PE=3 SV=1 225 541 1.0E-48
sp|A4JAW9|HIS6_BURVG Imidazole glycerol phosphate synthase subunit HisF OS=Burkholderia vietnamiensis (strain G4 / LMG 22486) GN=hisF PE=3 SV=1 226 541 1.0E-48
sp|A6VHY8|HIS6_METM7 Imidazole glycerol phosphate synthase subunit HisF OS=Methanococcus maripaludis (strain C7 / ATCC BAA-1331) GN=hisF PE=3 SV=1 226 541 1.0E-48
sp|Q39K85|HIS6_BURL3 Imidazole glycerol phosphate synthase subunit HisF OS=Burkholderia lata (strain ATCC 17760 / LMG 22485 / NCIMB 9086 / R18194 / 383) GN=hisF PE=3 SV=1 226 541 1.0E-48
sp|Q92E88|HIS6_LISIN Imidazole glycerol phosphate synthase subunit HisF OS=Listeria innocua serovar 6a (strain CLIP 11262) GN=hisF PE=3 SV=1 226 541 2.0E-48
sp|O31139|HIS6_CORGL Imidazole glycerol phosphate synthase subunit HisF OS=Corynebacterium glutamicum (strain ATCC 13032 / DSM 20300 / JCM 1318 / LMG 3730 / NCIMB 10025) GN=hisF PE=3 SV=2 225 542 2.0E-48
sp|A4QFF9|HIS6_CORGB Imidazole glycerol phosphate synthase subunit HisF OS=Corynebacterium glutamicum (strain R) GN=hisF PE=3 SV=1 225 542 2.0E-48
sp|Q3KJI5|HIS6_PSEPF Imidazole glycerol phosphate synthase subunit HisF OS=Pseudomonas fluorescens (strain Pf0-1) GN=hisF PE=3 SV=1 226 541 2.0E-48
sp|A1V8H5|HIS6_BURMS Imidazole glycerol phosphate synthase subunit HisF OS=Burkholderia mallei (strain SAVP1) GN=hisF PE=3 SV=2 226 541 2.0E-48
sp|Q62GE5|HIS6_BURMA Imidazole glycerol phosphate synthase subunit HisF OS=Burkholderia mallei (strain ATCC 23344) GN=hisF PE=3 SV=1 226 541 2.0E-48
sp|A2S754|HIS6_BURM9 Imidazole glycerol phosphate synthase subunit HisF OS=Burkholderia mallei (strain NCTC 10229) GN=hisF PE=3 SV=2 226 541 2.0E-48
sp|A3MPU4|HIS6_BURM7 Imidazole glycerol phosphate synthase subunit HisF OS=Burkholderia mallei (strain NCTC 10247) GN=hisF PE=3 SV=2 226 541 2.0E-48
sp|Q0VM72|HIS6_ALCBS Imidazole glycerol phosphate synthase subunit HisF OS=Alcanivorax borkumensis (strain ATCC 700651 / DSM 11573 / NCIMB 13689 / SK2) GN=hisF PE=3 SV=1 225 541 2.0E-48
sp|B2V9M8|HIS6_SULSY Imidazole glycerol phosphate synthase subunit HisF OS=Sulfurihydrogenibium sp. (strain YO3AOP1) GN=hisF PE=3 SV=1 226 541 2.0E-48
sp|C1A0L6|HIS6_RHOE4 Imidazole glycerol phosphate synthase subunit HisF OS=Rhodococcus erythropolis (strain PR4 / NBRC 100887) GN=hisF PE=3 SV=1 226 541 3.0E-48
sp|Q3Z7F5|HIS6_DEHM1 Imidazole glycerol phosphate synthase subunit HisF OS=Dehalococcoides mccartyi (strain ATCC BAA-2266 / KCTC 15142 / 195) GN=hisF PE=3 SV=1 226 541 3.0E-48
sp|A1A1I5|HIS6_BIFAA Imidazole glycerol phosphate synthase subunit HisF OS=Bifidobacterium adolescentis (strain ATCC 15703 / DSM 20083 / NCTC 11814 / E194a) GN=hisF PE=3 SV=1 226 541 3.0E-48
sp|Q5HKP2|HIS6_STAEQ Imidazole glycerol phosphate synthase subunit HisF OS=Staphylococcus epidermidis (strain ATCC 35984 / RP62A) GN=hisF PE=3 SV=1 226 541 3.0E-48
sp|Q1I3G8|HIS6_PSEE4 Imidazole glycerol phosphate synthase subunit HisF OS=Pseudomonas entomophila (strain L48) GN=hisF PE=3 SV=1 226 541 3.0E-48
sp|B0KI45|HIS6_PSEPG Imidazole glycerol phosphate synthase subunit HisF OS=Pseudomonas putida (strain GB-1) GN=hisF PE=3 SV=1 226 541 3.0E-48
sp|A9A8U1|HIS6_METM6 Imidazole glycerol phosphate synthase subunit HisF OS=Methanococcus maripaludis (strain C6 / ATCC BAA-1332) GN=hisF PE=3 SV=1 226 541 3.0E-48
sp|A4T9N2|HIS6_MYCGI Imidazole glycerol phosphate synthase subunit HisF OS=Mycobacterium gilvum (strain PYR-GCK) GN=hisF PE=3 SV=1 223 541 3.0E-48
sp|A4VRV9|HIS6_PSEU5 Imidazole glycerol phosphate synthase subunit HisF OS=Pseudomonas stutzeri (strain A1501) GN=hisF PE=3 SV=1 226 541 4.0E-48
sp|B1JED1|HIS6_PSEPW Imidazole glycerol phosphate synthase subunit HisF OS=Pseudomonas putida (strain W619) GN=hisF PE=3 SV=1 226 541 4.0E-48
sp|Q7P0E9|HIS6_CHRVO Imidazole glycerol phosphate synthase subunit HisF OS=Chromobacterium violaceum (strain ATCC 12472 / DSM 30191 / JCM 1249 / NBRC 12614 / NCIMB 9131 / NCTC 9757) GN=hisF PE=3 SV=1 226 541 4.0E-48
sp|A5FQI9|HIS6_DEHMB Imidazole glycerol phosphate synthase subunit HisF OS=Dehalococcoides mccartyi (strain ATCC BAA-2100 / JCM 16839 / KCTC 5957 / BAV1) GN=hisF PE=3 SV=1 226 541 4.0E-48
sp|O33774|HIS6_SULSO Imidazole glycerol phosphate synthase subunit HisF OS=Sulfolobus solfataricus (strain ATCC 35092 / DSM 1617 / JCM 11322 / P2) GN=hisF PE=3 SV=1 227 542 4.0E-48
sp|B1VH88|HIS6_CORU7 Imidazole glycerol phosphate synthase subunit HisF OS=Corynebacterium urealyticum (strain ATCC 43042 / DSM 7109) GN=hisF PE=3 SV=1 229 533 4.0E-48
sp|Q9HR52|HIS6_HALSA Imidazole glycerol phosphate synthase subunit HisF OS=Halobacterium salinarum (strain ATCC 700922 / JCM 11081 / NRC-1) GN=hisF PE=3 SV=1 226 541 4.0E-48
sp|B0R4B2|HIS6_HALS3 Imidazole glycerol phosphate synthase subunit HisF OS=Halobacterium salinarum (strain ATCC 29341 / DSM 671 / R1) GN=hisF PE=3 SV=1 226 541 4.0E-48
sp|Q88R41|HIS6_PSEPK Imidazole glycerol phosphate synthase subunit HisF OS=Pseudomonas putida (strain KT2440) GN=hisF PE=3 SV=1 226 541 5.0E-48
sp|A5VX76|HIS6_PSEP1 Imidazole glycerol phosphate synthase subunit HisF OS=Pseudomonas putida (strain F1 / ATCC 700007) GN=hisF PE=3 SV=1 226 541 5.0E-48
sp|B1XSV3|HIS6_POLNS Imidazole glycerol phosphate synthase subunit HisF OS=Polynucleobacter necessarius subsp. necessarius (strain STIR1) GN=hisF PE=3 SV=1 226 541 5.0E-48
sp|Q47QS3|HIS6_THEFY Imidazole glycerol phosphate synthase subunit HisF OS=Thermobifida fusca (strain YX) GN=hisF PE=3 SV=1 226 541 6.0E-48
sp|Q1Q835|HIS6_PSYCK Imidazole glycerol phosphate synthase subunit HisF OS=Psychrobacter cryohalolentis (strain K5) GN=hisF PE=3 SV=1 226 541 7.0E-48
sp|Q3ZY29|HIS6_DEHMC Imidazole glycerol phosphate synthase subunit HisF OS=Dehalococcoides mccartyi (strain CBDB1) GN=hisF PE=3 SV=1 226 541 7.0E-48
sp|Q8CQ92|HIS6_STAES Imidazole glycerol phosphate synthase subunit HisF OS=Staphylococcus epidermidis (strain ATCC 12228) GN=hisF PE=3 SV=1 226 541 7.0E-48
sp|Q4KJS4|HIS6_PSEF5 Imidazole glycerol phosphate synthase subunit HisF OS=Pseudomonas fluorescens (strain Pf-5 / ATCC BAA-477) GN=hisF PE=3 SV=1 226 541 7.0E-48
sp|B1HVQ1|HIS6_LYSSC Imidazole glycerol phosphate synthase subunit HisF OS=Lysinibacillus sphaericus (strain C3-41) GN=hisF PE=3 SV=1 226 541 1.0E-47
sp|B0TDM7|HIS6_HELMI Imidazole glycerol phosphate synthase subunit HisF OS=Heliobacterium modesticaldum (strain ATCC 51547 / Ice1) GN=hisF PE=3 SV=1 226 543 1.0E-47
sp|B3WED1|HIS6_LACCB Imidazole glycerol phosphate synthase subunit HisF OS=Lactobacillus casei (strain BL23) GN=hisF PE=3 SV=1 226 541 1.0E-47
sp|B2UEE5|HIS6_RALPJ Imidazole glycerol phosphate synthase subunit HisF OS=Ralstonia pickettii (strain 12J) GN=hisF PE=3 SV=1 226 541 1.0E-47
sp|Q5P795|HIS6_AROAE Imidazole glycerol phosphate synthase subunit HisF OS=Aromatoleum aromaticum (strain EbN1) GN=hisF PE=3 SV=1 226 541 1.0E-47
sp|Q7UKJ9|HIS6_RHOBA Imidazole glycerol phosphate synthase subunit HisF OS=Rhodopirellula baltica (strain DSM 10527 / NCIMB 13988 / SH1) GN=hisF PE=3 SV=1 226 541 1.0E-47
sp|C3K6V3|HIS6_PSEFS Imidazole glycerol phosphate synthase subunit HisF OS=Pseudomonas fluorescens (strain SBW25) GN=hisF PE=3 SV=1 226 541 1.0E-47
sp|A6UR05|HIS6_METVS Imidazole glycerol phosphate synthase subunit HisF OS=Methanococcus vannielii (strain SB / ATCC 35089 / DSM 1224) GN=hisF PE=3 SV=1 226 541 2.0E-47
sp|P58800|HIS6_PYRFU Imidazole glycerol phosphate synthase subunit HisF OS=Pyrococcus furiosus (strain ATCC 43587 / DSM 3638 / JCM 8422 / Vc1) GN=hisF PE=3 SV=1 226 541 2.0E-47
sp|A4G0J7|HIS6_METM5 Imidazole glycerol phosphate synthase subunit HisF OS=Methanococcus maripaludis (strain C5 / ATCC BAA-1333) GN=hisF PE=3 SV=1 226 541 2.0E-47
sp|Q0K693|HIS6_CUPNH Imidazole glycerol phosphate synthase subunit HisF OS=Cupriavidus necator (strain ATCC 17699 / H16 / DSM 428 / Stanier 337) GN=hisF PE=3 SV=1 226 541 2.0E-47
sp|Q4FPZ3|HIS6_PSYA2 Imidazole glycerol phosphate synthase subunit HisF OS=Psychrobacter arcticus (strain DSM 17307 / 273-4) GN=hisF PE=3 SV=1 226 541 2.0E-47
sp|Q2YZ71|HIS6_STAAB Imidazole glycerol phosphate synthase subunit HisF OS=Staphylococcus aureus (strain bovine RF122 / ET3-1) GN=hisF PE=3 SV=1 226 541 2.0E-47
sp|P64362|HIS6_STAAN Imidazole glycerol phosphate synthase subunit HisF OS=Staphylococcus aureus (strain N315) GN=hisF PE=3 SV=1 226 541 3.0E-47
sp|P64361|HIS6_STAAM Imidazole glycerol phosphate synthase subunit HisF OS=Staphylococcus aureus (strain Mu50 / ATCC 700699) GN=hisF PE=3 SV=1 226 541 3.0E-47
sp|A5IWA0|HIS6_STAA9 Imidazole glycerol phosphate synthase subunit HisF OS=Staphylococcus aureus (strain JH9) GN=hisF PE=3 SV=1 226 541 3.0E-47
sp|A6U558|HIS6_STAA2 Imidazole glycerol phosphate synthase subunit HisF OS=Staphylococcus aureus (strain JH1) GN=hisF PE=3 SV=1 226 541 3.0E-47
sp|A7X763|HIS6_STAA1 Imidazole glycerol phosphate synthase subunit HisF OS=Staphylococcus aureus (strain Mu3 / ATCC 700698) GN=hisF PE=3 SV=1 226 541 3.0E-47
sp|A1U5H5|HIS6_MARHV Imidazole glycerol phosphate synthase subunit HisF OS=Marinobacter hydrocarbonoclasticus (strain ATCC 700491 / DSM 11845 / VT8) GN=hisF PE=3 SV=1 226 541 3.0E-47
sp|A9A5X0|HIS6_NITMS Imidazole glycerol phosphate synthase subunit HisF OS=Nitrosopumilus maritimus (strain SCM1) GN=hisF PE=3 SV=1 226 541 3.0E-47
sp|C1DJD3|HIS6_AZOVD Imidazole glycerol phosphate synthase subunit HisF OS=Azotobacter vinelandii (strain DJ / ATCC BAA-1303) GN=hisF PE=3 SV=1 226 541 3.0E-47
sp|Q039B5|HIS6_LACC3 Imidazole glycerol phosphate synthase subunit HisF OS=Lactobacillus casei (strain ATCC 334) GN=hisF PE=3 SV=1 226 541 3.0E-47
sp|B1MBX3|HIS6_MYCA9 Imidazole glycerol phosphate synthase subunit HisF OS=Mycobacterium abscessus (strain ATCC 19977 / DSM 44196 / CIP 104536 / JCM 13569 / NCTC 13031 / TMC 1543) GN=hisF PE=3 SV=1 229 541 3.0E-47
