Fungal Genomics

at Utrecht University

General Properties

Protein IDOphauB2|7336
Gene name
LocationContig_78:16728..18467
Strand-
Gene length (bp)1739
Transcript length (bp)1671
Coding sequence length (bp)1671
Protein length (aa) 557

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00977 His_biosynth Histidine biosynthesis protein 6.1E-45 229 524
PF00117 GATase Glutamine amidotransferase class-I 4.3E-20 6 189
PF01174 SNO SNO glutamine amidotransferase family 1.3E-07 11 189

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q9P4P9|HIS5_EMENI Imidazole glycerol phosphate synthase hisHF OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=hisHF PE=3 SV=2 1 547 0.0E+00
sp|P33734|HIS5_YEAST Imidazole glycerol phosphate synthase hisHF OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=HIS7 PE=1 SV=2 1 544 0.0E+00
sp|O94303|HIS5_SCHPO Imidazole glycerol phosphate synthase hisHF OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=his4 PE=3 SV=3 4 541 0.0E+00
sp|Q9SZ30|HIS4_ARATH Imidazole glycerol phosphate synthase hisHF, chloroplastic OS=Arabidopsis thaliana GN=HISN4 PE=2 SV=1 3 541 0.0E+00
sp|Q5V2C9|HIS6_HALMA Imidazole glycerol phosphate synthase subunit HisF OS=Haloarcula marismortui (strain ATCC 43049 / DSM 3752 / JCM 8966 / VKM B-1809) GN=hisF PE=3 SV=1 226 541 7.0E-57
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q9P4P9|HIS5_EMENI Imidazole glycerol phosphate synthase hisHF OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=hisHF PE=3 SV=2 1 547 0.0E+00
sp|P33734|HIS5_YEAST Imidazole glycerol phosphate synthase hisHF OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=HIS7 PE=1 SV=2 1 544 0.0E+00
sp|O94303|HIS5_SCHPO Imidazole glycerol phosphate synthase hisHF OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=his4 PE=3 SV=3 4 541 0.0E+00
sp|Q9SZ30|HIS4_ARATH Imidazole glycerol phosphate synthase hisHF, chloroplastic OS=Arabidopsis thaliana GN=HISN4 PE=2 SV=1 3 541 0.0E+00
sp|Q5V2C9|HIS6_HALMA Imidazole glycerol phosphate synthase subunit HisF OS=Haloarcula marismortui (strain ATCC 43049 / DSM 3752 / JCM 8966 / VKM B-1809) GN=hisF PE=3 SV=1 226 541 7.0E-57
sp|Q8TYW8|HIS6_METKA Imidazole glycerol phosphate synthase subunit HisF OS=Methanopyrus kandleri (strain AV19 / DSM 6324 / JCM 9639 / NBRC 100938) GN=hisF PE=3 SV=1 226 542 1.0E-56
sp|Q2NI84|HIS6_METST Imidazole glycerol phosphate synthase subunit HisF OS=Methanosphaera stadtmanae (strain ATCC 43021 / DSM 3091 / JCM 11832 / MCB-3) GN=hisF PE=3 SV=1 226 541 3.0E-56
sp|A5UMZ1|HIS6_METS3 Imidazole glycerol phosphate synthase subunit HisF OS=Methanobrevibacter smithii (strain PS / ATCC 35061 / DSM 861) GN=hisF PE=3 SV=1 226 541 5.0E-56
sp|Q18JI3|HIS6_HALWD Imidazole glycerol phosphate synthase subunit HisF OS=Haloquadratum walsbyi (strain DSM 16790 / HBSQ001) GN=hisF PE=3 SV=1 226 541 1.0E-55
sp|Q57854|HIS6_METJA Imidazole glycerol phosphate synthase subunit HisF OS=Methanocaldococcus jannaschii (strain ATCC 43067 / DSM 2661 / JAL-1 / JCM 10045 / NBRC 100440) GN=hisF PE=3 SV=1 226 541 1.0E-55
sp|O27398|HIS6_METTH Imidazole glycerol phosphate synthase subunit HisF OS=Methanothermobacter thermautotrophicus (strain ATCC 29096 / DSM 1053 / JCM 10044 / NBRC 100330 / Delta H) GN=hisF PE=3 SV=2 226 541 2.0E-55
sp|A2STB8|HIS6_METLZ Imidazole glycerol phosphate synthase subunit HisF OS=Methanocorpusculum labreanum (strain ATCC 43576 / DSM 4855 / Z) GN=hisF PE=3 SV=1 225 541 2.0E-54
sp|Q8TT96|HIS6_METAC Imidazole glycerol phosphate synthase subunit HisF OS=Methanosarcina acetivorans (strain ATCC 35395 / DSM 2834 / JCM 12185 / C2A) GN=hisF PE=3 SV=1 226 541 5.0E-54
sp|Q8R885|HIS6_CALS4 Imidazole glycerol phosphate synthase subunit HisF OS=Caldanaerobacter subterraneus subsp. tengcongensis (strain DSM 15242 / JCM 11007 / NBRC 100824 / MB4) GN=hisF PE=3 SV=1 226 541 1.0E-53
sp|Q8PW92|HIS6_METMA Imidazole glycerol phosphate synthase subunit HisF OS=Methanosarcina mazei (strain ATCC BAA-159 / DSM 3647 / Goe1 / Go1 / JCM 11833 / OCM 88) GN=hisF PE=3 SV=1 226 541 2.0E-53
sp|B0K629|HIS6_THEPX Imidazole glycerol phosphate synthase subunit HisF OS=Thermoanaerobacter sp. (strain X514) GN=hisF PE=3 SV=1 226 541 4.0E-53
sp|A3CT78|HIS6_METMJ Imidazole glycerol phosphate synthase subunit HisF OS=Methanoculleus marisnigri (strain ATCC 35101 / DSM 1498 / JR1) GN=hisF PE=3 SV=1 226 541 6.0E-53
sp|Q8FNZ9|HIS6_COREF Imidazole glycerol phosphate synthase subunit HisF OS=Corynebacterium efficiens (strain DSM 44549 / YS-314 / AJ 12310 / JCM 11189 / NBRC 100395) GN=hisF PE=3 SV=1 225 542 9.0E-53
sp|Q46CC5|HIS6_METBF Imidazole glycerol phosphate synthase subunit HisF OS=Methanosarcina barkeri (strain Fusaro / DSM 804) GN=hisF PE=3 SV=1 226 541 1.0E-52
sp|Q820Q0|HIS6_NITEU Imidazole glycerol phosphate synthase subunit HisF OS=Nitrosomonas europaea (strain ATCC 19718 / NBRC 14298) GN=hisF PE=3 SV=1 225 541 1.0E-52