sp|Q8NUI3|HIS6_STAAW Imidazole glycerol phosphate synthase subunit HisF OS=Staphylococcus aureus (strain MW2) GN=hisF PE=3 SV=1 226 541 4.0E-47
sp|A8Z5H3|HIS6_STAAT Imidazole glycerol phosphate synthase subunit HisF OS=Staphylococcus aureus (strain USA300 / TCH1516) GN=hisF PE=3 SV=1 226 541 4.0E-47
sp|Q6G602|HIS6_STAAS Imidazole glycerol phosphate synthase subunit HisF OS=Staphylococcus aureus (strain MSSA476) GN=hisF PE=3 SV=1 226 541 4.0E-47
sp|A6QKG1|HIS6_STAAE Imidazole glycerol phosphate synthase subunit HisF OS=Staphylococcus aureus (strain Newman) GN=hisF PE=3 SV=1 226 541 4.0E-47
sp|Q5HCM4|HIS6_STAAC Imidazole glycerol phosphate synthase subunit HisF OS=Staphylococcus aureus (strain COL) GN=hisF PE=3 SV=1 226 541 4.0E-47
sp|Q2FDI8|HIS6_STAA3 Imidazole glycerol phosphate synthase subunit HisF OS=Staphylococcus aureus (strain USA300) GN=hisF PE=3 SV=1 226 541 4.0E-47
sp|Q6GDD1|HIS6_STAAR Imidazole glycerol phosphate synthase subunit HisF OS=Staphylococcus aureus (strain MRSA252) GN=hisF PE=3 SV=1 226 541 4.0E-47
sp|A6TKT6|HIS6_ALKMQ Imidazole glycerol phosphate synthase subunit HisF OS=Alkaliphilus metalliredigens (strain QYMF) GN=hisF PE=3 SV=1 226 542 4.0E-47
sp|Q5YYP3|HIS6_NOCFA Imidazole glycerol phosphate synthase subunit HisF OS=Nocardia farcinica (strain IFM 10152) GN=hisF PE=3 SV=1 229 541 4.0E-47
sp|Q8KCB0|HIS6_CHLTE Imidazole glycerol phosphate synthase subunit HisF OS=Chlorobium tepidum (strain ATCC 49652 / DSM 12025 / NBRC 103806 / TLS) GN=hisF PE=3 SV=1 226 541 5.0E-47
sp|Q87UG4|HIS6_PSESM Imidazole glycerol phosphate synthase subunit HisF OS=Pseudomonas syringae pv. tomato (strain DC3000) GN=hisF PE=3 SV=1 226 541 5.0E-47
sp|B7INA3|HIS6_BACC2 Imidazole glycerol phosphate synthase subunit HisF OS=Bacillus cereus (strain G9842) GN=hisF PE=3 SV=1 226 541 5.0E-47
sp|Q31E64|HIS6_THICR Imidazole glycerol phosphate synthase subunit HisF OS=Thiomicrospira crunogena (strain XCL-2) GN=hisF PE=3 SV=1 226 541 5.0E-47
sp|Q3J6Q1|HIS6_NITOC Imidazole glycerol phosphate synthase subunit HisF OS=Nitrosococcus oceani (strain ATCC 19707 / NCIMB 11848) GN=hisF PE=3 SV=1 226 542 6.0E-47
sp|A0LCF3|HIS6_MAGMM Imidazole glycerol phosphate synthase subunit HisF OS=Magnetococcus marinus (strain ATCC BAA-1437 / JCM 17883 / MC-1) GN=hisF PE=3 SV=1 226 541 6.0E-47
sp|C0Q9D3|HIS6_DESAH Imidazole glycerol phosphate synthase subunit HisF OS=Desulfobacterium autotrophicum (strain ATCC 43914 / DSM 3382 / HRM2) GN=hisF PE=3 SV=1 226 542 7.0E-47
sp|B9KXJ6|HIS6_THERP Imidazole glycerol phosphate synthase subunit HisF OS=Thermomicrobium roseum (strain ATCC 27502 / DSM 5159 / P-2) GN=hisF PE=3 SV=1 226 542 9.0E-47
sp|Q4ZLQ2|HIS6_PSEU2 Imidazole glycerol phosphate synthase subunit HisF OS=Pseudomonas syringae pv. syringae (strain B728a) GN=hisF PE=3 SV=1 226 541 1.0E-46
sp|Q48C81|HIS6_PSE14 Imidazole glycerol phosphate synthase subunit HisF OS=Pseudomonas savastanoi pv. phaseolicola (strain 1448A / Race 6) GN=hisF PE=3 SV=1 226 541 1.0E-46
sp|A6VTA6|HIS6_MARMS Imidazole glycerol phosphate synthase subunit HisF OS=Marinomonas sp. (strain MWYL1) GN=hisF PE=3 SV=1 225 541 1.0E-46
sp|B1I556|HIS6_DESAP Imidazole glycerol phosphate synthase subunit HisF OS=Desulforudis audaxviator (strain MP104C) GN=hisF PE=3 SV=1 226 541 2.0E-46
sp|B2HQA8|HIS6_MYCMM Imidazole glycerol phosphate synthase subunit HisF OS=Mycobacterium marinum (strain ATCC BAA-535 / M) GN=hisF PE=3 SV=1 224 541 2.0E-46
sp|Q2RGW2|HIS6_MOOTA Imidazole glycerol phosphate synthase subunit HisF OS=Moorella thermoacetica (strain ATCC 39073) GN=hisF PE=3 SV=1 226 541 2.0E-46
sp|C5D7N8|HIS6_GEOSW Imidazole glycerol phosphate synthase subunit HisF OS=Geobacillus sp. (strain WCH70) GN=hisF PE=3 SV=1 226 541 2.0E-46
sp|A1T8W7|HIS6_MYCVP Imidazole glycerol phosphate synthase subunit HisF OS=Mycobacterium vanbaalenii (strain DSM 7251 / PYR-1) GN=hisF PE=3 SV=1 229 541 2.0E-46
sp|A1W444|HIS6_ACISJ Imidazole glycerol phosphate synthase subunit HisF OS=Acidovorax sp. (strain JS42) GN=hisF PE=3 SV=1 226 541 2.0E-46
sp|B9MDW3|HIS6_ACIET Imidazole glycerol phosphate synthase subunit HisF OS=Acidovorax ebreus (strain TPSY) GN=hisF PE=3 SV=1 226 541 2.0E-46
sp|Q845U7|HIS6_BURM1 Imidazole glycerol phosphate synthase subunit HisF OS=Burkholderia multivorans (strain ATCC 17616 / 249) GN=hisF PE=3 SV=1 226 541 2.0E-46
sp|B8GU32|HIS6_THISH Imidazole glycerol phosphate synthase subunit HisF OS=Thioalkalivibrio sulfidiphilus (strain HL-EbGR7) GN=hisF PE=3 SV=1 226 541 2.0E-46
sp|B3R794|HIS6_CUPTR Imidazole glycerol phosphate synthase subunit HisF OS=Cupriavidus taiwanensis (strain R1 / LMG 19424) GN=hisF PE=3 SV=1 226 541 3.0E-46
sp|C5BMF5|HIS6_TERTT Imidazole glycerol phosphate synthase subunit HisF OS=Teredinibacter turnerae (strain ATCC 39867 / T7901) GN=hisF PE=3 SV=1 226 541 3.0E-46
sp|Q2SMB2|HIS6_HAHCH Imidazole glycerol phosphate synthase subunit HisF OS=Hahella chejuensis (strain KCTC 2396) GN=hisF PE=3 SV=1 225 541 3.0E-46
sp|Q0AW41|HIS6_SYNWW Imidazole glycerol phosphate synthase subunit HisF OS=Syntrophomonas wolfei subsp. wolfei (strain DSM 2245B / Goettingen) GN=hisF PE=3 SV=1 228 541 3.0E-46
sp|A1TL06|HIS6_ACIAC Imidazole glycerol phosphate synthase subunit HisF OS=Acidovorax citrulli (strain AAC00-1) GN=hisF PE=3 SV=1 226 541 3.0E-46
sp|B9DIP1|HIS6_STACT Imidazole glycerol phosphate synthase subunit HisF OS=Staphylococcus carnosus (strain TM300) GN=hisF PE=3 SV=1 226 541 3.0E-46
sp|B9L718|HIS6_NAUPA Imidazole glycerol phosphate synthase subunit HisF OS=Nautilia profundicola (strain ATCC BAA-1463 / DSM 18972 / AmH) GN=hisF PE=3 SV=1 226 541 4.0E-46
sp|A0PP20|HIS6_MYCUA Imidazole glycerol phosphate synthase subunit HisF OS=Mycobacterium ulcerans (strain Agy99) GN=hisF PE=3 SV=1 224 541 5.0E-46
sp|Q21NH5|HIS6_SACD2 Imidazole glycerol phosphate synthase subunit HisF OS=Saccharophagus degradans (strain 2-40 / ATCC 43961 / DSM 17024) GN=hisF PE=3 SV=1 226 541 6.0E-46
sp|B7HHG5|HIS6_BACC4 Imidazole glycerol phosphate synthase subunit HisF OS=Bacillus cereus (strain B4264) GN=hisF PE=3 SV=1 226 541 7.0E-46
sp|B6YWA9|HIS6_THEON Imidazole glycerol phosphate synthase subunit HisF OS=Thermococcus onnurineus (strain NA1) GN=hisF PE=3 SV=1 226 541 8.0E-46
sp|Q970Z0|HIS6_SULTO Imidazole glycerol phosphate synthase subunit HisF OS=Sulfolobus tokodaii (strain DSM 16993 / JCM 10545 / NBRC 100140 / 7) GN=hisF PE=3 SV=1 228 541 9.0E-46
sp|A9B5I5|HIS6_HERA2 Imidazole glycerol phosphate synthase subunit HisF OS=Herpetosiphon aurantiacus (strain ATCC 23779 / DSM 785) GN=hisF PE=3 SV=1 226 542 9.0E-46
sp|B3EKW7|HIS6_CHLPB Imidazole glycerol phosphate synthase subunit HisF OS=Chlorobium phaeobacteroides (strain BS1) GN=hisF PE=3 SV=1 226 541 9.0E-46
sp|Q8GDQ6|HIS6_HELMO Imidazole glycerol phosphate synthase subunit HisF (Fragment) OS=Heliobacillus mobilis GN=hisF PE=3 SV=1 226 543 1.0E-45
sp|P60715|HIS6_GEOSL Imidazole glycerol phosphate synthase subunit HisF OS=Geobacter sulfurreducens (strain ATCC 51573 / DSM 12127 / PCA) GN=hisF PE=3 SV=1 226 541 1.0E-45
sp|A0LFI1|HIS6_SYNFM Imidazole glycerol phosphate synthase subunit HisF OS=Syntrophobacter fumaroxidans (strain DSM 10017 / MPOB) GN=hisF PE=3 SV=1 226 542 1.0E-45
sp|Q8XV85|HIS6_RALSO Imidazole glycerol phosphate synthase subunit HisF OS=Ralstonia solanacearum (strain GMI1000) GN=hisF PE=3 SV=1 226 542 1.0E-45
sp|B3QQ00|HIS6_CHLP8 Imidazole glycerol phosphate synthase subunit HisF OS=Chlorobaculum parvum (strain NCIB 8327) GN=hisF PE=3 SV=1 226 541 1.0E-45
sp|A7GMV0|HIS6_BACCN Imidazole glycerol phosphate synthase subunit HisF OS=Bacillus cytotoxicus (strain DSM 22905 / CIP 110041 / 391-98 / NVH 391-98) GN=hisF PE=3 SV=1 226 541 1.0E-45
sp|Q81G02|HIS6_BACCR Imidazole glycerol phosphate synthase subunit HisF OS=Bacillus cereus (strain ATCC 14579 / DSM 31 / JCM 2152 / NBRC 15305 / NCIMB 9373 / NRRL B-3711) GN=hisF PE=3 SV=1 226 541 1.0E-45
sp|Q2J8L3|HIS6_FRASC Imidazole glycerol phosphate synthase subunit HisF OS=Frankia sp. (strain CcI3) GN=hisF PE=3 SV=1 229 541 1.0E-45
sp|B2UQA2|HIS6_AKKM8 Imidazole glycerol phosphate synthase subunit HisF OS=Akkermansia muciniphila (strain ATCC BAA-835 / Muc) GN=hisF PE=3 SV=1 226 541 2.0E-45
sp|B4S9G0|HIS6_PROA2 Imidazole glycerol phosphate synthase subunit HisF OS=Prosthecochloris aestuarii (strain DSM 271 / SK 413) GN=hisF PE=3 SV=1 226 541 2.0E-45
sp|B3EEF2|HIS6_CHLL2 Imidazole glycerol phosphate synthase subunit HisF OS=Chlorobium limicola (strain DSM 245 / NBRC 103803) GN=hisF PE=3 SV=1 226 541 2.0E-45
sp|C6E7F4|HIS6_GEOSM Imidazole glycerol phosphate synthase subunit HisF OS=Geobacter sp. (strain M21) GN=hisF PE=3 SV=1 226 541 2.0E-45
sp|C1ATY7|HIS6_RHOOB Imidazole glycerol phosphate synthase subunit HisF OS=Rhodococcus opacus (strain B4) GN=hisF PE=3 SV=1 226 541 2.0E-45
sp|Q46WL8|HIS6_CUPPJ Imidazole glycerol phosphate synthase subunit HisF OS=Cupriavidus pinatubonensis (strain JMP 134 / LMG 1197) GN=hisF PE=3 SV=1 226 541 2.0E-45
sp|Q0SHY7|HIS6_RHOJR Imidazole glycerol phosphate synthase subunit HisF OS=Rhodococcus jostii (strain RHA1) GN=hisF PE=3 SV=1 226 541 2.0E-45
sp|B5EDR4|HIS6_GEOBB Imidazole glycerol phosphate synthase subunit HisF OS=Geobacter bemidjiensis (strain Bem / ATCC BAA-1014 / DSM 16622) GN=hisF PE=3 SV=1 226 541 3.0E-45
sp|A5WHT5|HIS6_PSYWF Imidazole glycerol phosphate synthase subunit HisF OS=Psychrobacter sp. (strain PRwf-1) GN=hisF PE=3 SV=1 226 541 3.0E-45
sp|C0QPQ6|HIS6_PERMH Imidazole glycerol phosphate synthase subunit HisF OS=Persephonella marina (strain DSM 14350 / EX-H1) GN=hisF PE=3 SV=1 226 541 3.0E-45