sp|Q2FPV1|HIS6_METHJ Imidazole glycerol phosphate synthase subunit HisF OS=Methanospirillum hungatei JF-1 (strain ATCC 27890 / DSM 864 / NBRC 100397 / JF-1) GN=hisF PE=3 SV=1 226 541 1.0E-52
sp|Q0AEU1|HIS6_NITEC Imidazole glycerol phosphate synthase subunit HisF OS=Nitrosomonas eutropha (strain C91) GN=hisF PE=3 SV=1 225 541 2.0E-52
sp|Q12UY6|HIS6_METBU Imidazole glycerol phosphate synthase subunit HisF OS=Methanococcoides burtonii (strain DSM 6242 / NBRC 107633 / OCM 468 / ACE-M) GN=hisF PE=3 SV=1 226 541 3.0E-52
sp|A4J707|HIS6_DESRM Imidazole glycerol phosphate synthase subunit HisF OS=Desulfotomaculum reducens (strain MI-1) GN=hisF PE=3 SV=1 226 541 3.0E-52
sp|Q4JW52|HIS6_CORJK Imidazole glycerol phosphate synthase subunit HisF OS=Corynebacterium jeikeium (strain K411) GN=hisF PE=3 SV=1 226 541 3.0E-52
sp|P60714|HIS6_CORDI Imidazole glycerol phosphate synthase subunit HisF OS=Corynebacterium diphtheriae (strain ATCC 700971 / NCTC 13129 / Biotype gravis) GN=hisF PE=3 SV=1 229 541 4.0E-52
sp|Q47AM3|HIS6_DECAR Imidazole glycerol phosphate synthase subunit HisF OS=Dechloromonas aromatica (strain RCB) GN=hisF PE=3 SV=1 226 541 1.0E-51
sp|O29439|HIS6_ARCFU Imidazole glycerol phosphate synthase subunit HisF OS=Archaeoglobus fulgidus (strain ATCC 49558 / VC-16 / DSM 4304 / JCM 9628 / NBRC 100126) GN=hisF PE=3 SV=1 226 541 1.0E-51
sp|Q7W2X9|HIS6_BORPA Imidazole glycerol phosphate synthase subunit HisF OS=Bordetella parapertussis (strain 12822 / ATCC BAA-587 / NCTC 13253) GN=hisF PE=3 SV=1 223 541 1.0E-51
sp|A0QX87|HIS6_MYCS2 Imidazole glycerol phosphate synthase subunit HisF OS=Mycobacterium smegmatis (strain ATCC 700084 / mc(2)155) GN=hisF PE=3 SV=1 223 541 1.0E-51
sp|Q7VSY6|HIS6_BORPE Imidazole glycerol phosphate synthase subunit HisF OS=Bordetella pertussis (strain Tohama I / ATCC BAA-589 / NCTC 13251) GN=hisF PE=3 SV=1 223 541 2.0E-51
sp|Q7WDX9|HIS6_BORBR Imidazole glycerol phosphate synthase subunit HisF OS=Bordetella bronchiseptica (strain ATCC BAA-588 / NCTC 13252 / RB50) GN=hisF PE=3 SV=1 223 541 2.0E-51
sp|A0QHH6|HIS6_MYCA1 Imidazole glycerol phosphate synthase subunit HisF OS=Mycobacterium avium (strain 104) GN=hisF PE=3 SV=1 223 542 2.0E-51
sp|Q01ZU6|HIS6_SOLUE Imidazole glycerol phosphate synthase subunit HisF OS=Solibacter usitatus (strain Ellin6076) GN=hisF PE=3 SV=1 226 541 4.0E-51
sp|Q2KTT1|HIS6_BORA1 Imidazole glycerol phosphate synthase subunit HisF OS=Bordetella avium (strain 197N) GN=hisF PE=3 SV=1 223 541 5.0E-51
sp|P60666|HIS6_MYCPA Imidazole glycerol phosphate synthase subunit HisF OS=Mycobacterium paratuberculosis (strain ATCC BAA-968 / K-10) GN=hisF PE=3 SV=1 223 542 5.0E-51
sp|Q2YAV0|HIS6_NITMU Imidazole glycerol phosphate synthase subunit HisF OS=Nitrosospira multiformis (strain ATCC 25196 / NCIMB 11849) GN=hisF PE=3 SV=1 225 541 6.0E-51
sp|O66567|HIS6_AQUAE Imidazole glycerol phosphate synthase subunit HisF OS=Aquifex aeolicus (strain VF5) GN=hisF PE=3 SV=1 226 544 6.0E-51
sp|A7I616|HIS6_METB6 Imidazole glycerol phosphate synthase subunit HisF OS=Methanoregula boonei (strain 6A8) GN=hisF PE=3 SV=2 226 541 6.0E-51
sp|B8D116|HIS6_HALOH Imidazole glycerol phosphate synthase subunit HisF OS=Halothermothrix orenii (strain H 168 / OCM 544 / DSM 9562) GN=hisF PE=3 SV=1 226 541 1.0E-50
sp|B8GEX3|HIS6_METPE Imidazole glycerol phosphate synthase subunit HisF OS=Methanosphaerula palustris (strain ATCC BAA-1556 / DSM 19958 / E1-9c) GN=hisF PE=3 SV=1 226 541 2.0E-50
sp|A6UUZ9|HIS6_META3 Imidazole glycerol phosphate synthase subunit HisF OS=Methanococcus aeolicus (strain Nankai-3 / ATCC BAA-1280) GN=hisF PE=3 SV=1 226 541 2.0E-50
sp|A4SV20|HIS6_POLSQ Imidazole glycerol phosphate synthase subunit HisF OS=Polynucleobacter necessarius subsp. asymbioticus (strain DSM 18221 / CIP 109841 / QLW-P1DMWA-1) GN=hisF PE=3 SV=1 226 541 3.0E-50
sp|Q0W358|HIS6_METAR Imidazole glycerol phosphate synthase subunit HisF OS=Methanocella arvoryzae (strain DSM 22066 / NBRC 105507 / MRE50) GN=hisF PE=3 SV=1 226 541 5.0E-50
sp|Q3INY2|HIS6_NATPD Imidazole glycerol phosphate synthase subunit HisF OS=Natronomonas pharaonis (strain ATCC 35678 / DSM 2160) GN=hisF PE=3 SV=1 226 541 8.0E-50
sp|A4Y083|HIS6_PSEMY Imidazole glycerol phosphate synthase subunit HisF OS=Pseudomonas mendocina (strain ymp) GN=hisF PE=3 SV=1 226 541 8.0E-50
sp|Q13TR0|HIS6_BURXL Imidazole glycerol phosphate synthase subunit HisF OS=Burkholderia xenovorans (strain LB400) GN=hisF PE=3 SV=1 226 541 1.0E-49
sp|C3PHA6|HIS6_CORA7 Imidazole glycerol phosphate synthase subunit HisF OS=Corynebacterium aurimucosum (strain ATCC 700975 / DSM 44827 / CN-1) GN=hisF PE=3 SV=1 226 542 1.0E-49
sp|B2JHX9|HIS6_BURP8 Imidazole glycerol phosphate synthase subunit HisF OS=Burkholderia phymatum (strain DSM 17167 / STM815) GN=hisF PE=3 SV=1 226 541 2.0E-49
sp|B2SZ59|HIS6_BURPP Imidazole glycerol phosphate synthase subunit HisF OS=Burkholderia phytofirmans (strain DSM 17436 / PsJN) GN=hisF PE=3 SV=1 226 541 2.0E-49
sp|Q1D4M4|HIS6_MYXXD Imidazole glycerol phosphate synthase subunit HisF OS=Myxococcus xanthus (strain DK 1622) GN=hisF PE=3 SV=1 226 543 3.0E-49