sp|B8FP24|HIS6_DESHD Imidazole glycerol phosphate synthase subunit HisF OS=Desulfitobacterium hafniense (strain DCB-2 / DSM 10664) GN=hisF PE=3 SV=1 226 542 3.0E-45
sp|Q11VM1|HIS6_CYTH3 Imidazole glycerol phosphate synthase subunit HisF OS=Cytophaga hutchinsonii (strain ATCC 33406 / NCIMB 9469) GN=hisF PE=3 SV=1 226 542 3.0E-45
sp|Q1IKB2|HIS6_KORVE Imidazole glycerol phosphate synthase subunit HisF OS=Koribacter versatilis (strain Ellin345) GN=hisF PE=3 SV=1 226 541 4.0E-45
sp|Q39YP2|HIS6_GEOMG Imidazole glycerol phosphate synthase subunit HisF OS=Geobacter metallireducens (strain GS-15 / ATCC 53774 / DSM 7210) GN=hisF PE=3 SV=1 226 541 4.0E-45
sp|Q1R080|HIS6_CHRSD Imidazole glycerol phosphate synthase subunit HisF OS=Chromohalobacter salexigens (strain DSM 3043 / ATCC BAA-138 / NCIMB 13768) GN=hisF PE=3 SV=1 226 541 4.0E-45
sp|Q24QJ5|HIS6_DESHY Imidazole glycerol phosphate synthase subunit HisF OS=Desulfitobacterium hafniense (strain Y51) GN=hisF PE=3 SV=1 226 542 4.0E-45
sp|A5CZ73|HIS6_PELTS Imidazole glycerol phosphate synthase subunit HisF OS=Pelotomaculum thermopropionicum (strain DSM 13744 / JCM 10971 / SI) GN=hisF PE=3 SV=1 226 541 4.0E-45
sp|A9WR62|HIS6_RENSM Imidazole glycerol phosphate synthase subunit HisF OS=Renibacterium salmoninarum (strain ATCC 33209 / DSM 20767 / JCM 11484 / NBRC 15589 / NCIMB 2235) GN=hisF PE=3 SV=1 229 541 5.0E-45
sp|Q3SEU8|HIS6_THIDA Imidazole glycerol phosphate synthase subunit HisF OS=Thiobacillus denitrificans (strain ATCC 25259) GN=hisF PE=3 SV=1 226 541 5.0E-45
sp|A6Q117|HIS6_NITSB Imidazole glycerol phosphate synthase subunit HisF OS=Nitratiruptor sp. (strain SB155-2) GN=hisF PE=3 SV=1 226 541 5.0E-45
sp|C1ANM7|HIS6_MYCBT Imidazole glycerol phosphate synthase subunit HisF OS=Mycobacterium bovis (strain BCG / Tokyo 172 / ATCC 35737 / TMC 1019) GN=hisF PE=3 SV=1 223 541 5.0E-45
sp|A1KJ21|HIS6_MYCBP Imidazole glycerol phosphate synthase subunit HisF OS=Mycobacterium bovis (strain BCG / Pasteur 1173P2) GN=hisF PE=3 SV=1 223 541 5.0E-45
sp|Q7VEW8|HIS6_MYCBO Imidazole glycerol phosphate synthase subunit HisF OS=Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97) GN=hisF PE=3 SV=1 223 541 5.0E-45
sp|A4SFU1|HIS6_CHLPM Imidazole glycerol phosphate synthase subunit HisF OS=Chlorobium phaeovibrioides (strain DSM 265 / 1930) GN=hisF PE=3 SV=1 226 541 6.0E-45
sp|A4G9I6|HIS6_HERAR Imidazole glycerol phosphate synthase subunit HisF OS=Herminiimonas arsenicoxydans GN=hisF PE=3 SV=1 226 541 6.0E-45
sp|B3Q951|HIS6_RHOPT Imidazole glycerol phosphate synthase subunit HisF OS=Rhodopseudomonas palustris (strain TIE-1) GN=hisF PE=3 SV=1 229 541 7.0E-45
sp|P60667|HIS6_RHOPA Imidazole glycerol phosphate synthase subunit HisF OS=Rhodopseudomonas palustris (strain ATCC BAA-98 / CGA009) GN=hisF PE=3 SV=1 229 541 7.0E-45
sp|P9WMM3|HIS6_MYCTU Imidazole glycerol phosphate synthase subunit HisF OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=hisF PE=1 SV=1 223 541 7.0E-45
sp|P9WMM2|HIS6_MYCTO Imidazole glycerol phosphate synthase subunit HisF OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) GN=hisF PE=3 SV=1 223 541 7.0E-45
sp|A5U2W1|HIS6_MYCTA Imidazole glycerol phosphate synthase subunit HisF OS=Mycobacterium tuberculosis (strain ATCC 25177 / H37Ra) GN=hisF PE=3 SV=1 223 541 7.0E-45
sp|Q1LIB2|HIS6_CUPMC Imidazole glycerol phosphate synthase subunit HisF OS=Cupriavidus metallidurans (strain ATCC 43123 / DSM 2839 / NBRC 102507 / CH34) GN=hisF PE=3 SV=1 226 542 8.0E-45
sp|A1BHP6|HIS6_CHLPD Imidazole glycerol phosphate synthase subunit HisF OS=Chlorobium phaeobacteroides (strain DSM 266) GN=hisF PE=3 SV=1 226 541 8.0E-45
sp|B1ILB0|HIS6_CLOBK Imidazole glycerol phosphate synthase subunit HisF OS=Clostridium botulinum (strain Okra / Type B1) GN=hisF PE=3 SV=1 226 541 8.0E-45
sp|C1EMQ7|HIS6_BACC3 Imidazole glycerol phosphate synthase subunit HisF OS=Bacillus cereus (strain 03BB102) GN=hisF PE=3 SV=1 226 541 9.0E-45
sp|A0RBM2|HIS6_BACAH Imidazole glycerol phosphate synthase subunit HisF OS=Bacillus thuringiensis (strain Al Hakam) GN=hisF PE=3 SV=1 226 541 9.0E-45
sp|A1KSN6|HIS6_NEIMF Imidazole glycerol phosphate synthase subunit HisF OS=Neisseria meningitidis serogroup C / serotype 2a (strain ATCC 700532 / DSM 15464 / FAM18) GN=hisF PE=3 SV=1 226 541 9.0E-45
sp|Q1H4R2|HIS6_METFK Imidazole glycerol phosphate synthase subunit HisF OS=Methylobacillus flagellatus (strain KT / ATCC 51484 / DSM 6875) GN=hisF PE=3 SV=1 226 541 9.0E-45
sp|Q9JVH5|HIS6_NEIMA Imidazole glycerol phosphate synthase subunit HisF OS=Neisseria meningitidis serogroup A / serotype 4A (strain Z2491) GN=hisF PE=3 SV=1 226 541 1.0E-44
sp|B4RJN3|HIS6_NEIG2 Imidazole glycerol phosphate synthase subunit HisF OS=Neisseria gonorrhoeae (strain NCCP11945) GN=hisF PE=3 SV=1 226 541 1.0E-44
sp|Q5FA23|HIS6_NEIG1 Imidazole glycerol phosphate synthase subunit HisF OS=Neisseria gonorrhoeae (strain ATCC 700825 / FA 1090) GN=hisF PE=3 SV=1 226 541 1.0E-44
sp|B3E617|HIS6_GEOLS Imidazole glycerol phosphate synthase subunit HisF OS=Geobacter lovleyi (strain ATCC BAA-1151 / DSM 17278 / SZ) GN=hisF PE=3 SV=1 226 541 1.0E-44
sp|B5EQF2|HIS6_ACIF5 Imidazole glycerol phosphate synthase subunit HisF OS=Acidithiobacillus ferrooxidans (strain ATCC 53993) GN=hisF PE=3 SV=1 226 541 1.0E-44
sp|B7JA19|HIS6_ACIF2 Imidazole glycerol phosphate synthase subunit HisF OS=Acidithiobacillus ferrooxidans (strain ATCC 23270 / DSM 14882 / CIP 104768 / NCIMB 8455) GN=hisF PE=3 SV=1 226 541 1.0E-44
sp|A9M2Q5|HIS6_NEIM0 Imidazole glycerol phosphate synthase subunit HisF OS=Neisseria meningitidis serogroup C (strain 053442) GN=hisF PE=3 SV=1 226 541 1.0E-44
sp|Q2J340|HIS6_RHOP2 Imidazole glycerol phosphate synthase subunit HisF OS=Rhodopseudomonas palustris (strain HaA2) GN=hisF PE=3 SV=1 229 541 1.0E-44
sp|Q07UQ9|HIS6_RHOP5 Imidazole glycerol phosphate synthase subunit HisF OS=Rhodopseudomonas palustris (strain BisA53) GN=hisF PE=3 SV=1 229 541 1.0E-44
sp|A6T376|HIS6_JANMA Imidazole glycerol phosphate synthase subunit HisF OS=Janthinobacterium sp. (strain Marseille) GN=hisF PE=3 SV=1 226 541 1.0E-44
sp|A9VLH7|HIS6_BACWK Imidazole glycerol phosphate synthase subunit HisF OS=Bacillus weihenstephanensis (strain KBAB4) GN=hisF PE=3 SV=1 226 541 1.0E-44
sp|Q21U91|HIS6_RHOFT Imidazole glycerol phosphate synthase subunit HisF OS=Rhodoferax ferrireducens (strain ATCC BAA-621 / DSM 15236 / T118) GN=hisF PE=3 SV=1 226 541 1.0E-44
sp|A4YJV5|HIS6_BRASO Imidazole glycerol phosphate synthase subunit HisF OS=Bradyrhizobium sp. (strain ORS278) GN=hisF PE=3 SV=1 229 541 1.0E-44
sp|B8FFL4|HIS6_DESAA Imidazole glycerol phosphate synthase subunit HisF OS=Desulfatibacillum alkenivorans (strain AK-01) GN=hisF PE=3 SV=1 226 541 2.0E-44
sp|A8HYT7|HIS6_AZOC5 Imidazole glycerol phosphate synthase subunit HisF OS=Azorhizobium caulinodans (strain ATCC 43989 / DSM 5975 / JCM 20966 / NBRC 14845 / NCIMB 13405 / ORS 571) GN=hisF PE=3 SV=1 226 542 2.0E-44
sp|Q3A137|HIS6_PELCD Imidazole glycerol phosphate synthase subunit HisF OS=Pelobacter carbinolicus (strain DSM 2380 / Gra Bd 1) GN=hisF PE=3 SV=1 226 541 2.0E-44
sp|Q5KVD0|HIS6_GEOKA Imidazole glycerol phosphate synthase subunit HisF OS=Geobacillus kaustophilus (strain HTA426) GN=hisF PE=3 SV=1 226 541 2.0E-44
sp|A0AG15|HIS6_LISW6 Imidazole glycerol phosphate synthase subunit HisF OS=Listeria welshimeri serovar 6b (strain ATCC 35897 / DSM 20650 / SLCC5334) GN=hisF PE=3 SV=1 226 541 2.0E-44
sp|Q6AF73|HIS6_LEIXX Imidazole glycerol phosphate synthase subunit HisF OS=Leifsonia xyli subsp. xyli (strain CTCB07) GN=hisF PE=3 SV=1 225 541 2.0E-44
sp|A8ZVD2|HIS6_DESOH Imidazole glycerol phosphate synthase subunit HisF OS=Desulfococcus oleovorans (strain DSM 6200 / Hxd3) GN=hisF PE=3 SV=1 226 542 2.0E-44
sp|Q9K0H4|HIS6_NEIMB Imidazole glycerol phosphate synthase subunit HisF OS=Neisseria meningitidis serogroup B (strain MC58) GN=hisF PE=3 SV=1 226 541 2.0E-44
sp|A1KAV4|HIS6_AZOSB Imidazole glycerol phosphate synthase subunit HisF OS=Azoarcus sp. (strain BH72) GN=hisF PE=3 SV=1 226 541 2.0E-44
sp|A5I246|HIS6_CLOBH Imidazole glycerol phosphate synthase subunit HisF OS=Clostridium botulinum (strain Hall / ATCC 3502 / NCTC 13319 / Type A) GN=hisF PE=3 SV=1 226 541 3.0E-44
sp|A7FU82|HIS6_CLOB1 Imidazole glycerol phosphate synthase subunit HisF OS=Clostridium botulinum (strain ATCC 19397 / Type A) GN=hisF PE=3 SV=1 226 541 3.0E-44
sp|Q8DTR3|HIS6_STRMU Imidazole glycerol phosphate synthase subunit HisF OS=Streptococcus mutans serotype c (strain ATCC 700610 / UA159) GN=hisF PE=3 SV=1 226 541 4.0E-44
sp|Q3AD48|HIS6_CARHZ Imidazole glycerol phosphate synthase subunit HisF OS=Carboxydothermus hydrogenoformans (strain ATCC BAA-161 / DSM 6008 / Z-2901) GN=hisF PE=3 SV=1 226 541 4.0E-44
sp|A8FHQ9|HIS6_BACP2 Imidazole glycerol phosphate synthase subunit HisF OS=Bacillus pumilus (strain SAFR-032) GN=hisF PE=3 SV=1 226 541 4.0E-44
sp|B7HKD4|HIS6_BACC7 Imidazole glycerol phosphate synthase subunit HisF OS=Bacillus cereus (strain AH187) GN=hisF PE=3 SV=1 226 541 5.0E-44
sp|B8J216|HIS6_DESDA Imidazole glycerol phosphate synthase subunit HisF OS=Desulfovibrio desulfuricans (strain ATCC 27774 / DSM 6949) GN=hisF PE=3 SV=1 226 541 5.0E-44
sp|Q1QRX0|HIS6_NITHX Imidazole glycerol phosphate synthase subunit HisF OS=Nitrobacter hamburgensis (strain X14 / DSM 10229) GN=hisF PE=3 SV=1 229 541 5.0E-44
sp|Q12FC7|HIS6_POLSJ Imidazole glycerol phosphate synthase subunit HisF OS=Polaromonas sp. (strain JS666 / ATCC BAA-500) GN=hisF PE=3 SV=1 226 541 5.0E-44
sp|C4XS73|HIS6_DESMR Imidazole glycerol phosphate synthase subunit HisF OS=Desulfovibrio magneticus (strain ATCC 700980 / DSM 13731 / RS-1) GN=hisF PE=3 SV=1 226 543 6.0E-44
sp|A8EQW5|HIS6_ARCB4 Imidazole glycerol phosphate synthase subunit HisF OS=Arcobacter butzleri (strain RM4018) GN=hisF PE=3 SV=1 224 541 6.0E-44
sp|B4SFM7|HIS6_PELPB Imidazole glycerol phosphate synthase subunit HisF OS=Pelodictyon phaeoclathratiforme (strain DSM 5477 / BU-1) GN=hisF PE=3 SV=1 226 541 6.0E-44
sp|A7GDQ7|HIS6_CLOBL Imidazole glycerol phosphate synthase subunit HisF OS=Clostridium botulinum (strain Langeland / NCTC 10281 / Type F) GN=hisF PE=3 SV=1 226 541 6.0E-44
sp|Q13E40|HIS6_RHOPS Imidazole glycerol phosphate synthase subunit HisF OS=Rhodopseudomonas palustris (strain BisB5) GN=hisF PE=3 SV=1 229 541 6.0E-44
sp|C1FN42|HIS6_CLOBJ Imidazole glycerol phosphate synthase subunit HisF OS=Clostridium botulinum (strain Kyoto / Type A2) GN=hisF PE=3 SV=1 226 541 7.0E-44
sp|Q63DW8|HIS6_BACCZ Imidazole glycerol phosphate synthase subunit HisF OS=Bacillus cereus (strain ZK / E33L) GN=hisF PE=3 SV=1 226 541 7.0E-44
sp|B7JFZ5|HIS6_BACC0 Imidazole glycerol phosphate synthase subunit HisF OS=Bacillus cereus (strain AH820) GN=hisF PE=3 SV=1 226 541 7.0E-44
sp|A9GBI6|HIS6_SORC5 Imidazole glycerol phosphate synthase subunit HisF OS=Sorangium cellulosum (strain So ce56) GN=hisF PE=3 SV=1 226 541 7.0E-44
sp|Q21CK1|HIS6_RHOPB Imidazole glycerol phosphate synthase subunit HisF OS=Rhodopseudomonas palustris (strain BisB18) GN=hisF PE=3 SV=1 229 541 8.0E-44
sp|Q4A049|HIS6_STAS1 Imidazole glycerol phosphate synthase subunit HisF OS=Staphylococcus saprophyticus subsp. saprophyticus (strain ATCC 15305 / DSM 20229) GN=hisF PE=3 SV=1 226 541 1.0E-43
sp|A6WC96|HIS6_KINRD Imidazole glycerol phosphate synthase subunit HisF OS=Kineococcus radiotolerans (strain ATCC BAA-149 / DSM 14245 / SRS30216) GN=hisF PE=3 SV=1 229 541 1.0E-43
sp|A4ISR2|HIS6_GEOTN Imidazole glycerol phosphate synthase subunit HisF OS=Geobacillus thermodenitrificans (strain NG80-2) GN=hisF PE=3 SV=1 226 541 1.0E-43
sp|A1SL56|HIS6_NOCSJ Imidazole glycerol phosphate synthase subunit HisF OS=Nocardioides sp. (strain BAA-499 / JS614) GN=hisF PE=3 SV=1 226 541 1.0E-43
sp|A6QCU4|HIS6_SULNB Imidazole glycerol phosphate synthase subunit HisF OS=Sulfurovum sp. (strain NBC37-1) GN=hisF PE=3 SV=1 226 541 1.0E-43
sp|B9IV00|HIS6_BACCQ Imidazole glycerol phosphate synthase subunit HisF OS=Bacillus cereus (strain Q1) GN=hisF PE=3 SV=1 226 541 1.0E-43
sp|A1VK42|HIS6_POLNA Imidazole glycerol phosphate synthase subunit HisF OS=Polaromonas naphthalenivorans (strain CJ2) GN=hisF PE=3 SV=1 226 541 2.0E-43
sp|B4U7M4|HIS6_HYDS0 Imidazole glycerol phosphate synthase subunit HisF OS=Hydrogenobaculum sp. (strain Y04AAS1) GN=hisF PE=3 SV=1 226 541 2.0E-43
sp|B7GQS5|HIS6_BIFLS Imidazole glycerol phosphate synthase subunit HisF OS=Bifidobacterium longum subsp. infantis (strain ATCC 15697 / DSM 20088 / JCM 1222 / NCTC 11817 / S12) GN=hisF PE=3 SV=1 226 541 2.0E-43
sp|Q89WM4|HIS6_BRADU Imidazole glycerol phosphate synthase subunit HisF OS=Bradyrhizobium diazoefficiens (strain JCM 10833 / IAM 13628 / NBRC 14792 / USDA 110) GN=hisF PE=3 SV=1 229 541 2.0E-43
sp|Q3SWF1|HIS6_NITWN Imidazole glycerol phosphate synthase subunit HisF OS=Nitrobacter winogradskyi (strain Nb-255 / ATCC 25391) GN=hisF PE=3 SV=1 229 541 2.0E-43
sp|A3DJF7|HIS6_CLOTH Imidazole glycerol phosphate synthase subunit HisF OS=Clostridium thermocellum (strain ATCC 27405 / DSM 1237 / NBRC 103400 / NCIMB 10682 / NRRL B-4536 / VPI 7372) GN=hisF PE=3 SV=1 226 542 2.0E-43
sp|Q0A5D3|HIS6_ALKEH Imidazole glycerol phosphate synthase subunit HisF OS=Alkalilimnicola ehrlichii (strain ATCC BAA-1101 / DSM 17681 / MLHE-1) GN=hisF PE=3 SV=1 226 541 3.0E-43
sp|B3PGA4|HIS6_CELJU Imidazole glycerol phosphate synthase subunit HisF OS=Cellvibrio japonicus (strain Ueda107) GN=hisF PE=3 SV=1 226 541 3.0E-43
sp|Q3ATG0|HIS6_CHLCH Imidazole glycerol phosphate synthase subunit HisF OS=Chlorobium chlorochromatii (strain CaD3) GN=hisF PE=3 SV=1 226 541 4.0E-43
sp|A9KP30|HIS6_CLOPH Imidazole glycerol phosphate synthase subunit HisF OS=Clostridium phytofermentans (strain ATCC 700394 / DSM 18823 / ISDg) GN=hisF PE=3 SV=1 227 541 4.0E-43
sp|P62449|HIS6_BACC1 Imidazole glycerol phosphate synthase subunit HisF OS=Bacillus cereus (strain ATCC 10987 / NRS 248) GN=hisF PE=3 SV=1 226 541 4.0E-43
sp|Q9X7C2|HIS6_MYCLE Imidazole glycerol phosphate synthase subunit HisF OS=Mycobacterium leprae (strain TN) GN=hisF PE=3 SV=1 224 541 4.0E-43
sp|B8ZRB4|HIS6_MYCLB Imidazole glycerol phosphate synthase subunit HisF OS=Mycobacterium leprae (strain Br4923) GN=hisF PE=3 SV=1 224 541 4.0E-43
sp|A5E8E5|HIS6_BRASB Imidazole glycerol phosphate synthase subunit HisF OS=Bradyrhizobium sp. (strain BTAi1 / ATCC BAA-1182) GN=hisF PE=3 SV=1 229 541 5.0E-43
sp|C3KVX6|HIS6_CLOB6 Imidazole glycerol phosphate synthase subunit HisF OS=Clostridium botulinum (strain 657 / Type Ba4) GN=hisF PE=3 SV=1 226 541 5.0E-43
sp|Q5JFU8|HIS6_THEKO Imidazole glycerol phosphate synthase subunit HisF OS=Thermococcus kodakarensis (strain ATCC BAA-918 / JCM 12380 / KOD1) GN=hisF PE=3 SV=1 226 541 6.0E-43
sp|Q6HLE3|HIS6_BACHK Imidazole glycerol phosphate synthase subunit HisF OS=Bacillus thuringiensis subsp. konkukian (strain 97-27) GN=hisF PE=3 SV=1 226 541 6.0E-43
sp|Q81T58|HIS6_BACAN Imidazole glycerol phosphate synthase subunit HisF OS=Bacillus anthracis GN=hisF PE=3 SV=1 226 541 6.0E-43
sp|C3L9P7|HIS6_BACAC Imidazole glycerol phosphate synthase subunit HisF OS=Bacillus anthracis (strain CDC 684 / NRRL 3495) GN=hisF PE=3 SV=1 226 541 6.0E-43
sp|C3P506|HIS6_BACAA Imidazole glycerol phosphate synthase subunit HisF OS=Bacillus anthracis (strain A0248) GN=hisF PE=3 SV=1 226 541 6.0E-43
sp|Q722Y7|HIS6_LISMF Imidazole glycerol phosphate synthase subunit HisF OS=Listeria monocytogenes serotype 4b (strain F2365) GN=hisF PE=3 SV=1 226 541 6.0E-43
sp|C1L0J2|HIS6_LISMC Imidazole glycerol phosphate synthase subunit HisF OS=Listeria monocytogenes serotype 4b (strain CLIP80459) GN=hisF PE=3 SV=1 226 541 6.0E-43
sp|A0JVK5|HIS6_ARTS2 Imidazole glycerol phosphate synthase subunit HisF OS=Arthrobacter sp. (strain FB24) GN=hisF PE=3 SV=1 229 541 6.0E-43
sp|Q3B2Q6|HIS6_CHLL7 Imidazole glycerol phosphate synthase subunit HisF OS=Chlorobium luteolum (strain DSM 273 / 2530) GN=hisF PE=3 SV=1 226 541 7.0E-43
sp|B2A6X0|HIS6_NATTJ Imidazole glycerol phosphate synthase subunit HisF OS=Natranaerobius thermophilus (strain ATCC BAA-1301 / DSM 18059 / JW/NM-WN-LF) GN=hisF PE=3 SV=1 226 541 7.0E-43
sp|B3DRT8|HIS6_BIFLD Imidazole glycerol phosphate synthase subunit HisF OS=Bifidobacterium longum (strain DJO10A) GN=hisF PE=3 SV=1 226 541 8.0E-43
sp|A1VGY9|HIS6_DESVV Imidazole glycerol phosphate synthase subunit HisF OS=Desulfovibrio vulgaris subsp. vulgaris (strain DP4) GN=hisF PE=3 SV=1 226 542 9.0E-43
sp|P62450|HIS6_DESVH Imidazole glycerol phosphate synthase subunit HisF OS=Desulfovibrio vulgaris (strain Hildenborough / ATCC 29579 / NCIMB 8303) GN=hisF PE=3 SV=1 226 542 9.0E-43
sp|A3M9P1|HIS6_ACIBT Imidazole glycerol phosphate synthase subunit HisF OS=Acinetobacter baumannii (strain ATCC 17978 / CIP 53.77 / LMG 1025 / NCDC KC755 / 5377) GN=hisF PE=3 SV=2 226 541 1.0E-42
sp|B2I0P3|HIS6_ACIBC Imidazole glycerol phosphate synthase subunit HisF OS=Acinetobacter baumannii (strain ACICU) GN=hisF PE=3 SV=1 226 541 1.0E-42
sp|B7IBD7|HIS6_ACIB5 Imidazole glycerol phosphate synthase subunit HisF OS=Acinetobacter baumannii (strain AB0057) GN=hisF PE=3 SV=1 226 541 1.0E-42
sp|B7GVJ5|HIS6_ACIB3 Imidazole glycerol phosphate synthase subunit HisF OS=Acinetobacter baumannii (strain AB307-0294) GN=hisF PE=3 SV=1 226 541 1.0E-42
sp|A1WR24|HIS6_VEREI Imidazole glycerol phosphate synthase subunit HisF OS=Verminephrobacter eiseniae (strain EF01-2) GN=hisF PE=3 SV=1 226 542 1.0E-42
sp|Q4FNT7|HIS6_PELUB Imidazole glycerol phosphate synthase subunit HisF OS=Pelagibacter ubique (strain HTCC1062) GN=hisF PE=3 SV=1 226 541 1.0E-42
sp|Q3MEF5|HIS6_ANAVT Imidazole glycerol phosphate synthase subunit HisF OS=Anabaena variabilis (strain ATCC 29413 / PCC 7937) GN=hisF PE=3 SV=1 226 543 1.0E-42
sp|B9LFN2|HIS6_CHLSY Imidazole glycerol phosphate synthase subunit HisF OS=Chloroflexus aurantiacus (strain ATCC 29364 / DSM 637 / Y-400-fl) GN=hisF PE=3 SV=1 226 543 1.0E-42
sp|A9WD80|HIS6_CHLAA Imidazole glycerol phosphate synthase subunit HisF OS=Chloroflexus aurantiacus (strain ATCC 29366 / DSM 635 / J-10-fl) GN=hisF PE=3 SV=1 226 543 1.0E-42
sp|Q8YT31|HIS6_NOSS1 Imidazole glycerol phosphate synthase subunit HisF OS=Nostoc sp. (strain PCC 7120 / UTEX 2576) GN=hisF PE=3 SV=1 226 543 1.0E-42
sp|A9BXA1|HIS6_DELAS Imidazole glycerol phosphate synthase subunit HisF OS=Delftia acidovorans (strain DSM 14801 / SPH-1) GN=hisF PE=3 SV=1 226 541 2.0E-42
sp|B8DQX6|HIS6_DESVM Imidazole glycerol phosphate synthase subunit HisF OS=Desulfovibrio vulgaris (strain Miyazaki F / DSM 19637) GN=hisF PE=3 SV=1 226 542 2.0E-42
sp|Q9S2T7|HIS6_STRCO Imidazole glycerol phosphate synthase subunit HisF OS=Streptomyces coelicolor (strain ATCC BAA-471 / A3(2) / M145) GN=hisF PE=3 SV=1 226 541 2.0E-42
sp|A5UY52|HIS6_ROSS1 Imidazole glycerol phosphate synthase subunit HisF OS=Roseiflexus sp. (strain RS-1) GN=hisF PE=3 SV=1 226 541 2.0E-42
sp|C5CQK0|HIS6_VARPS Imidazole glycerol phosphate synthase subunit HisF OS=Variovorax paradoxus (strain S110) GN=hisF PE=3 SV=1 226 541 2.0E-42
sp|A7IHN9|HIS6_XANP2 Imidazole glycerol phosphate synthase subunit HisF OS=Xanthobacter autotrophicus (strain ATCC BAA-1158 / Py2) GN=hisF PE=3 SV=1 226 541 3.0E-42
sp|B8DUB2|HIS6_BIFA0 Imidazole glycerol phosphate synthase subunit HisF OS=Bifidobacterium animalis subsp. lactis (strain AD011) GN=hisF PE=3 SV=1 226 541 3.0E-42
sp|Q8G6F7|HIS6_BIFLO Imidazole glycerol phosphate synthase subunit HisF OS=Bifidobacterium longum (strain NCC 2705) GN=hisF PE=3 SV=1 226 541 3.0E-42