sp|Q603K3|HIS6_METCA Imidazole glycerol phosphate synthase subunit HisF OS=Methylococcus capsulatus (strain ATCC 33009 / NCIMB 11132 / Bath) GN=hisF PE=3 SV=1 226 542 3.0E-49
sp|C1DAK5|HIS6_LARHH Imidazole glycerol phosphate synthase subunit HisF OS=Laribacter hongkongensis (strain HLHK9) GN=hisF PE=3 SV=1 226 541 3.0E-49
sp|A4YI34|HIS6_METS5 Imidazole glycerol phosphate synthase subunit HisF OS=Metallosphaera sedula (strain ATCC 51363 / DSM 5348) GN=hisF PE=3 SV=1 227 541 4.0E-49
sp|A6VDQ9|HIS6_PSEA7 Imidazole glycerol phosphate synthase subunit HisF OS=Pseudomonas aeruginosa (strain PA7) GN=hisF PE=3 SV=1 226 541 4.0E-49
sp|C0Z6P4|HIS6_BREBN Imidazole glycerol phosphate synthase subunit HisF OS=Brevibacillus brevis (strain 47 / JCM 6285 / NBRC 100599) GN=hisF PE=3 SV=1 226 541 4.0E-49
sp|B4E641|HIS6_BURCJ Imidazole glycerol phosphate synthase subunit HisF OS=Burkholderia cenocepacia (strain ATCC BAA-245 / DSM 16553 / LMG 16656 / NCTC 13227 / J2315 / CF5610) GN=hisF PE=3 SV=1 226 541 4.0E-49
sp|Q2SUA8|HIS6_BURTA Imidazole glycerol phosphate synthase subunit HisF OS=Burkholderia thailandensis (strain E264 / ATCC 700388 / DSM 13276 / CIP 106301) GN=hisF PE=3 SV=2 226 541 5.0E-49
sp|P62454|HIS6_METMP Imidazole glycerol phosphate synthase subunit HisF OS=Methanococcus maripaludis (strain S2 / LL) GN=hisF PE=3 SV=1 226 541 5.0E-49
sp|A5G8S9|HIS6_GEOUR Imidazole glycerol phosphate synthase subunit HisF OS=Geobacter uraniireducens (strain Rf4) GN=hisF PE=3 SV=1 226 541 5.0E-49
sp|Q0BIW4|HIS6_BURCM Imidazole glycerol phosphate synthase subunit HisF OS=Burkholderia ambifaria (strain ATCC BAA-244 / AMMD) GN=hisF PE=3 SV=1 226 541 6.0E-49
sp|A0K3V8|HIS6_BURCH Imidazole glycerol phosphate synthase subunit HisF OS=Burkholderia cenocepacia (strain HI2424) GN=hisF PE=3 SV=1 226 541 6.0E-49
sp|B1JUA5|HIS6_BURCC Imidazole glycerol phosphate synthase subunit HisF OS=Burkholderia cenocepacia (strain MC0-3) GN=hisF PE=3 SV=1 226 541 6.0E-49
sp|Q1BS31|HIS6_BURCA Imidazole glycerol phosphate synthase subunit HisF OS=Burkholderia cenocepacia (strain AU 1054) GN=hisF PE=3 SV=1 226 541 6.0E-49
sp|Q63Q92|HIS6_BURPS Imidazole glycerol phosphate synthase subunit HisF OS=Burkholderia pseudomallei (strain K96243) GN=hisF PE=3 SV=2 226 541 7.0E-49
sp|A3NE93|HIS6_BURP6 Imidazole glycerol phosphate synthase subunit HisF OS=Burkholderia pseudomallei (strain 668) GN=hisF PE=3 SV=2 226 541 7.0E-49
sp|Q3JN02|HIS6_BURP1 Imidazole glycerol phosphate synthase subunit HisF OS=Burkholderia pseudomallei (strain 1710b) GN=hisF PE=3 SV=1 226 541 7.0E-49
sp|A3P027|HIS6_BURP0 Imidazole glycerol phosphate synthase subunit HisF OS=Burkholderia pseudomallei (strain 1106a) GN=hisF PE=3 SV=2 226 541 7.0E-49
sp|B9M0M0|HIS6_GEODF Imidazole glycerol phosphate synthase subunit HisF OS=Geobacter daltonii (strain DSM 22248 / JCM 15807 / FRC-32) GN=hisF PE=3 SV=1 226 541 8.0E-49
sp|Q02EM6|HIS6_PSEAB Imidazole glycerol phosphate synthase subunit HisF OS=Pseudomonas aeruginosa (strain UCBPP-PA14) GN=hisF PE=3 SV=1 226 541 8.0E-49
sp|B7V3N3|HIS6_PSEA8 Imidazole glycerol phosphate synthase subunit HisF OS=Pseudomonas aeruginosa (strain LESB58) GN=hisF PE=3 SV=1 226 541 8.0E-49
sp|Q9HU44|HIS61_PSEAE Imidazole glycerol phosphate synthase subunit hisF1 OS=Pseudomonas aeruginosa (strain ATCC 15692 / PAO1 / 1C / PRS 101 / LMG 12228) GN=hisF1 PE=3 SV=1 226 541 8.0E-49
sp|Q97KH8|HIS6_CLOAB Imidazole glycerol phosphate synthase subunit HisF OS=Clostridium acetobutylicum (strain ATCC 824 / DSM 792 / JCM 1419 / LMG 5710 / VKM B-1787) GN=hisF PE=3 SV=1 226 541 9.0E-49
sp|B1YRW1|HIS6_BURA4 Imidazole glycerol phosphate synthase subunit HisF OS=Burkholderia ambifaria (strain MC40-6) GN=hisF PE=3 SV=1 226 541 9.0E-49
sp|A8AAK3|HIS6_IGNH4 Imidazole glycerol phosphate synthase subunit HisF OS=Ignicoccus hospitalis (strain KIN4/I / DSM 18386 / JCM 14125) GN=hisF PE=3 SV=1 226 541 1.0E-48
sp|Q1B7H0|HIS6_MYCSS Imidazole glycerol phosphate synthase subunit HisF OS=Mycobacterium sp. (strain MCS) GN=hisF PE=3 SV=1 225 541 1.0E-48
sp|A1UHK2|HIS6_MYCSK Imidazole glycerol phosphate synthase subunit HisF OS=Mycobacterium sp. (strain KMS) GN=hisF PE=3 SV=1 225 541 1.0E-48
sp|A3Q125|HIS6_MYCSJ Imidazole glycerol phosphate synthase subunit HisF OS=Mycobacterium sp. (strain JLS) GN=hisF PE=3 SV=1 225 541 1.0E-48
sp|A4JAW9|HIS6_BURVG Imidazole glycerol phosphate synthase subunit HisF OS=Burkholderia vietnamiensis (strain G4 / LMG 22486) GN=hisF PE=3 SV=1 226 541 1.0E-48
sp|A6VHY8|HIS6_METM7 Imidazole glycerol phosphate synthase subunit HisF OS=Methanococcus maripaludis (strain C7 / ATCC BAA-1331) GN=hisF PE=3 SV=1 226 541 1.0E-48
sp|Q39K85|HIS6_BURL3 Imidazole glycerol phosphate synthase subunit HisF OS=Burkholderia lata (strain ATCC 17760 / LMG 22485 / NCIMB 9086 / R18194 / 383) GN=hisF PE=3 SV=1 226 541 1.0E-48
sp|Q92E88|HIS6_LISIN Imidazole glycerol phosphate synthase subunit HisF OS=Listeria innocua serovar 6a (strain CLIP 11262) GN=hisF PE=3 SV=1 226 541 2.0E-48
sp|O31139|HIS6_CORGL Imidazole glycerol phosphate synthase subunit HisF OS=Corynebacterium glutamicum (strain ATCC 13032 / DSM 20300 / JCM 1318 / LMG 3730 / NCIMB 10025) GN=hisF PE=3 SV=2 225 542 2.0E-48
sp|A4QFF9|HIS6_CORGB Imidazole glycerol phosphate synthase subunit HisF OS=Corynebacterium glutamicum (strain R) GN=hisF PE=3 SV=1 225 542 2.0E-48
sp|Q3KJI5|HIS6_PSEPF Imidazole glycerol phosphate synthase subunit HisF OS=Pseudomonas fluorescens (strain Pf0-1) GN=hisF PE=3 SV=1 226 541 2.0E-48
sp|A1V8H5|HIS6_BURMS Imidazole glycerol phosphate synthase subunit HisF OS=Burkholderia mallei (strain SAVP1) GN=hisF PE=3 SV=2 226 541 2.0E-48
sp|Q62GE5|HIS6_BURMA Imidazole glycerol phosphate synthase subunit HisF OS=Burkholderia mallei (strain ATCC 23344) GN=hisF PE=3 SV=1 226 541 2.0E-48
sp|A2S754|HIS6_BURM9 Imidazole glycerol phosphate synthase subunit HisF OS=Burkholderia mallei (strain NCTC 10229) GN=hisF PE=3 SV=2 226 541 2.0E-48
sp|A3MPU4|HIS6_BURM7 Imidazole glycerol phosphate synthase subunit HisF OS=Burkholderia mallei (strain NCTC 10247) GN=hisF PE=3 SV=2 226 541 2.0E-48
sp|Q0VM72|HIS6_ALCBS Imidazole glycerol phosphate synthase subunit HisF OS=Alcanivorax borkumensis (strain ATCC 700651 / DSM 11573 / NCIMB 13689 / SK2) GN=hisF PE=3 SV=1 225 541 2.0E-48
sp|B2V9M8|HIS6_SULSY Imidazole glycerol phosphate synthase subunit HisF OS=Sulfurihydrogenibium sp. (strain YO3AOP1) GN=hisF PE=3 SV=1 226 541 2.0E-48
sp|C1A0L6|HIS6_RHOE4 Imidazole glycerol phosphate synthase subunit HisF OS=Rhodococcus erythropolis (strain PR4 / NBRC 100887) GN=hisF PE=3 SV=1 226 541 3.0E-48
sp|Q3Z7F5|HIS6_DEHM1 Imidazole glycerol phosphate synthase subunit HisF OS=Dehalococcoides mccartyi (strain ATCC BAA-2266 / KCTC 15142 / 195) GN=hisF PE=3 SV=1 226 541 3.0E-48
sp|A1A1I5|HIS6_BIFAA Imidazole glycerol phosphate synthase subunit HisF OS=Bifidobacterium adolescentis (strain ATCC 15703 / DSM 20083 / NCTC 11814 / E194a) GN=hisF PE=3 SV=1 226 541 3.0E-48
sp|Q5HKP2|HIS6_STAEQ Imidazole glycerol phosphate synthase subunit HisF OS=Staphylococcus epidermidis (strain ATCC 35984 / RP62A) GN=hisF PE=3 SV=1 226 541 3.0E-48
sp|Q1I3G8|HIS6_PSEE4 Imidazole glycerol phosphate synthase subunit HisF OS=Pseudomonas entomophila (strain L48) GN=hisF PE=3 SV=1 226 541 3.0E-48
sp|B0KI45|HIS6_PSEPG Imidazole glycerol phosphate synthase subunit HisF OS=Pseudomonas putida (strain GB-1) GN=hisF PE=3 SV=1 226 541 3.0E-48
sp|A9A8U1|HIS6_METM6 Imidazole glycerol phosphate synthase subunit HisF OS=Methanococcus maripaludis (strain C6 / ATCC BAA-1332) GN=hisF PE=3 SV=1 226 541 3.0E-48
sp|A4T9N2|HIS6_MYCGI Imidazole glycerol phosphate synthase subunit HisF OS=Mycobacterium gilvum (strain PYR-GCK) GN=hisF PE=3 SV=1 223 541 3.0E-48
sp|A4VRV9|HIS6_PSEU5 Imidazole glycerol phosphate synthase subunit HisF OS=Pseudomonas stutzeri (strain A1501) GN=hisF PE=3 SV=1 226 541 4.0E-48
sp|B1JED1|HIS6_PSEPW Imidazole glycerol phosphate synthase subunit HisF OS=Pseudomonas putida (strain W619) GN=hisF PE=3 SV=1 226 541 4.0E-48
sp|Q7P0E9|HIS6_CHRVO Imidazole glycerol phosphate synthase subunit HisF OS=Chromobacterium violaceum (strain ATCC 12472 / DSM 30191 / JCM 1249 / NBRC 12614 / NCIMB 9131 / NCTC 9757) GN=hisF PE=3 SV=1 226 541 4.0E-48
sp|A5FQI9|HIS6_DEHMB Imidazole glycerol phosphate synthase subunit HisF OS=Dehalococcoides mccartyi (strain ATCC BAA-2100 / JCM 16839 / KCTC 5957 / BAV1) GN=hisF PE=3 SV=1 226 541 4.0E-48
sp|O33774|HIS6_SULSO Imidazole glycerol phosphate synthase subunit HisF OS=Sulfolobus solfataricus (strain ATCC 35092 / DSM 1617 / JCM 11322 / P2) GN=hisF PE=3 SV=1 227 542 4.0E-48
sp|B1VH88|HIS6_CORU7 Imidazole glycerol phosphate synthase subunit HisF OS=Corynebacterium urealyticum (strain ATCC 43042 / DSM 7109) GN=hisF PE=3 SV=1 229 533 4.0E-48
sp|Q9HR52|HIS6_HALSA Imidazole glycerol phosphate synthase subunit HisF OS=Halobacterium salinarum (strain ATCC 700922 / JCM 11081 / NRC-1) GN=hisF PE=3 SV=1 226 541 4.0E-48
sp|B0R4B2|HIS6_HALS3 Imidazole glycerol phosphate synthase subunit HisF OS=Halobacterium salinarum (strain ATCC 29341 / DSM 671 / R1) GN=hisF PE=3 SV=1 226 541 4.0E-48
sp|Q88R41|HIS6_PSEPK Imidazole glycerol phosphate synthase subunit HisF OS=Pseudomonas putida (strain KT2440) GN=hisF PE=3 SV=1 226 541 5.0E-48
sp|A5VX76|HIS6_PSEP1 Imidazole glycerol phosphate synthase subunit HisF OS=Pseudomonas putida (strain F1 / ATCC 700007) GN=hisF PE=3 SV=1 226 541 5.0E-48
sp|B1XSV3|HIS6_POLNS Imidazole glycerol phosphate synthase subunit HisF OS=Polynucleobacter necessarius subsp. necessarius (strain STIR1) GN=hisF PE=3 SV=1 226 541 5.0E-48
sp|Q47QS3|HIS6_THEFY Imidazole glycerol phosphate synthase subunit HisF OS=Thermobifida fusca (strain YX) GN=hisF PE=3 SV=1 226 541 6.0E-48
sp|Q1Q835|HIS6_PSYCK Imidazole glycerol phosphate synthase subunit HisF OS=Psychrobacter cryohalolentis (strain K5) GN=hisF PE=3 SV=1 226 541 7.0E-48