sp|B5YIB7|HIS6_THEYD Imidazole glycerol phosphate synthase subunit HisF OS=Thermodesulfovibrio yellowstonii (strain ATCC 51303 / DSM 11347 / YP87) GN=hisF PE=3 SV=1 226 541 4.0E-42
sp|Q8Y9G5|HIS6_LISMO Imidazole glycerol phosphate synthase subunit HisF OS=Listeria monocytogenes serovar 1/2a (strain ATCC BAA-679 / EGD-e) GN=hisF PE=3 SV=1 226 541 5.0E-42
sp|B7GL45|HIS6_ANOFW Imidazole glycerol phosphate synthase subunit HisF OS=Anoxybacillus flavithermus (strain DSM 21510 / WK1) GN=hisF PE=3 SV=1 226 541 5.0E-42
sp|A9BE47|HIS6_PROM4 Imidazole glycerol phosphate synthase subunit HisF OS=Prochlorococcus marinus (strain MIT 9211) GN=hisF PE=3 SV=1 229 541 7.0E-42
sp|B6JCG5|HIS6_OLICO Imidazole glycerol phosphate synthase subunit HisF OS=Oligotropha carboxidovorans (strain ATCC 49405 / DSM 1227 / OM5) GN=hisF PE=3 SV=1 229 541 9.0E-42
sp|B8GBF3|HIS6_CHLAD Imidazole glycerol phosphate synthase subunit HisF OS=Chloroflexus aggregans (strain MD-66 / DSM 9485) GN=hisF PE=3 SV=1 226 545 1.0E-41
sp|Q4J8I9|HIS6_SULAC Imidazole glycerol phosphate synthase subunit HisF OS=Sulfolobus acidocaldarius (strain ATCC 33909 / DSM 639 / JCM 8929 / NBRC 15157 / NCIMB 11770) GN=hisF PE=3 SV=1 227 542 1.0E-41
sp|Q9RPQ4|HIS6_THEP3 Imidazole glycerol phosphate synthase subunit HisF OS=Thermoanaerobacter pseudethanolicus (strain ATCC 33223 / 39E) GN=hisF PE=3 SV=1 226 542 1.0E-41
sp|C5A7A2|HIS6_THEGJ Imidazole glycerol phosphate synthase subunit HisF OS=Thermococcus gammatolerans (strain DSM 15229 / JCM 11827 / EJ3) GN=hisF PE=3 SV=1 226 541 2.0E-41
sp|Q6A7Y8|HIS6_PROAC Imidazole glycerol phosphate synthase subunit HisF OS=Propionibacterium acnes (strain KPA171202 / DSM 16379) GN=hisF PE=3 SV=1 229 541 2.0E-41
sp|B1ZX57|HIS6_OPITP Imidazole glycerol phosphate synthase subunit HisF OS=Opitutus terrae (strain DSM 11246 / PB90-1) GN=hisF PE=3 SV=1 226 541 2.0E-41
sp|C5CBK1|HIS6_MICLC Imidazole glycerol phosphate synthase subunit HisF OS=Micrococcus luteus (strain ATCC 4698 / DSM 20030 / JCM 1464 / NBRC 3333 / NCIMB 9278 / NCTC 2665 / VKM Ac-2230) GN=hisF PE=3 SV=1 226 541 2.0E-41
sp|Q316L4|HIS6_DESAG Imidazole glycerol phosphate synthase subunit HisF OS=Desulfovibrio alaskensis (strain G20) GN=hisF PE=3 SV=1 226 541 2.0E-41
sp|P26721|HIS6_AZOBR Imidazole glycerol phosphate synthase subunit HisF OS=Azospirillum brasilense GN=hisF PE=3 SV=1 226 541 3.0E-41
sp|Q6F799|HIS6_ACIAD Imidazole glycerol phosphate synthase subunit HisF OS=Acinetobacter baylyi (strain ATCC 33305 / BD413 / ADP1) GN=hisF PE=3 SV=2 226 541 3.0E-41
sp|O34727|HIS6_BACSU Imidazole glycerol phosphate synthase subunit HisF OS=Bacillus subtilis (strain 168) GN=hisF PE=3 SV=1 226 541 3.0E-41
sp|A1R5S1|HIS6_ARTAT Imidazole glycerol phosphate synthase subunit HisF OS=Arthrobacter aurescens (strain TC1) GN=hisF PE=3 SV=1 229 541 4.0E-41
sp|B2GGU9|HIS6_KOCRD Imidazole glycerol phosphate synthase subunit HisF OS=Kocuria rhizophila (strain ATCC 9341 / DSM 348 / NBRC 103217 / DC2201) GN=hisF PE=3 SV=1 225 541 4.0E-41
sp|A5CXY8|HIS6_VESOH Imidazole glycerol phosphate synthase subunit HisF OS=Vesicomyosocius okutanii subsp. Calyptogena okutanii (strain HA) GN=hisF PE=3 SV=1 226 541 4.0E-41
sp|Q65EG3|HIS6_BACLD Imidazole glycerol phosphate synthase subunit HisF OS=Bacillus licheniformis (strain ATCC 14580 / DSM 13 / JCM 2505 / NBRC 12200 / NCIMB 9375 / NRRL NRS-1264 / Gibson 46) GN=hisF PE=3 SV=1 226 541 4.0E-41
sp|C1FAD8|HIS6_ACIC5 Imidazole glycerol phosphate synthase subunit HisF OS=Acidobacterium capsulatum (strain ATCC 51196 / DSM 11244 / JCM 7670 / NBRC 15755 / NCIMB 13165 / 161) GN=hisF PE=3 SV=1 226 541 5.0E-41
sp|Q82A99|HIS6_STRAW Imidazole glycerol phosphate synthase subunit HisF OS=Streptomyces avermitilis (strain ATCC 31267 / DSM 46492 / JCM 5070 / NBRC 14893 / NCIMB 12804 / NRRL 8165 / MA-4680) GN=hisF PE=3 SV=1 226 541 5.0E-41
sp|Q8ESS2|HIS6_OCEIH Imidazole glycerol phosphate synthase subunit HisF OS=Oceanobacillus iheyensis (strain DSM 14371 / JCM 11309 / KCTC 3954 / HTE831) GN=hisF PE=3 SV=1 226 542 6.0E-41
sp|A1WW05|HIS6_HALHL Imidazole glycerol phosphate synthase subunit HisF OS=Halorhodospira halophila (strain DSM 244 / SL1) GN=hisF PE=3 SV=1 228 542 6.0E-41
sp|Q02YX1|HIS6_LACLS Imidazole glycerol phosphate synthase subunit HisF OS=Lactococcus lactis subsp. cremoris (strain SK11) GN=hisF PE=3 SV=1 226 533 7.0E-41
sp|B8I5V6|HIS6_CLOCE Imidazole glycerol phosphate synthase subunit HisF OS=Clostridium cellulolyticum (strain ATCC 35319 / DSM 5812 / JCM 6584 / H10) GN=hisF PE=3 SV=1 226 541 7.0E-41
sp|C4L176|HIS6_EXISA Imidazole glycerol phosphate synthase subunit HisF OS=Exiguobacterium sp. (strain ATCC BAA-1283 / AT1b) GN=hisF PE=3 SV=1 226 548 9.0E-41
sp|Q02133|HIS6_LACLA Imidazole glycerol phosphate synthase subunit HisF OS=Lactococcus lactis subsp. lactis (strain IL1403) GN=hisF PE=3 SV=3 226 541 1.0E-40
sp|B2UX20|HIS6_CLOBA Imidazole glycerol phosphate synthase subunit HisF OS=Clostridium botulinum (strain Alaska E43 / Type E3) GN=hisF PE=3 SV=1 227 541 1.0E-40
sp|A1AV74|HIS6_RUTMC Imidazole glycerol phosphate synthase subunit HisF OS=Ruthia magnifica subsp. Calyptogena magnifica GN=hisF PE=3 SV=1 226 541 1.0E-40
sp|Q67KI0|HIS6_SYMTH Imidazole glycerol phosphate synthase subunit HisF OS=Symbiobacterium thermophilum (strain T / IAM 14863) GN=hisF PE=3 SV=1 226 541 1.0E-40
sp|A7ZGB2|HIS6_CAMC1 Imidazole glycerol phosphate synthase subunit HisF OS=Campylobacter concisus (strain 13826) GN=hisF PE=3 SV=1 226 541 1.0E-40
sp|Q8ZY16|HIS6_PYRAE Imidazole glycerol phosphate synthase subunit HisF OS=Pyrobaculum aerophilum (strain ATCC 51768 / IM2 / DSM 7523 / JCM 9630 / NBRC 100827) GN=hisF PE=1 SV=1 229 541 2.0E-40
sp|A2SE09|HIS6_METPP Imidazole glycerol phosphate synthase subunit HisF OS=Methylibium petroleiphilum (strain PM1) GN=hisF PE=3 SV=1 226 542 2.0E-40
sp|A2RKR7|HIS6_LACLM Imidazole glycerol phosphate synthase subunit HisF OS=Lactococcus lactis subsp. cremoris (strain MG1363) GN=hisF PE=3 SV=1 226 533 2.0E-40
sp|Q88UE3|HIS6_LACPL Imidazole glycerol phosphate synthase subunit HisF OS=Lactobacillus plantarum (strain ATCC BAA-793 / NCIMB 8826 / WCFS1) GN=hisF PE=3 SV=1 226 541 2.0E-40
sp|B1W0M6|HIS6_STRGG Imidazole glycerol phosphate synthase subunit HisF OS=Streptomyces griseus subsp. griseus (strain JCM 4626 / NBRC 13350) GN=hisF PE=3 SV=1 226 541 2.0E-40
sp|Q3M5W4|HIS5_ANAVT Imidazole glycerol phosphate synthase subunit HisH OS=Anabaena variabilis (strain ATCC 29413 / PCC 7937) GN=hisH PE=3 SV=1 1 202 3.0E-40
sp|A9BJZ9|HIS6_PETMO Imidazole glycerol phosphate synthase subunit HisF OS=Petrotoga mobilis (strain DSM 10674 / SJ95) GN=hisF PE=3 SV=1 226 541 4.0E-40
sp|B8H6U2|HIS6_ARTCA Imidazole glycerol phosphate synthase subunit HisF OS=Arthrobacter chlorophenolicus (strain ATCC 700700 / DSM 12829 / JCM 12360 / NCIMB 13794 / A6) GN=hisF PE=3 SV=1 229 541 4.0E-40
sp|A3CNT0|HIS6_STRSV Imidazole glycerol phosphate synthase subunit HisF OS=Streptococcus sanguinis (strain SK36) GN=hisF PE=3 SV=1 226 541 5.0E-40
sp|B8EM84|HIS6_METSB Imidazole glycerol phosphate synthase subunit HisF OS=Methylocella silvestris (strain BL2 / DSM 15510 / NCIMB 13906) GN=hisF PE=3 SV=1 226 541 5.0E-40
sp|Q7MAS1|HIS6_WOLSU Imidazole glycerol phosphate synthase subunit HisF OS=Wolinella succinogenes (strain ATCC 29543 / DSM 1740 / LMG 7466 / NCTC 11488 / FDC 602W) GN=hisF PE=3 SV=1 226 541 5.0E-40
sp|B3QSI0|HIS6_CHLT3 Imidazole glycerol phosphate synthase subunit HisF OS=Chloroherpeton thalassium (strain ATCC 35110 / GB-78) GN=hisF PE=3 SV=1 226 541 6.0E-40
sp|B2J1A3|HIS5_NOSP7 Imidazole glycerol phosphate synthase subunit HisH OS=Nostoc punctiforme (strain ATCC 29133 / PCC 73102) GN=hisH PE=3 SV=1 1 201 8.0E-40
sp|Q8DJN7|HIS6_THEEB Imidazole glycerol phosphate synthase subunit HisF OS=Thermosynechococcus elongatus (strain BP-1) GN=hisF PE=3 SV=1 226 544 9.0E-40
sp|P74106|HIS6_SYNY3 Imidazole glycerol phosphate synthase subunit HisF OS=Synechocystis sp. (strain PCC 6803 / Kazusa) GN=hisF PE=3 SV=1 226 542 9.0E-40
sp|B0JY78|HIS6_MICAN Imidazole glycerol phosphate synthase subunit HisF OS=Microcystis aeruginosa (strain NIES-843) GN=hisF PE=3 SV=1 226 541 9.0E-40
sp|Q5FTN3|HIS6_GLUOX Imidazole glycerol phosphate synthase subunit HisF OS=Gluconobacter oxydans (strain 621H) GN=hisF PE=3 SV=1 226 544 1.0E-39
sp|B8HUR1|HIS5_CYAP4 Imidazole glycerol phosphate synthase subunit HisH OS=Cyanothece sp. (strain PCC 7425 / ATCC 29141) GN=hisH PE=3 SV=1 1 202 2.0E-39
sp|B6IWI7|HIS6_RHOCS Imidazole glycerol phosphate synthase subunit HisF OS=Rhodospirillum centenum (strain ATCC 51521 / SW) GN=hisF PE=3 SV=1 226 541 2.0E-39
sp|Q7NDC1|HIS6_GLOVI Imidazole glycerol phosphate synthase subunit HisF OS=Gloeobacter violaceus (strain PCC 7421) GN=hisF PE=3 SV=1 226 542 2.0E-39
sp|B1YL09|HIS6_EXIS2 Imidazole glycerol phosphate synthase subunit HisF OS=Exiguobacterium sibiricum (strain DSM 17290 / JCM 13490 / 255-15) GN=hisF PE=3 SV=1 226 541 3.0E-39
sp|P59119|HIS6_LEPIN Imidazole glycerol phosphate synthase subunit HisF OS=Leptospira interrogans serogroup Icterohaemorrhagiae serovar Lai (strain 56601) GN=hisF PE=3 SV=1 224 541 3.0E-39
sp|P62451|HIS6_LEPIC Imidazole glycerol phosphate synthase subunit HisF OS=Leptospira interrogans serogroup Icterohaemorrhagiae serovar copenhageni (strain Fiocruz L1-130) GN=hisF PE=3 SV=1 224 541 3.0E-39
sp|Q7VGZ1|HIS6_HELHP Imidazole glycerol phosphate synthase subunit HisF OS=Helicobacter hepaticus (strain ATCC 51449 / 3B1) GN=hisF PE=3 SV=1 226 541 3.0E-39
sp|A2C0N7|HIS6_PROM1 Imidazole glycerol phosphate synthase subunit HisF OS=Prochlorococcus marinus (strain NATL1A) GN=hisF PE=3 SV=1 229 544 3.0E-39