sp|Q3ZY29|HIS6_DEHMC Imidazole glycerol phosphate synthase subunit HisF OS=Dehalococcoides mccartyi (strain CBDB1) GN=hisF PE=3 SV=1 226 541 7.0E-48
sp|Q8CQ92|HIS6_STAES Imidazole glycerol phosphate synthase subunit HisF OS=Staphylococcus epidermidis (strain ATCC 12228) GN=hisF PE=3 SV=1 226 541 7.0E-48
sp|Q4KJS4|HIS6_PSEF5 Imidazole glycerol phosphate synthase subunit HisF OS=Pseudomonas fluorescens (strain Pf-5 / ATCC BAA-477) GN=hisF PE=3 SV=1 226 541 7.0E-48
sp|B1HVQ1|HIS6_LYSSC Imidazole glycerol phosphate synthase subunit HisF OS=Lysinibacillus sphaericus (strain C3-41) GN=hisF PE=3 SV=1 226 541 1.0E-47
sp|B0TDM7|HIS6_HELMI Imidazole glycerol phosphate synthase subunit HisF OS=Heliobacterium modesticaldum (strain ATCC 51547 / Ice1) GN=hisF PE=3 SV=1 226 543 1.0E-47
sp|B3WED1|HIS6_LACCB Imidazole glycerol phosphate synthase subunit HisF OS=Lactobacillus casei (strain BL23) GN=hisF PE=3 SV=1 226 541 1.0E-47
sp|B2UEE5|HIS6_RALPJ Imidazole glycerol phosphate synthase subunit HisF OS=Ralstonia pickettii (strain 12J) GN=hisF PE=3 SV=1 226 541 1.0E-47
sp|Q5P795|HIS6_AROAE Imidazole glycerol phosphate synthase subunit HisF OS=Aromatoleum aromaticum (strain EbN1) GN=hisF PE=3 SV=1 226 541 1.0E-47
sp|Q7UKJ9|HIS6_RHOBA Imidazole glycerol phosphate synthase subunit HisF OS=Rhodopirellula baltica (strain DSM 10527 / NCIMB 13988 / SH1) GN=hisF PE=3 SV=1 226 541 1.0E-47
sp|C3K6V3|HIS6_PSEFS Imidazole glycerol phosphate synthase subunit HisF OS=Pseudomonas fluorescens (strain SBW25) GN=hisF PE=3 SV=1 226 541 1.0E-47
sp|A6UR05|HIS6_METVS Imidazole glycerol phosphate synthase subunit HisF OS=Methanococcus vannielii (strain SB / ATCC 35089 / DSM 1224) GN=hisF PE=3 SV=1 226 541 2.0E-47
sp|P58800|HIS6_PYRFU Imidazole glycerol phosphate synthase subunit HisF OS=Pyrococcus furiosus (strain ATCC 43587 / DSM 3638 / JCM 8422 / Vc1) GN=hisF PE=3 SV=1 226 541 2.0E-47
sp|A4G0J7|HIS6_METM5 Imidazole glycerol phosphate synthase subunit HisF OS=Methanococcus maripaludis (strain C5 / ATCC BAA-1333) GN=hisF PE=3 SV=1 226 541 2.0E-47
sp|Q0K693|HIS6_CUPNH Imidazole glycerol phosphate synthase subunit HisF OS=Cupriavidus necator (strain ATCC 17699 / H16 / DSM 428 / Stanier 337) GN=hisF PE=3 SV=1 226 541 2.0E-47
sp|Q4FPZ3|HIS6_PSYA2 Imidazole glycerol phosphate synthase subunit HisF OS=Psychrobacter arcticus (strain DSM 17307 / 273-4) GN=hisF PE=3 SV=1 226 541 2.0E-47
sp|Q2YZ71|HIS6_STAAB Imidazole glycerol phosphate synthase subunit HisF OS=Staphylococcus aureus (strain bovine RF122 / ET3-1) GN=hisF PE=3 SV=1 226 541 2.0E-47
sp|P64362|HIS6_STAAN Imidazole glycerol phosphate synthase subunit HisF OS=Staphylococcus aureus (strain N315) GN=hisF PE=3 SV=1 226 541 3.0E-47
sp|P64361|HIS6_STAAM Imidazole glycerol phosphate synthase subunit HisF OS=Staphylococcus aureus (strain Mu50 / ATCC 700699) GN=hisF PE=3 SV=1 226 541 3.0E-47
sp|A5IWA0|HIS6_STAA9 Imidazole glycerol phosphate synthase subunit HisF OS=Staphylococcus aureus (strain JH9) GN=hisF PE=3 SV=1 226 541 3.0E-47
sp|A6U558|HIS6_STAA2 Imidazole glycerol phosphate synthase subunit HisF OS=Staphylococcus aureus (strain JH1) GN=hisF PE=3 SV=1 226 541 3.0E-47
sp|A7X763|HIS6_STAA1 Imidazole glycerol phosphate synthase subunit HisF OS=Staphylococcus aureus (strain Mu3 / ATCC 700698) GN=hisF PE=3 SV=1 226 541 3.0E-47
sp|A1U5H5|HIS6_MARHV Imidazole glycerol phosphate synthase subunit HisF OS=Marinobacter hydrocarbonoclasticus (strain ATCC 700491 / DSM 11845 / VT8) GN=hisF PE=3 SV=1 226 541 3.0E-47
sp|A9A5X0|HIS6_NITMS Imidazole glycerol phosphate synthase subunit HisF OS=Nitrosopumilus maritimus (strain SCM1) GN=hisF PE=3 SV=1 226 541 3.0E-47
sp|C1DJD3|HIS6_AZOVD Imidazole glycerol phosphate synthase subunit HisF OS=Azotobacter vinelandii (strain DJ / ATCC BAA-1303) GN=hisF PE=3 SV=1 226 541 3.0E-47
sp|Q039B5|HIS6_LACC3 Imidazole glycerol phosphate synthase subunit HisF OS=Lactobacillus casei (strain ATCC 334) GN=hisF PE=3 SV=1 226 541 3.0E-47
sp|B1MBX3|HIS6_MYCA9 Imidazole glycerol phosphate synthase subunit HisF OS=Mycobacterium abscessus (strain ATCC 19977 / DSM 44196 / CIP 104536 / JCM 13569 / NCTC 13031 / TMC 1543) GN=hisF PE=3 SV=1 229 541 3.0E-47
sp|Q8NUI3|HIS6_STAAW Imidazole glycerol phosphate synthase subunit HisF OS=Staphylococcus aureus (strain MW2) GN=hisF PE=3 SV=1 226 541 4.0E-47
sp|A8Z5H3|HIS6_STAAT Imidazole glycerol phosphate synthase subunit HisF OS=Staphylococcus aureus (strain USA300 / TCH1516) GN=hisF PE=3 SV=1 226 541 4.0E-47
sp|Q6G602|HIS6_STAAS Imidazole glycerol phosphate synthase subunit HisF OS=Staphylococcus aureus (strain MSSA476) GN=hisF PE=3 SV=1 226 541 4.0E-47
sp|A6QKG1|HIS6_STAAE Imidazole glycerol phosphate synthase subunit HisF OS=Staphylococcus aureus (strain Newman) GN=hisF PE=3 SV=1 226 541 4.0E-47
sp|Q5HCM4|HIS6_STAAC Imidazole glycerol phosphate synthase subunit HisF OS=Staphylococcus aureus (strain COL) GN=hisF PE=3 SV=1 226 541 4.0E-47
sp|Q2FDI8|HIS6_STAA3 Imidazole glycerol phosphate synthase subunit HisF OS=Staphylococcus aureus (strain USA300) GN=hisF PE=3 SV=1 226 541 4.0E-47
sp|Q6GDD1|HIS6_STAAR Imidazole glycerol phosphate synthase subunit HisF OS=Staphylococcus aureus (strain MRSA252) GN=hisF PE=3 SV=1 226 541 4.0E-47
sp|A6TKT6|HIS6_ALKMQ Imidazole glycerol phosphate synthase subunit HisF OS=Alkaliphilus metalliredigens (strain QYMF) GN=hisF PE=3 SV=1 226 542 4.0E-47
sp|Q5YYP3|HIS6_NOCFA Imidazole glycerol phosphate synthase subunit HisF OS=Nocardia farcinica (strain IFM 10152) GN=hisF PE=3 SV=1 229 541 4.0E-47
sp|Q8KCB0|HIS6_CHLTE Imidazole glycerol phosphate synthase subunit HisF OS=Chlorobium tepidum (strain ATCC 49652 / DSM 12025 / NBRC 103806 / TLS) GN=hisF PE=3 SV=1 226 541 5.0E-47
sp|Q87UG4|HIS6_PSESM Imidazole glycerol phosphate synthase subunit HisF OS=Pseudomonas syringae pv. tomato (strain DC3000) GN=hisF PE=3 SV=1 226 541 5.0E-47
sp|B7INA3|HIS6_BACC2 Imidazole glycerol phosphate synthase subunit HisF OS=Bacillus cereus (strain G9842) GN=hisF PE=3 SV=1 226 541 5.0E-47
sp|Q31E64|HIS6_THICR Imidazole glycerol phosphate synthase subunit HisF OS=Thiomicrospira crunogena (strain XCL-2) GN=hisF PE=3 SV=1 226 541 5.0E-47
sp|Q3J6Q1|HIS6_NITOC Imidazole glycerol phosphate synthase subunit HisF OS=Nitrosococcus oceani (strain ATCC 19707 / NCIMB 11848) GN=hisF PE=3 SV=1 226 542 6.0E-47
sp|A0LCF3|HIS6_MAGMM Imidazole glycerol phosphate synthase subunit HisF OS=Magnetococcus marinus (strain ATCC BAA-1437 / JCM 17883 / MC-1) GN=hisF PE=3 SV=1 226 541 6.0E-47
sp|C0Q9D3|HIS6_DESAH Imidazole glycerol phosphate synthase subunit HisF OS=Desulfobacterium autotrophicum (strain ATCC 43914 / DSM 3382 / HRM2) GN=hisF PE=3 SV=1 226 542 7.0E-47
sp|B9KXJ6|HIS6_THERP Imidazole glycerol phosphate synthase subunit HisF OS=Thermomicrobium roseum (strain ATCC 27502 / DSM 5159 / P-2) GN=hisF PE=3 SV=1 226 542 9.0E-47
sp|Q4ZLQ2|HIS6_PSEU2 Imidazole glycerol phosphate synthase subunit HisF OS=Pseudomonas syringae pv. syringae (strain B728a) GN=hisF PE=3 SV=1 226 541 1.0E-46
sp|Q48C81|HIS6_PSE14 Imidazole glycerol phosphate synthase subunit HisF OS=Pseudomonas savastanoi pv. phaseolicola (strain 1448A / Race 6) GN=hisF PE=3 SV=1 226 541 1.0E-46
sp|A6VTA6|HIS6_MARMS Imidazole glycerol phosphate synthase subunit HisF OS=Marinomonas sp. (strain MWYL1) GN=hisF PE=3 SV=1 225 541 1.0E-46
sp|B1I556|HIS6_DESAP Imidazole glycerol phosphate synthase subunit HisF OS=Desulforudis audaxviator (strain MP104C) GN=hisF PE=3 SV=1 226 541 2.0E-46
sp|B2HQA8|HIS6_MYCMM Imidazole glycerol phosphate synthase subunit HisF OS=Mycobacterium marinum (strain ATCC BAA-535 / M) GN=hisF PE=3 SV=1 224 541 2.0E-46
sp|Q2RGW2|HIS6_MOOTA Imidazole glycerol phosphate synthase subunit HisF OS=Moorella thermoacetica (strain ATCC 39073) GN=hisF PE=3 SV=1 226 541 2.0E-46
sp|C5D7N8|HIS6_GEOSW Imidazole glycerol phosphate synthase subunit HisF OS=Geobacillus sp. (strain WCH70) GN=hisF PE=3 SV=1 226 541 2.0E-46
sp|A1T8W7|HIS6_MYCVP Imidazole glycerol phosphate synthase subunit HisF OS=Mycobacterium vanbaalenii (strain DSM 7251 / PYR-1) GN=hisF PE=3 SV=1 229 541 2.0E-46
sp|A1W444|HIS6_ACISJ Imidazole glycerol phosphate synthase subunit HisF OS=Acidovorax sp. (strain JS42) GN=hisF PE=3 SV=1 226 541 2.0E-46
sp|B9MDW3|HIS6_ACIET Imidazole glycerol phosphate synthase subunit HisF OS=Acidovorax ebreus (strain TPSY) GN=hisF PE=3 SV=1 226 541 2.0E-46
sp|Q845U7|HIS6_BURM1 Imidazole glycerol phosphate synthase subunit HisF OS=Burkholderia multivorans (strain ATCC 17616 / 249) GN=hisF PE=3 SV=1 226 541 2.0E-46
sp|B8GU32|HIS6_THISH Imidazole glycerol phosphate synthase subunit HisF OS=Thioalkalivibrio sulfidiphilus (strain HL-EbGR7) GN=hisF PE=3 SV=1 226 541 2.0E-46
sp|B3R794|HIS6_CUPTR Imidazole glycerol phosphate synthase subunit HisF OS=Cupriavidus taiwanensis (strain R1 / LMG 19424) GN=hisF PE=3 SV=1 226 541 3.0E-46
sp|C5BMF5|HIS6_TERTT Imidazole glycerol phosphate synthase subunit HisF OS=Teredinibacter turnerae (strain ATCC 39867 / T7901) GN=hisF PE=3 SV=1 226 541 3.0E-46
sp|Q2SMB2|HIS6_HAHCH Imidazole glycerol phosphate synthase subunit HisF OS=Hahella chejuensis (strain KCTC 2396) GN=hisF PE=3 SV=1 225 541 3.0E-46
sp|Q0AW41|HIS6_SYNWW Imidazole glycerol phosphate synthase subunit HisF OS=Syntrophomonas wolfei subsp. wolfei (strain DSM 2245B / Goettingen) GN=hisF PE=3 SV=1 228 541 3.0E-46
sp|A1TL06|HIS6_ACIAC Imidazole glycerol phosphate synthase subunit HisF OS=Acidovorax citrulli (strain AAC00-1) GN=hisF PE=3 SV=1 226 541 3.0E-46
sp|B9DIP1|HIS6_STACT Imidazole glycerol phosphate synthase subunit HisF OS=Staphylococcus carnosus (strain TM300) GN=hisF PE=3 SV=1 226 541 3.0E-46
sp|B9L718|HIS6_NAUPA Imidazole glycerol phosphate synthase subunit HisF OS=Nautilia profundicola (strain ATCC BAA-1463 / DSM 18972 / AmH) GN=hisF PE=3 SV=1 226 541 4.0E-46
sp|A0PP20|HIS6_MYCUA Imidazole glycerol phosphate synthase subunit HisF OS=Mycobacterium ulcerans (strain Agy99) GN=hisF PE=3 SV=1 224 541 5.0E-46