sp|B0BYP8|HIS5_ACAM1 Imidazole glycerol phosphate synthase subunit HisH OS=Acaryochloris marina (strain MBIC 11017) GN=hisH PE=3 SV=1 1 201 4.0E-39
sp|A8AY24|HIS6_STRGC Imidazole glycerol phosphate synthase subunit HisF OS=Streptococcus gordonii (strain Challis / ATCC 35105 / CH1 / DL1 / V288) GN=hisF PE=3 SV=1 226 541 5.0E-39
sp|Q2JVR1|HIS5_SYNJA Imidazole glycerol phosphate synthase subunit HisH OS=Synechococcus sp. (strain JA-3-3Ab) GN=hisH PE=3 SV=1 6 201 5.0E-39
sp|Q8DIP5|HIS5_THEEB Imidazole glycerol phosphate synthase subunit HisH OS=Thermosynechococcus elongatus (strain BP-1) GN=hisH PE=3 SV=1 2 201 6.0E-39
sp|Q18C74|HIS6_PEPD6 Imidazole glycerol phosphate synthase subunit HisF OS=Peptoclostridium difficile (strain 630) GN=hisF PE=3 SV=1 226 541 7.0E-39
sp|Q5WDI2|HIS6_BACSK Imidazole glycerol phosphate synthase subunit HisF OS=Bacillus clausii (strain KSM-K16) GN=hisF PE=3 SV=1 226 541 8.0E-39
sp|A7Z962|HIS6_BACMF Imidazole glycerol phosphate synthase subunit HisF OS=Bacillus methylotrophicus (strain DSM 23117 / BGSC 10A6 / FZB42) GN=hisF PE=3 SV=1 226 541 8.0E-39
sp|C5BV99|HIS6_BEUC1 Imidazole glycerol phosphate synthase subunit HisF OS=Beutenbergia cavernae (strain ATCC BAA-8 / DSM 12333 / NBRC 16432) GN=hisF PE=3 SV=1 229 541 8.0E-39
sp|B7KPM8|HIS6_METC4 Imidazole glycerol phosphate synthase subunit HisF OS=Methylobacterium extorquens (strain CM4 / NCIMB 13688) GN=hisF PE=3 SV=1 226 541 9.0E-39
sp|B2ICL0|HIS6_BEII9 Imidazole glycerol phosphate synthase subunit HisF OS=Beijerinckia indica subsp. indica (strain ATCC 9039 / DSM 1715 / NCIB 8712) GN=hisF PE=3 SV=1 226 551 1.0E-38
sp|Q3A135|HIS5_PELCD Imidazole glycerol phosphate synthase subunit HisH OS=Pelobacter carbinolicus (strain DSM 2380 / Gra Bd 1) GN=hisH PE=3 SV=1 6 200 2.0E-38
sp|Q64RT2|HIS6_BACFR Imidazole glycerol phosphate synthase subunit HisF OS=Bacteroides fragilis (strain YCH46) GN=hisF PE=3 SV=1 226 541 2.0E-38
sp|A0RRT8|HIS6_CAMFF Imidazole glycerol phosphate synthase subunit HisF OS=Campylobacter fetus subsp. fetus (strain 82-40) GN=hisF PE=3 SV=1 226 541 2.0E-38
sp|A5CRW2|HIS6_CLAM3 Imidazole glycerol phosphate synthase subunit HisF OS=Clavibacter michiganensis subsp. michiganensis (strain NCPPB 382) GN=hisF PE=3 SV=1 226 542 2.0E-38
sp|Q8YX49|HIS5_NOSS1 Imidazole glycerol phosphate synthase subunit HisH OS=Nostoc sp. (strain PCC 7120 / UTEX 2576) GN=hisH PE=3 SV=1 1 202 3.0E-38
sp|B1ZAD6|HIS6_METPB Imidazole glycerol phosphate synthase subunit HisF OS=Methylobacterium populi (strain ATCC BAA-705 / NCIMB 13946 / BJ001) GN=hisF PE=3 SV=1 226 541 3.0E-38
sp|B1H0E6|HIS6_UNCTG Imidazole glycerol phosphate synthase subunit HisF OS=Uncultured termite group 1 bacterium phylotype Rs-D17 GN=hisF PE=3 SV=1 229 547 3.0E-38
sp|A9W5U0|HIS6_METEP Imidazole glycerol phosphate synthase subunit HisF OS=Methylobacterium extorquens (strain PA1) GN=hisF PE=3 SV=1 226 541 4.0E-38
sp|Q5LBD7|HIS6_BACFN Imidazole glycerol phosphate synthase subunit HisF OS=Bacteroides fragilis (strain ATCC 25285 / DSM 2151 / JCM 11019 / NCTC 9343) GN=hisF PE=3 SV=1 226 541 4.0E-38
sp|A6GY75|HIS6_FLAPJ Imidazole glycerol phosphate synthase subunit HisF OS=Flavobacterium psychrophilum (strain JIP02/86 / ATCC 49511) GN=hisF PE=3 SV=1 226 541 4.0E-38
sp|B0SRP0|HIS6_LEPBP Imidazole glycerol phosphate synthase subunit HisF OS=Leptospira biflexa serovar Patoc (strain Patoc 1 / ATCC 23582 / Paris) GN=hisF PE=3 SV=1 226 541 4.0E-38
sp|B0S8V2|HIS6_LEPBA Imidazole glycerol phosphate synthase subunit HisF OS=Leptospira biflexa serovar Patoc (strain Patoc 1 / Ames) GN=hisF PE=3 SV=1 226 541 4.0E-38
sp|B7KGN3|HIS5_CYAP7 Imidazole glycerol phosphate synthase subunit HisH OS=Cyanothece sp. (strain PCC 7424) GN=hisH PE=3 SV=1 1 202 5.0E-38
sp|Q30NR6|HIS6_SULDN Imidazole glycerol phosphate synthase subunit HisF OS=Sulfurimonas denitrificans (strain ATCC 33889 / DSM 1251) GN=hisF PE=3 SV=1 226 541 5.0E-38
sp|A6LT22|HIS6_CLOB8 Imidazole glycerol phosphate synthase subunit HisF OS=Clostridium beijerinckii (strain ATCC 51743 / NCIMB 8052) GN=hisF PE=3 SV=1 227 541 5.0E-38
sp|Q2JN09|HIS5_SYNJB Imidazole glycerol phosphate synthase subunit HisH OS=Synechococcus sp. (strain JA-2-3B'a(2-13)) GN=hisH PE=3 SV=1 6 201 5.0E-38
sp|B2KEU8|HIS6_ELUMP Imidazole glycerol phosphate synthase subunit HisF OS=Elusimicrobium minutum (strain Pei191) GN=hisF PE=3 SV=1 226 541 5.0E-38
sp|B0JFQ9|HIS5_MICAN Imidazole glycerol phosphate synthase subunit HisH OS=Microcystis aeruginosa (strain NIES-843) GN=hisH PE=3 SV=1 1 201 6.0E-38
sp|A5FYE5|HIS6_ACICJ Imidazole glycerol phosphate synthase subunit HisF OS=Acidiphilium cryptum (strain JF-5) GN=hisF PE=3 SV=1 226 541 7.0E-38
sp|Q39YP4|HIS5_GEOMG Imidazole glycerol phosphate synthase subunit HisH OS=Geobacter metallireducens (strain GS-15 / ATCC 53774 / DSM 7210) GN=hisH PE=3 SV=1 1 200 9.0E-38
sp|Q7SIB9|HIS6_THET8 Imidazole glycerol phosphate synthase subunit HisF OS=Thermus thermophilus (strain HB8 / ATCC 27634 / DSM 579) GN=hisF PE=1 SV=1 226 541 1.0E-37
sp|B2GBR5|HIS6_LACF3 Imidazole glycerol phosphate synthase subunit HisF OS=Lactobacillus fermentum (strain NBRC 3956 / LMG 18251) GN=hisF PE=3 SV=1 226 541 1.0E-37
sp|P62453|HIS6_THET2 Imidazole glycerol phosphate synthase subunit HisF OS=Thermus thermophilus (strain HB27 / ATCC BAA-163 / DSM 7039) GN=hisF PE=3 SV=1 226 541 1.0E-37
sp|A2BV90|HIS6_PROM5 Imidazole glycerol phosphate synthase subunit HisF OS=Prochlorococcus marinus (strain MIT 9515) GN=hisF PE=3 SV=1 229 544 1.0E-37
sp|Q1IX39|HIS6_DEIGD Imidazole glycerol phosphate synthase subunit HisF OS=Deinococcus geothermalis (strain DSM 11300) GN=hisF PE=3 SV=1 226 541 1.0E-37
sp|Q28NK0|HIS6_JANSC Imidazole glycerol phosphate synthase subunit HisF OS=Jannaschia sp. (strain CCS1) GN=hisF PE=3 SV=1 226 541 2.0E-37
sp|Q1GEZ3|HIS6_RUEST Imidazole glycerol phosphate synthase subunit HisF OS=Ruegeria sp. (strain TM1040) GN=hisF PE=3 SV=1 226 541 2.0E-37
sp|A7GVW5|HIS6_CAMC5 Imidazole glycerol phosphate synthase subunit HisF OS=Campylobacter curvus (strain 525.92) GN=hisF PE=3 SV=1 226 541 2.0E-37
sp|Q46GY9|HIS6_PROMT Imidazole glycerol phosphate synthase subunit HisF OS=Prochlorococcus marinus (strain NATL2A) GN=hisF PE=3 SV=1 229 544 3.0E-37
sp|Q050D2|HIS6_LEPBL Imidazole glycerol phosphate synthase subunit HisF OS=Leptospira borgpetersenii serovar Hardjo-bovis (strain L550) GN=hisF PE=3 SV=1 224 541 3.0E-37
sp|Q04SA6|HIS6_LEPBJ Imidazole glycerol phosphate synthase subunit HisF OS=Leptospira borgpetersenii serovar Hardjo-bovis (strain JB197) GN=hisF PE=3 SV=1 224 541 3.0E-37
sp|Q6F7A7|HIS5_ACIAD Imidazole glycerol phosphate synthase subunit HisH OS=Acinetobacter baylyi (strain ATCC 33305 / BD413 / ADP1) GN=hisH PE=3 SV=1 1 201 4.0E-37
sp|B6YQ30|HIS6_AZOPC Imidazole glycerol phosphate synthase subunit HisF OS=Azobacteroides pseudotrichonymphae genomovar. CFP2 GN=hisF PE=3 SV=1 226 542 5.0E-37
sp|Q5NMD6|HIS6_ZYMMO Imidazole glycerol phosphate synthase subunit HisF OS=Zymomonas mobilis subsp. mobilis (strain ATCC 31821 / ZM4 / CP4) GN=hisF PE=3 SV=1 226 542 5.0E-37
sp|A6L6Z2|HIS6_BACV8 Imidazole glycerol phosphate synthase subunit HisF OS=Bacteroides vulgatus (strain ATCC 8482 / DSM 1447 / NCTC 11154) GN=hisF PE=3 SV=1 226 541 5.0E-37
sp|A8G3E4|HIS6_PROM2 Imidazole glycerol phosphate synthase subunit HisF OS=Prochlorococcus marinus (strain MIT 9215) GN=hisF PE=3 SV=1 229 544 6.0E-37
sp|Q9X0C6|HIS6_THEMA Imidazole glycerol phosphate synthase subunit HisF OS=Thermotoga maritima (strain ATCC 43589 / MSB8 / DSM 3109 / JCM 10099) GN=hisF PE=1 SV=1 226 541 7.0E-37
sp|B8IPH3|HIS6_METNO Imidazole glycerol phosphate synthase subunit HisF OS=Methylobacterium nodulans (strain ORS2060 / LMG 21967) GN=hisF PE=3 SV=1 226 541 9.0E-37
sp|Q113E7|HIS5_TRIEI Imidazole glycerol phosphate synthase subunit HisH OS=Trichodesmium erythraeum (strain IMS101) GN=hisH PE=3 SV=1 1 213 1.0E-36
sp|A2BPR2|HIS6_PROMS Imidazole glycerol phosphate synthase subunit HisF OS=Prochlorococcus marinus (strain AS9601) GN=hisF PE=3 SV=1 229 544 1.0E-36
sp|B1L873|HIS6_THESQ Imidazole glycerol phosphate synthase subunit HisF OS=Thermotoga sp. (strain RQ2) GN=hisF PE=3 SV=1 226 541 1.0E-36
sp|A5FFX6|HIS6_FLAJ1 Imidazole glycerol phosphate synthase subunit HisF OS=Flavobacterium johnsoniae (strain ATCC 17061 / DSM 2064 / UW101) GN=hisF PE=3 SV=1 226 541 1.0E-36
sp|Q9RX89|HIS5_DEIRA Imidazole glycerol phosphate synthase subunit HisH OS=Deinococcus radiodurans (strain ATCC 13939 / DSM 20539 / JCM 16871 / LMG 4051 / NBRC 15346 / NCIMB 9279 / R1 / VKM B-1422) GN=hisH PE=3 SV=1 2 200 1.0E-36
sp|B0T798|HIS6_CAUSK Imidazole glycerol phosphate synthase subunit HisF OS=Caulobacter sp. (strain K31) GN=hisF PE=3 SV=1 226 541 1.0E-36
sp|Q2S295|HIS6_SALRD Imidazole glycerol phosphate synthase subunit HisF OS=Salinibacter ruber (strain DSM 13855 / M31) GN=hisF PE=3 SV=1 226 541 1.0E-36
sp|A8LHX5|HIS6_DINSH Imidazole glycerol phosphate synthase subunit HisF OS=Dinoroseobacter shibae (strain DSM 16493 / NCIMB 14021 / DFL 12) GN=hisF PE=3 SV=1 226 541 1.0E-36
sp|A1W0U9|HIS51_CAMJJ Imidazole glycerol phosphate synthase subunit HisH 1 OS=Campylobacter jejuni subsp. jejuni serotype O:23/36 (strain 81-176) GN=hisH1 PE=3 SV=1 3 200 2.0E-36
sp|Q9K6Z6|HIS6_BACHD Imidazole glycerol phosphate synthase subunit HisF OS=Bacillus halodurans (strain ATCC BAA-125 / DSM 18197 / FERM 7344 / JCM 9153 / C-125) GN=hisF PE=3 SV=1 226 541 2.0E-36
sp|A1B388|HIS6_PARDP Imidazole glycerol phosphate synthase subunit HisF OS=Paracoccus denitrificans (strain Pd 1222) GN=hisF PE=3 SV=1 226 541 2.0E-36
sp|Q3J6Q3|HIS5_NITOC Imidazole glycerol phosphate synthase subunit HisH OS=Nitrosococcus oceani (strain ATCC 19707 / NCIMB 11848) GN=hisH PE=3 SV=1 1 207 2.0E-36