sp|Q21NH5|HIS6_SACD2 Imidazole glycerol phosphate synthase subunit HisF OS=Saccharophagus degradans (strain 2-40 / ATCC 43961 / DSM 17024) GN=hisF PE=3 SV=1 226 541 6.0E-46
sp|B7HHG5|HIS6_BACC4 Imidazole glycerol phosphate synthase subunit HisF OS=Bacillus cereus (strain B4264) GN=hisF PE=3 SV=1 226 541 7.0E-46
sp|B6YWA9|HIS6_THEON Imidazole glycerol phosphate synthase subunit HisF OS=Thermococcus onnurineus (strain NA1) GN=hisF PE=3 SV=1 226 541 8.0E-46
sp|Q970Z0|HIS6_SULTO Imidazole glycerol phosphate synthase subunit HisF OS=Sulfolobus tokodaii (strain DSM 16993 / JCM 10545 / NBRC 100140 / 7) GN=hisF PE=3 SV=1 228 541 9.0E-46
sp|A9B5I5|HIS6_HERA2 Imidazole glycerol phosphate synthase subunit HisF OS=Herpetosiphon aurantiacus (strain ATCC 23779 / DSM 785) GN=hisF PE=3 SV=1 226 542 9.0E-46
sp|B3EKW7|HIS6_CHLPB Imidazole glycerol phosphate synthase subunit HisF OS=Chlorobium phaeobacteroides (strain BS1) GN=hisF PE=3 SV=1 226 541 9.0E-46
sp|Q8GDQ6|HIS6_HELMO Imidazole glycerol phosphate synthase subunit HisF (Fragment) OS=Heliobacillus mobilis GN=hisF PE=3 SV=1 226 543 1.0E-45
sp|P60715|HIS6_GEOSL Imidazole glycerol phosphate synthase subunit HisF OS=Geobacter sulfurreducens (strain ATCC 51573 / DSM 12127 / PCA) GN=hisF PE=3 SV=1 226 541 1.0E-45
sp|A0LFI1|HIS6_SYNFM Imidazole glycerol phosphate synthase subunit HisF OS=Syntrophobacter fumaroxidans (strain DSM 10017 / MPOB) GN=hisF PE=3 SV=1 226 542 1.0E-45
sp|Q8XV85|HIS6_RALSO Imidazole glycerol phosphate synthase subunit HisF OS=Ralstonia solanacearum (strain GMI1000) GN=hisF PE=3 SV=1 226 542 1.0E-45
sp|B3QQ00|HIS6_CHLP8 Imidazole glycerol phosphate synthase subunit HisF OS=Chlorobaculum parvum (strain NCIB 8327) GN=hisF PE=3 SV=1 226 541 1.0E-45
sp|A7GMV0|HIS6_BACCN Imidazole glycerol phosphate synthase subunit HisF OS=Bacillus cytotoxicus (strain DSM 22905 / CIP 110041 / 391-98 / NVH 391-98) GN=hisF PE=3 SV=1 226 541 1.0E-45
sp|Q81G02|HIS6_BACCR Imidazole glycerol phosphate synthase subunit HisF OS=Bacillus cereus (strain ATCC 14579 / DSM 31 / JCM 2152 / NBRC 15305 / NCIMB 9373 / NRRL B-3711) GN=hisF PE=3 SV=1 226 541 1.0E-45
sp|Q2J8L3|HIS6_FRASC Imidazole glycerol phosphate synthase subunit HisF OS=Frankia sp. (strain CcI3) GN=hisF PE=3 SV=1 229 541 1.0E-45
sp|B2UQA2|HIS6_AKKM8 Imidazole glycerol phosphate synthase subunit HisF OS=Akkermansia muciniphila (strain ATCC BAA-835 / Muc) GN=hisF PE=3 SV=1 226 541 2.0E-45
sp|B4S9G0|HIS6_PROA2 Imidazole glycerol phosphate synthase subunit HisF OS=Prosthecochloris aestuarii (strain DSM 271 / SK 413) GN=hisF PE=3 SV=1 226 541 2.0E-45
sp|B3EEF2|HIS6_CHLL2 Imidazole glycerol phosphate synthase subunit HisF OS=Chlorobium limicola (strain DSM 245 / NBRC 103803) GN=hisF PE=3 SV=1 226 541 2.0E-45
sp|C6E7F4|HIS6_GEOSM Imidazole glycerol phosphate synthase subunit HisF OS=Geobacter sp. (strain M21) GN=hisF PE=3 SV=1 226 541 2.0E-45
sp|C1ATY7|HIS6_RHOOB Imidazole glycerol phosphate synthase subunit HisF OS=Rhodococcus opacus (strain B4) GN=hisF PE=3 SV=1 226 541 2.0E-45
sp|Q46WL8|HIS6_CUPPJ Imidazole glycerol phosphate synthase subunit HisF OS=Cupriavidus pinatubonensis (strain JMP 134 / LMG 1197) GN=hisF PE=3 SV=1 226 541 2.0E-45
sp|Q0SHY7|HIS6_RHOJR Imidazole glycerol phosphate synthase subunit HisF OS=Rhodococcus jostii (strain RHA1) GN=hisF PE=3 SV=1 226 541 2.0E-45
sp|B5EDR4|HIS6_GEOBB Imidazole glycerol phosphate synthase subunit HisF OS=Geobacter bemidjiensis (strain Bem / ATCC BAA-1014 / DSM 16622) GN=hisF PE=3 SV=1 226 541 3.0E-45
sp|A5WHT5|HIS6_PSYWF Imidazole glycerol phosphate synthase subunit HisF OS=Psychrobacter sp. (strain PRwf-1) GN=hisF PE=3 SV=1 226 541 3.0E-45
sp|C0QPQ6|HIS6_PERMH Imidazole glycerol phosphate synthase subunit HisF OS=Persephonella marina (strain DSM 14350 / EX-H1) GN=hisF PE=3 SV=1 226 541 3.0E-45
sp|B8FP24|HIS6_DESHD Imidazole glycerol phosphate synthase subunit HisF OS=Desulfitobacterium hafniense (strain DCB-2 / DSM 10664) GN=hisF PE=3 SV=1 226 542 3.0E-45
sp|Q11VM1|HIS6_CYTH3 Imidazole glycerol phosphate synthase subunit HisF OS=Cytophaga hutchinsonii (strain ATCC 33406 / NCIMB 9469) GN=hisF PE=3 SV=1 226 542 3.0E-45
sp|Q1IKB2|HIS6_KORVE Imidazole glycerol phosphate synthase subunit HisF OS=Koribacter versatilis (strain Ellin345) GN=hisF PE=3 SV=1 226 541 4.0E-45
sp|Q39YP2|HIS6_GEOMG Imidazole glycerol phosphate synthase subunit HisF OS=Geobacter metallireducens (strain GS-15 / ATCC 53774 / DSM 7210) GN=hisF PE=3 SV=1 226 541 4.0E-45
sp|Q1R080|HIS6_CHRSD Imidazole glycerol phosphate synthase subunit HisF OS=Chromohalobacter salexigens (strain DSM 3043 / ATCC BAA-138 / NCIMB 13768) GN=hisF PE=3 SV=1 226 541 4.0E-45
sp|Q24QJ5|HIS6_DESHY Imidazole glycerol phosphate synthase subunit HisF OS=Desulfitobacterium hafniense (strain Y51) GN=hisF PE=3 SV=1 226 542 4.0E-45
sp|A5CZ73|HIS6_PELTS Imidazole glycerol phosphate synthase subunit HisF OS=Pelotomaculum thermopropionicum (strain DSM 13744 / JCM 10971 / SI) GN=hisF PE=3 SV=1 226 541 4.0E-45
sp|A9WR62|HIS6_RENSM Imidazole glycerol phosphate synthase subunit HisF OS=Renibacterium salmoninarum (strain ATCC 33209 / DSM 20767 / JCM 11484 / NBRC 15589 / NCIMB 2235) GN=hisF PE=3 SV=1 229 541 5.0E-45
sp|Q3SEU8|HIS6_THIDA Imidazole glycerol phosphate synthase subunit HisF OS=Thiobacillus denitrificans (strain ATCC 25259) GN=hisF PE=3 SV=1 226 541 5.0E-45
sp|A6Q117|HIS6_NITSB Imidazole glycerol phosphate synthase subunit HisF OS=Nitratiruptor sp. (strain SB155-2) GN=hisF PE=3 SV=1 226 541 5.0E-45
sp|C1ANM7|HIS6_MYCBT Imidazole glycerol phosphate synthase subunit HisF OS=Mycobacterium bovis (strain BCG / Tokyo 172 / ATCC 35737 / TMC 1019) GN=hisF PE=3 SV=1 223 541 5.0E-45
sp|A1KJ21|HIS6_MYCBP Imidazole glycerol phosphate synthase subunit HisF OS=Mycobacterium bovis (strain BCG / Pasteur 1173P2) GN=hisF PE=3 SV=1 223 541 5.0E-45
sp|Q7VEW8|HIS6_MYCBO Imidazole glycerol phosphate synthase subunit HisF OS=Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97) GN=hisF PE=3 SV=1 223 541 5.0E-45
sp|A4SFU1|HIS6_CHLPM Imidazole glycerol phosphate synthase subunit HisF OS=Chlorobium phaeovibrioides (strain DSM 265 / 1930) GN=hisF PE=3 SV=1 226 541 6.0E-45
sp|A4G9I6|HIS6_HERAR Imidazole glycerol phosphate synthase subunit HisF OS=Herminiimonas arsenicoxydans GN=hisF PE=3 SV=1 226 541 6.0E-45
sp|B3Q951|HIS6_RHOPT Imidazole glycerol phosphate synthase subunit HisF OS=Rhodopseudomonas palustris (strain TIE-1) GN=hisF PE=3 SV=1 229 541 7.0E-45
sp|P60667|HIS6_RHOPA Imidazole glycerol phosphate synthase subunit HisF OS=Rhodopseudomonas palustris (strain ATCC BAA-98 / CGA009) GN=hisF PE=3 SV=1 229 541 7.0E-45
sp|P9WMM3|HIS6_MYCTU Imidazole glycerol phosphate synthase subunit HisF OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=hisF PE=1 SV=1 223 541 7.0E-45
sp|P9WMM2|HIS6_MYCTO Imidazole glycerol phosphate synthase subunit HisF OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) GN=hisF PE=3 SV=1 223 541 7.0E-45
sp|A5U2W1|HIS6_MYCTA Imidazole glycerol phosphate synthase subunit HisF OS=Mycobacterium tuberculosis (strain ATCC 25177 / H37Ra) GN=hisF PE=3 SV=1 223 541 7.0E-45
sp|Q1LIB2|HIS6_CUPMC Imidazole glycerol phosphate synthase subunit HisF OS=Cupriavidus metallidurans (strain ATCC 43123 / DSM 2839 / NBRC 102507 / CH34) GN=hisF PE=3 SV=1 226 542 8.0E-45
sp|A1BHP6|HIS6_CHLPD Imidazole glycerol phosphate synthase subunit HisF OS=Chlorobium phaeobacteroides (strain DSM 266) GN=hisF PE=3 SV=1 226 541 8.0E-45
sp|B1ILB0|HIS6_CLOBK Imidazole glycerol phosphate synthase subunit HisF OS=Clostridium botulinum (strain Okra / Type B1) GN=hisF PE=3 SV=1 226 541 8.0E-45
sp|C1EMQ7|HIS6_BACC3 Imidazole glycerol phosphate synthase subunit HisF OS=Bacillus cereus (strain 03BB102) GN=hisF PE=3 SV=1 226 541 9.0E-45
sp|A0RBM2|HIS6_BACAH Imidazole glycerol phosphate synthase subunit HisF OS=Bacillus thuringiensis (strain Al Hakam) GN=hisF PE=3 SV=1 226 541 9.0E-45
sp|A1KSN6|HIS6_NEIMF Imidazole glycerol phosphate synthase subunit HisF OS=Neisseria meningitidis serogroup C / serotype 2a (strain ATCC 700532 / DSM 15464 / FAM18) GN=hisF PE=3 SV=1 226 541 9.0E-45
sp|Q1H4R2|HIS6_METFK Imidazole glycerol phosphate synthase subunit HisF OS=Methylobacillus flagellatus (strain KT / ATCC 51484 / DSM 6875) GN=hisF PE=3 SV=1 226 541 9.0E-45
sp|Q9JVH5|HIS6_NEIMA Imidazole glycerol phosphate synthase subunit HisF OS=Neisseria meningitidis serogroup A / serotype 4A (strain Z2491) GN=hisF PE=3 SV=1 226 541 1.0E-44
sp|B4RJN3|HIS6_NEIG2 Imidazole glycerol phosphate synthase subunit HisF OS=Neisseria gonorrhoeae (strain NCCP11945) GN=hisF PE=3 SV=1 226 541 1.0E-44
sp|Q5FA23|HIS6_NEIG1 Imidazole glycerol phosphate synthase subunit HisF OS=Neisseria gonorrhoeae (strain ATCC 700825 / FA 1090) GN=hisF PE=3 SV=1 226 541 1.0E-44
sp|B3E617|HIS6_GEOLS Imidazole glycerol phosphate synthase subunit HisF OS=Geobacter lovleyi (strain ATCC BAA-1151 / DSM 17278 / SZ) GN=hisF PE=3 SV=1 226 541 1.0E-44
sp|B5EQF2|HIS6_ACIF5 Imidazole glycerol phosphate synthase subunit HisF OS=Acidithiobacillus ferrooxidans (strain ATCC 53993) GN=hisF PE=3 SV=1 226 541 1.0E-44
sp|B7JA19|HIS6_ACIF2 Imidazole glycerol phosphate synthase subunit HisF OS=Acidithiobacillus ferrooxidans (strain ATCC 23270 / DSM 14882 / CIP 104768 / NCIMB 8455) GN=hisF PE=3 SV=1 226 541 1.0E-44
sp|A9M2Q5|HIS6_NEIM0 Imidazole glycerol phosphate synthase subunit HisF OS=Neisseria meningitidis serogroup C (strain 053442) GN=hisF PE=3 SV=1 226 541 1.0E-44
sp|Q2J340|HIS6_RHOP2 Imidazole glycerol phosphate synthase subunit HisF OS=Rhodopseudomonas palustris (strain HaA2) GN=hisF PE=3 SV=1 229 541 1.0E-44
sp|Q07UQ9|HIS6_RHOP5 Imidazole glycerol phosphate synthase subunit HisF OS=Rhodopseudomonas palustris (strain BisA53) GN=hisF PE=3 SV=1 229 541 1.0E-44
sp|A6T376|HIS6_JANMA Imidazole glycerol phosphate synthase subunit HisF OS=Janthinobacterium sp. (strain Marseille) GN=hisF PE=3 SV=1 226 541 1.0E-44
sp|A