sp|B8E2C8|HIS6_DICTD Imidazole glycerol phosphate synthase subunit HisF OS=Dictyoglomus turgidum (strain Z-1310 / DSM 6724) GN=hisF PE=3 SV=1 226 541 2.0E-36
sp|A6WX52|HIS6_OCHA4 Imidazole glycerol phosphate synthase subunit HisF OS=Ochrobactrum anthropi (strain ATCC 49188 / DSM 6882 / NCTC 12168) GN=hisF PE=3 SV=1 226 541 3.0E-36
sp|Q5HT90|HIS51_CAMJR Imidazole glycerol phosphate synthase subunit HisH 1 OS=Campylobacter jejuni (strain RM1221) GN=hisH1 PE=3 SV=1 3 201 3.0E-36
sp|Q8A7Z6|HIS6_BACTN Imidazole glycerol phosphate synthase subunit HisF OS=Bacteroides thetaiotaomicron (strain ATCC 29148 / DSM 2079 / NCTC 10582 / E50 / VPI-5482) GN=hisF PE=3 SV=1 226 541 4.0E-36
sp|A8LX55|HIS6_SALAI Imidazole glycerol phosphate synthase subunit HisF OS=Salinispora arenicola (strain CNS-205) GN=hisF PE=3 SV=1 226 541 4.0E-36
sp|Q31CA5|HIS6_PROM9 Imidazole glycerol phosphate synthase subunit HisF OS=Prochlorococcus marinus (strain MIT 9312) GN=hisF PE=3 SV=1 229 544 5.0E-36
sp|Q162Q1|HIS6_ROSDO Imidazole glycerol phosphate synthase subunit HisF OS=Roseobacter denitrificans (strain ATCC 33942 / OCh 114) GN=hisF PE=3 SV=1 226 541 5.0E-36
sp|Q9A229|HIS6_CAUCR Imidazole glycerol phosphate synthase subunit HisF OS=Caulobacter crescentus (strain ATCC 19089 / CB15) GN=hisF PE=3 SV=1 226 541 6.0E-36
sp|B8GW15|HIS6_CAUCN Imidazole glycerol phosphate synthase subunit HisF OS=Caulobacter crescentus (strain NA1000 / CB15N) GN=hisF PE=3 SV=1 226 541 6.0E-36
sp|Q0P8U2|HIS51_CAMJE Imidazole glycerol phosphate synthase subunit HisH 1 OS=Campylobacter jejuni subsp. jejuni serotype O:2 (strain ATCC 700819 / NCTC 11168) GN=hisH1 PE=1 SV=1 3 200 6.0E-36
sp|A9GZW9|HIS6_GLUDA Imidazole glycerol phosphate synthase subunit HisF OS=Gluconacetobacter diazotrophicus (strain ATCC 49037 / DSM 5601 / PAl5) GN=hisF PE=3 SV=1 226 542 6.0E-36
sp|A5INE6|HIS6_THEP1 Imidazole glycerol phosphate synthase subunit HisF OS=Thermotoga petrophila (strain RKU-1 / ATCC BAA-488 / DSM 13995) GN=hisF PE=3 SV=1 226 541 1.0E-35
sp|Q5LU99|HIS6_RUEPO Imidazole glycerol phosphate synthase subunit HisF OS=Ruegeria pomeroyi (strain ATCC 700808 / DSM 15171 / DSS-3) GN=hisF PE=3 SV=1 226 541 1.0E-35
sp|A4WUS8|HIS6_RHOS5 Imidazole glycerol phosphate synthase subunit HisF OS=Rhodobacter sphaeroides (strain ATCC 17025 / ATH 2.4.3) GN=hisF PE=3 SV=1 226 541 1.0E-35
sp|P60599|HIS5_GEOSL Imidazole glycerol phosphate synthase subunit HisH OS=Geobacter sulfurreducens (strain ATCC 51573 / DSM 12127 / PCA) GN=hisH PE=3 SV=1 1 200 1.0E-35
sp|Q03VY0|HIS6_LEUMM Imidazole glycerol phosphate synthase subunit HisF OS=Leuconostoc mesenteroides subsp. mesenteroides (strain ATCC 8293 / NCDO 523) GN=hisF PE=3 SV=1 226 541 1.0E-35
sp|B1LUA2|HIS6_METRJ Imidazole glycerol phosphate synthase subunit HisF OS=Methylobacterium radiotolerans (strain ATCC 27329 / DSM 1819 / JCM 2831) GN=hisF PE=3 SV=1 226 541 1.0E-35
sp|A6LDI7|HIS6_PARD8 Imidazole glycerol phosphate synthase subunit HisF OS=Parabacteroides distasonis (strain ATCC 8503 / DSM 20701 / NCTC 11152) GN=hisF PE=3 SV=1 226 541 1.0E-35
sp|C3MBC1|HIS6_RHISN Imidazole glycerol phosphate synthase subunit HisF OS=Rhizobium sp. (strain NGR234) GN=hisF PE=3 SV=1 226 541 2.0E-35
sp|P45603|HIS6_KLEOX Imidazole glycerol phosphate synthase subunit HisF OS=Klebsiella oxytoca GN=hisF PE=3 SV=1 226 541 2.0E-35
sp|A0M283|HIS6_GRAFK Imidazole glycerol phosphate synthase subunit HisF OS=Gramella forsetii (strain KT0803) GN=hisF PE=3 SV=1 226 541 2.0E-35
sp|Q2VYJ0|HIS6_MAGSA Imidazole glycerol phosphate synthase subunit HisF OS=Magnetospirillum magneticum (strain AMB-1 / ATCC 700264) GN=hisF PE=3 SV=1 226 541 2.0E-35
sp|A5V9W0|HIS6_SPHWW Imidazole glycerol phosphate synthase subunit HisF OS=Sphingomonas wittichii (strain RW1 / DSM 6014 / JCM 10273) GN=hisF PE=3 SV=1 229 542 2.0E-35
sp|Q7ULP3|HIS5_RHOBA Imidazole glycerol phosphate synthase subunit HisH OS=Rhodopirellula baltica (strain DSM 10527 / NCIMB 13988 / SH1) GN=hisH PE=3 SV=1 4 202 2.0E-35
sp|B5YE90|HIS6_DICT6 Imidazole glycerol phosphate synthase subunit HisF OS=Dictyoglomus thermophilum (strain ATCC 35947 / DSM 3960 / H-6-12) GN=hisF PE=3 SV=1 226 541 2.0E-35
sp|C5BG16|HIS6_EDWI9 Imidazole glycerol phosphate synthase subunit HisF OS=Edwardsiella ictaluri (strain 93-146) GN=hisF PE=3 SV=1 226 541 2.0E-35
sp|Q8YE37|HIS6_BRUME Imidazole glycerol phosphate synthase subunit HisF OS=Brucella melitensis biotype 1 (strain 16M / ATCC 23456 / NCTC 10094) GN=hisF PE=3 SV=1 226 541 3.0E-35
sp|C0RFX3|HIS6_BRUMB Imidazole glycerol phosphate synthase subunit HisF OS=Brucella melitensis biotype 2 (strain ATCC 23457) GN=hisF PE=3 SV=1 226 541 3.0E-35
sp|B0UHR5|HIS6_METS4 Imidazole glycerol phosphate synthase subunit HisF OS=Methylobacterium sp. (strain 4-46) GN=hisF PE=3 SV=1 226 541 3.0E-35
sp|A7HSH0|HIS6_PARL1 Imidazole glycerol phosphate synthase subunit HisF OS=Parvibaculum lavamentivorans (strain DS-1 / DSM 13023 / NCIMB 13966) GN=hisF PE=3 SV=1 226 541 3.0E-35
sp|Q7SIC0|HIS5_THET8 Imidazole glycerol phosphate synthase subunit HisH OS=Thermus thermophilus (strain HB8 / ATCC 27634 / DSM 579) GN=hisH PE=1 SV=1 6 194 3.0E-35
sp|Q8FY07|HIS6_BRUSU Imidazole glycerol phosphate synthase subunit HisF OS=Brucella suis biovar 1 (strain 1330) GN=hisF PE=3 SV=1 226 541 4.0E-35
sp|B0CJI6|HIS6_BRUSI Imidazole glycerol phosphate synthase subunit HisF OS=Brucella suis (strain ATCC 23445 / NCTC 10510) GN=hisF PE=3 SV=1 226 541 4.0E-35
sp|A5VT43|HIS6_BRUO2 Imidazole glycerol phosphate synthase subunit HisF OS=Brucella ovis (strain ATCC 25840 / 63/290 / NCTC 10512) GN=hisF PE=3 SV=1 226 541 4.0E-35
sp|A9M9R9|HIS6_BRUC2 Imidazole glycerol phosphate synthase subunit HisF OS=Brucella canis (strain ATCC 23365 / NCTC 10854) GN=hisF PE=3 SV=1 226 541 4.0E-35
sp|Q57AH3|HIS6_BRUAB Imidazole glycerol phosphate synthase subunit HisF OS=Brucella abortus biovar 1 (strain 9-941) GN=hisF PE=3 SV=1 226 541 4.0E-35
sp|Q2YQY8|HIS6_BRUA2 Imidazole glycerol phosphate synthase subunit HisF OS=Brucella abortus (strain 2308) GN=hisF PE=3 SV=1 226 541 4.0E-35
sp|B2S984|HIS6_BRUA1 Imidazole glycerol phosphate synthase subunit HisF OS=Brucella abortus (strain S19) GN=hisF PE=3 SV=1 226 541 4.0E-35
sp|P61781|HIS5_THET2 Imidazole glycerol phosphate synthase subunit HisH OS=Thermus thermophilus (strain HB27 / ATCC BAA-163 / DSM 7039) GN=hisH PE=3 SV=1 6 194 4.0E-35
sp|Q2RNA7|HIS6_RHORT Imidazole glycerol phosphate synthase subunit HisF OS=Rhodospirillum rubrum (strain ATCC 11170 / ATH 1.1.1 / DSM 467 / LMG 4362 / NCIB 8255 / S1) GN=hisF PE=3 SV=1 226 541 4.0E-35
sp|A4X9P7|HIS6_SALTO Imidazole glycerol phosphate synthase subunit HisF OS=Salinispora tropica (strain ATCC BAA-916 / DSM 44818 / CNB-440) GN=hisF PE=3 SV=1 226 541 6.0E-35
sp|B4ESZ8|HIS6_PROMH Imidazole glycerol phosphate synthase subunit HisF OS=Proteus mirabilis (strain HI4320) GN=hisF PE=3 SV=1 226 541 6.0E-35
sp|O30724|HIS6_RHOCB Imidazole glycerol phosphate synthase subunit HisF OS=Rhodobacter capsulatus (strain ATCC BAA-309 / NBRC 16581 / SB1003) GN=hisF PE=3 SV=2 226 541 8.0E-35
sp|Q5N0H4|HIS6_SYNP6 Imidazole glycerol phosphate synthase subunit HisF OS=Synechococcus sp. (strain ATCC 27144 / PCC 6301 / SAUG 1402/1) GN=hisF PE=3 SV=1 226 541 1.0E-34
sp|A3PBF2|HIS6_PROM0 Imidazole glycerol phosphate synthase subunit HisF OS=Prochlorococcus marinus (strain MIT 9301) GN=hisF PE=3 SV=1 229 544 1.0E-34
sp|Q11CK7|HIS6_CHESB Imidazole glycerol phosphate synthase subunit HisF OS=Chelativorans sp. (strain BNC1) GN=hisF PE=3 SV=1 226 541 1.0E-34
sp|P59118|HIS5_LEPIN Imidazole glycerol phosphate synthase subunit HisH OS=Leptospira interrogans serogroup Icterohaemorrhagiae serovar Lai (strain 56601) GN=hisH PE=3 SV=1 6 201 2.0E-34
sp|P61780|HIS5_LEPIC Imidazole glycerol phosphate synthase subunit HisH OS=Leptospira interrogans serogroup Icterohaemorrhagiae serovar copenhageni (strain Fiocruz L1-130) GN=hisH PE=3 SV=1 6 201 2.0E-34
sp|Q7VDF1|HIS6_PROMA Imidazole glycerol phosphate synthase subunit HisF OS=Prochlorococcus marinus (strain SARG / CCMP1375 / SS120) GN=hisF PE=3 SV=1 229 541 2.0E-34
sp|Q7NNK4|HIS5_GLOVI Imidazole glycerol phosphate synthase subunit HisH OS=Gloeobacter violaceus (strain PCC 7421) GN=hisH PE=3 SV=1 2 208 3.0E-34
sp|C3LLI5|HIS6_VIBCM Imidazole glycerol phosphate synthase subunit HisF OS=Vibrio cholerae serotype O1 (strain M66-2) GN=hisF PE=3 SV=1 226 542 3.0E-34
sp|Q9KSW8|HIS6_VIBCH Imidazole glycerol phosphate synthase subunit HisF OS=Vibrio cholerae serotype O1 (strain ATCC 39315 / El Tor Inaba N16961) GN=hisF PE=3 SV=1 226 542 3.0E-34
sp|A5F289|HIS6_VIBC3 Imidazole glycerol phosphate synthase subunit HisF OS=Vibrio cholerae serotype O1 (strain ATCC 39541 / Classical Ogawa 395 / O395) GN=hisF PE=3 SV=1 226 542 3.0E-34
sp|A7ZNJ7|HIS6_ECO24 Imidazole glycerol phosphate synthase subunit HisF OS=Escherichia coli O139:H28 (strain E24377A / ETEC) GN=hisF PE=3 SV=1 226 541 4.0E-34
sp|B3GZH3|HIS6_ACTP7 Imidazole glycerol phosphate synthase subunit HisF OS=Actinobacillus pleuropneumoniae serotype 7 (strain AP76) GN=hisF PE=3 SV=1 226 542 4.0E-34
sp|A8AEJ9|HIS6_CITK8 Imidazole glycerol phosphate synthase subunit HisF OS=Citrobacter koseri (strain ATCC BAA-895 / CDC 4225-83 / SGSC4696) GN=hisF PE=3 SV=1 226 541 4.0E-34
sp|Q7N6I5|HIS6_PHOLL Imidazole glycerol phosphate synthase subunit HisF OS=Photorhabdus luminescens subsp. laumondii (strain TT01) GN=hisF PE=3 SV=1 226 541 4.0E-34
sp|A7I416|HIS6_CAMHC Imidazole glycerol phosphate synthase subunit HisF OS=Campylobacter hominis (strain ATCC BAA-381 / LMG 19568 / NCTC 13146 / CH001A) GN=hisF PE=3 SV=1 224 541 5.0E-34
sp|Q0C643|HIS6_HYPNA Imidazole glycerol phosphate synthase subunit HisF OS=Hyphomonas neptunium (strain ATCC 15444) GN=hisF PE=3 SV=1 226 522 5.0E-34
sp|B9KPC8|HIS6_RHOSK Imidazole glycerol phosphate synthase subunit HisF OS=Rhodobacter sphaeroides (strain KD131 / KCTC 12085) GN=hisF PE=3 SV=1 226 541 5.0E-34
sp|Q92TB3|HIS6_RHIME Imidazole glycerol phosphate synthase subunit HisF OS=Rhizobium meliloti (strain 1021) GN=hisF PE=3 SV=1 226 541 6.0E-34
sp|B5XPE2|HIS6_KLEP3 Imidazole glycerol phosphate synthase subunit HisF OS=Klebsiella pneumoniae (strain 342) GN=hisF PE=3 SV=1 226 541 6.0E-34
sp|A6UEK3|HIS6_SINMW Imidazole glycerol phosphate synthase subunit HisF OS=Sinorhizobium medicae (strain WSM419) GN=hisF PE=3 SV=1 226 541 7.0E-34
sp|Q7V2P2|HIS6_PROMP Imidazole glycerol phosphate synthase subunit HisF OS=Prochlorococcus marinus subsp. pastoris (strain CCMP1986 / MED4) GN=hisF PE=3 SV=1 229 541 8.0E-34
[Show less]

GO

GO Term Description Terminal node
GO:0042823 pyridoxal phosphate biosynthetic process Yes
GO:0000105 histidine biosynthetic process Yes
GO:0004359 glutaminase activity Yes
GO:0042819 vitamin B6 biosynthetic process Yes
GO:0019637 organophosphate metabolic process No
GO:0019438 aromatic compound biosynthetic process No
GO:0006807 nitrogen compound metabolic process No
GO:0018130 heterocycle biosynthetic process No
GO:0016811 hydrolase activity, acting on carbon-nitrogen (but not peptide) bonds, in linear amides No
GO:0006081 cellular aldehyde metabolic process No
GO:0006796 phosphate-containing compound metabolic process No
GO:0043436 oxoacid metabolic process No
GO:0008652 cellular amino acid biosynthetic process No
GO:1901576 organic substance biosynthetic process No
GO:0006520 cellular amino acid metabolic process No
GO:0072525 pyridine-containing compound biosynthetic process No
GO:0046394 carboxylic acid biosynthetic process No
GO:0034641 cellular nitrogen compound metabolic process No
GO:0006793 phosphorus metabolic process No
GO:0042364 water-soluble vitamin biosynthetic process No
GO:0003674 molecular_function No
GO:0016787 hydrolase activity No
GO:0008150 biological_process No
GO:0090407 organophosphate biosynthetic process No
GO:0006082 organic acid metabolic process No
GO:0019752 carboxylic acid metabolic process No
GO:0006766 vitamin metabolic process No
GO:0006725 cellular aromatic compound metabolic process No
GO:0042816 vitamin B6 metabolic process No
GO:0008152 metabolic process No
GO:1901617 organic hydroxy compound biosynthetic process No
GO:0046184 aldehyde biosynthetic process No
GO:0006767 water-soluble vitamin metabolic process No
GO:0009110 vitamin biosynthetic process No
GO:0046483 heterocycle metabolic process No
GO:1901615 organic hydroxy compound metabolic process No
GO:1901564 organonitrogen compound metabolic process No
GO:0009058 biosynthetic process No
GO:0044238 primary metabolic process No
GO:0042822 pyridoxal phosphate metabolic process No
GO:0009987 cellular process No
GO:1901362 organic cyclic compound biosynthetic process No
GO:1901360 organic cyclic compound metabolic process No
GO:0016053 organic acid biosynthetic process No
GO:1901566 organonitrogen compound biosynthetic process No
GO:0044237 cellular metabolic process No
GO:0044281 small molecule metabolic process No
GO:0071704 organic substance metabolic process No
GO:0044283 small molecule biosynthetic process No
GO:0044249 cellular biosynthetic process No
GO:0016810 hydrolase activity, acting on carbon-nitrogen (but not peptide) bonds No
GO:0003824 catalytic activity No
GO:0044271 cellular nitrogen compound biosynthetic process No
GO:0006547 histidine metabolic process No
GO:0072524 pyridine-containing compound metabolic process No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 21 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >OphauB2|7336
MPTVHLLDYVAGNIHSLVNAIEKLGYSVEWIKSPQDVSKAQKLILPGVGHFGHCLSQLDRAGFLPAIKAHIDSGK
PFMGICVGLQALFEGSLEDSAVPGLGIIAGCLGRFDDAQKSVPHIGWNSASSSMYQLSPASKYYYVHTYRFPYVE
GQLEAQGWSVATATYGSETFVGAVAKGNVYATQFHPEKSGVAGLRTIGAFLTGEGAASLGNASANGSANKTLSSG
LTRRVIACLDVRANDQGDLVVTKGDQYDVRLKSSDRSVRNLGKPVELARRYYNDGADEVTFLNITSFRDCPAADL
PMLEVLRQTSATVFVPLTIGGGIRDTVDPDGSTLSALDIASLYFRSGADKVSIGSDAVAAAEQYYASGRRLTGST
AIEQISRAYGNQAVVVSIDPRRVYLDSPDSCPRHRQHVIETCFPGPAGERFCWYVCTVRGGRETRDLDVVELAQA
VQAMGAGELLLNSIDRDGSNSGFDLELIAQVKACVKIPVIASSGAGNPSHFEQVFTQTSTDAALGAGIFHRGEYS
VRQVKDYLSSKGLLVRQFEGDLDTHAVAIQS*
Coding >OphauB2|7336
ATGCCTACGGTCCATTTGCTAGACTACGTCGCCGGCAACATCCACAGCCTCGTCAATGCCATTGAGAAGCTAGGC
TACAGCGTCGAGTGGATAAAGTCGCCCCAAGATGTTTCCAAGGCTCAAAAACTCATCCTCCCCGGCGTCGGCCAC
TTTGGCCATTGTCTCTCGCAGCTAGACCGCGCCGGCTTCCTCCCTGCAATCAAGGCTCACATTGACAGCGGGAAG
CCCTTTATGGGCATCTGCGTCGGCCTGCAGGCTCTCTTTGAAGGCTCGCTGGAAGACTCAGCCGTGCCTGGGCTG
GGCATCATTGCCGGCTGTCTGGGTCGCTTTGATGACGCTCAAAAGTCGGTTCCTCATATTGGCTGGAACAGCGCC
TCCAGCTCCATGTATCAGCTCAGCCCGGCTTCCAAATACTACTATGTCCATACCTATCGCTTCCCCTACGTCGAG
GGCCAGCTCGAGGCCCAGGGCTGGTCCGTCGCCACGGCCACGTATGGCTCAGAGACGTTTGTCGGCGCCGTCGCA
AAGGGCAATGTCTACGCCACCCAGTTCCACCCTGAAAAGTCTGGCGTCGCCGGCCTGCGCACCATTGGCGCCTTT
TTGACGGGCGAGGGCGCCGCTTCCCTGGGCAATGCGTCTGCCAATGGCTCGGCCAACAAGACGCTCTCCTCGGGC
CTGACACGCCGCGTCATTGCCTGTCTCGACGTCCGCGCCAATGACCAAGGCGACCTCGTCGTCACAAAGGGCGAC
CAGTACGACGTGCGCCTCAAATCCTCTGACCGCTCCGTCCGCAACCTCGGCAAGCCCGTCGAGCTTGCCCGCCGC
TACTACAATGACGGCGCCGACGAAGTCACCTTTCTCAACATCACCTCGTTTCGCGACTGTCCCGCTGCCGACTTG
CCCATGCTCGAGGTTCTCCGTCAAACATCTGCCACCGTCTTTGTGCCCCTGACGATTGGCGGCGGCATTCGCGAT
ACTGTCGACCCCGACGGCTCAACCCTCTCCGCCCTCGACATTGCCTCGCTCTACTTCCGCTCCGGCGCCGACAAG
GTGTCGATTGGCTCCGACGCCGTGGCCGCCGCAGAGCAATACTACGCCTCTGGCCGTCGTCTCACCGGCTCCACC
GCCATTGAGCAAATCTCGCGCGCCTACGGCAACCAAGCCGTCGTTGTCAGCATCGATCCCCGCCGCGTCTACCTC
GATAGCCCCGACTCTTGTCCCCGTCACCGGCAGCACGTCATCGAGACTTGTTTTCCCGGCCCGGCTGGCGAGCGC
TTTTGCTGGTACGTCTGCACCGTCCGCGGCGGTCGCGAGACGCGTGATCTGGACGTGGTTGAGCTCGCCCAGGCT
GTCCAAGCCATGGGTGCCGGCGAGCTCCTCCTCAACTCGATTGACCGTGACGGCTCAAACTCGGGCTTTGATCTC
GAGCTCATTGCCCAGGTCAAGGCTTGTGTCAAAATCCCCGTCATTGCCTCGAGTGGTGCTGGCAACCCATCCCAC
TTTGAACAAGTCTTTACACAAACTTCAACCGACGCTGCCCTCGGTGCCGGCATCTTCCACCGTGGAGAGTACAGC
GTCAGACAGGTCAAGGATTATCTCAGCTCCAAGGGGCTTCTTGTGCGTCAGTTTGAGGGCGATTTGGATACTCAT
GCTGTTGCAATACAATCATAG
Transcript >OphauB2|7336
ATGCCTACGGTCCATTTGCTAGACTACGTCGCCGGCAACATCCACAGCCTCGTCAATGCCATTGAGAAGCTAGGC
TACAGCGTCGAGTGGATAAAGTCGCCCCAAGATGTTTCCAAGGCTCAAAAACTCATCCTCCCCGGCGTCGGCCAC
TTTGGCCATTGTCTCTCGCAGCTAGACCGCGCCGGCTTCCTCCCTGCAATCAAGGCTCACATTGACAGCGGGAAG
CCCTTTATGGGCATCTGCGTCGGCCTGCAGGCTCTCTTTGAAGGCTCGCTGGAAGACTCAGCCGTGCCTGGGCTG
GGCATCATTGCCGGCTGTCTGGGTCGCTTTGATGACGCTCAAAAGTCGGTTCCTCATATTGGCTGGAACAGCGCC
TCCAGCTCCATGTATCAGCTCAGCCCGGCTTCCAAATACTACTATGTCCATACCTATCGCTTCCCCTACGTCGAG
GGCCAGCTCGAGGCCCAGGGCTGGTCCGTCGCCACGGCCACGTATGGCTCAGAGACGTTTGTCGGCGCCGTCGCA
AAGGGCAATGTCTACGCCACCCAGTTCCACCCTGAAAAGTCTGGCGTCGCCGGCCTGCGCACCATTGGCGCCTTT
TTGACGGGCGAGGGCGCCGCTTCCCTGGGCAATGCGTCTGCCAATGGCTCGGCCAACAAGACGCTCTCCTCGGGC
CTGACACGCCGCGTCATTGCCTGTCTCGACGTCCGCGCCAATGACCAAGGCGACCTCGTCGTCACAAAGGGCGAC
CAGTACGACGTGCGCCTCAAATCCTCTGACCGCTCCGTCCGCAACCTCGGCAAGCCCGTCGAGCTTGCCCGCCGC
TACTACAATGACGGCGCCGACGAAGTCACCTTTCTCAACATCACCTCGTTTCGCGACTGTCCCGCTGCCGACTTG
CCCATGCTCGAGGTTCTCCGTCAAACATCTGCCACCGTCTTTGTGCCCCTGACGATTGGCGGCGGCATTCGCGAT
ACTGTCGACCCCGACGGCTCAACCCTCTCCGCCCTCGACATTGCCTCGCTCTACTTCCGCTCCGGCGCCGACAAG
GTGTCGATTGGCTCCGACGCCGTGGCCGCCGCAGAGCAATACTACGCCTCTGGCCGTCGTCTCACCGGCTCCACC
GCCATTGAGCAAATCTCGCGCGCCTACGGCAACCAAGCCGTCGTTGTCAGCATCGATCCCCGCCGCGTCTACCTC
GATAGCCCCGACTCTTGTCCCCGTCACCGGCAGCACGTCATCGAGACTTGTTTTCCCGGCCCGGCTGGCGAGCGC
TTTTGCTGGTACGTCTGCACCGTCCGCGGCGGTCGCGAGACGCGTGATCTGGACGTGGTTGAGCTCGCCCAGGCT
GTCCAAGCCATGGGTGCCGGCGAGCTCCTCCTCAACTCGATTGACCGTGACGGCTCAAACTCGGGCTTTGATCTC
GAGCTCATTGCCCAGGTCAAGGCTTGTGTCAAAATCCCCGTCATTGCCTCGAGTGGTGCTGGCAACCCATCCCAC
TTTGAACAAGTCTTTACACAAACTTCAACCGACGCTGCCCTCGGTGCCGGCATCTTCCACCGTGGAGAGTACAGC
GTCAGACAGGTCAAGGATTATCTCAGCTCCAAGGGGCTTCTTGTGCGTCAGTTTGAGGGCGATTTGGATACTCAT
GCTGTTGCAATACAATCATAG
Gene >OphauB2|7336
ATGCCTACGGTCCATTTGCTAGACTACGTCGCCGGCAACATCCACAGCCTCGTCAATGCCATTGAGAAGCTAGGC
TACAGCGTCGAGTGGATAAAGTCGCCCCAAGATGTTTCCAAGGCTCAAGTCGGCCACCCCTTGTTTGCTCCTTGT
CCGTCAATATCCAGTCTTTGCCTTCTGACTTTGGTCTGCAGAAACTCATCCTCCCCGGCGTCGGCCACTTTGGCC
ATTGTCTCTCGCAGCTAGACCGCGCCGGCTTCCTCCCTGCAATCAAGGCTCACATTGACAGCGGGAAGCCCTTTA
TGGGCATCTGCGTCGGCCTGCAGGCTCTCTTTGAAGGCTCGCTGGAAGACTCAGCCGTGCCTGGGCTGGGCATCA
TTGCCGGCTGTCTGGGTCGCTTTGATGACGCTCAAAAGTCGGTTCCTCATATTGGCTGGAACAGCGCCTCCAGCT
CCATGTATCAGCTCAGCCCGGCTTCCAAATACTACTATGTCCATACCTATCGCTTCCCCTACGTCGAGGGCCAGC
TCGAGGCCCAGGGCTGGTCCGTCGCCACGGCCACGTATGGCTCAGAGACGTTTGTCGGCGCCGTCGCAAAGGGCA
ATGTCTACGCCACCCAGTTCCACCCTGAAAAGTCTGGCGTCGCCGGCCTGCGCACCATTGGCGCCTTTTTGACGG
GCGAGGGCGCCGCTTCCCTGGGCAATGCGTCTGCCAATGGCTCGGCCAACAAGACGCTCTCCTCGGGCCTGACAC
GCCGCGTCATTGCCTGTCTCGACGTCCGCGCCAATGACCAAGGCGACCTCGTCGTCACAAAGGGCGACCAGTACG
ACGTGCGCCTCAAATCCTCTGACCGCTCCGTCCGCAACCTCGGCAAGCCCGTCGAGCTTGCCCGCCGCTACTACA
ATGACGGCGCCGACGAAGTCACCTTTCTCAACATCACCTCGTTTCGCGACTGTCCCGCTGCCGACTTGCCCATGC
TCGAGGTTCTCCGTCAAACATCTGCCACCGTCTTTGTGCCCCTGACGATTGGCGGCGGCATTCGCGATACTGTCG
ACCCCGACGGCTCAACCCTCTCCGCCCTCGACATTGCCTCGCTCTACTTCCGCTCCGGCGCCGACAAGGTGTCGA
TTGGCTCCGACGCCGTGGCCGCCGCAGAGCAATACTACGCCTCTGGCCGTCGTCTCACCGGCTCCACCGCCATTG
AGCAAATCTCGCGCGCCTACGGCAACCAAGCCGTCGTTGTCAGCATCGATCCCCGCCGCGTCTACCTCGATAGCC
CCGACTCTTGTCCCCGTCACCGGCAGCACGTCATCGAGACTTGTTTTCCCGGCCCGGCTGGCGAGCGCTTTTGCT
GGTACGTCTGCACCGTCCGCGGCGGTCGCGAGACGCGTGATCTGGACGTGGTTGAGCTCGCCCAGGCTGTCCAAG
CCATGGGTGCCGGCGAGCTCCTCCTCAACTCGATTGACCGTGACGGCTCAAACTCGGGCTTTGATCTCGAGCTCA
TTGCCCAGGTCAAGGCTTGTGTCAAAATCCCCGTCATTGCCTCGAGTGGTGCTGGCAACCCATCCCACTTTGAAC
AAGTCTTTACACAAACTTCAACCGACGCTGCCCTCGGTGCCGGCATCTTCCACCGTGGAGAGTACAGCGTCAGAC
AGGTCAAGGATTATCTCAGCTCCAAGGGGCTTCTTGTGCGTCAGTTTGAGGGCGATTTGGATACTCATGCTGTTG
CAATACAATCATAG

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail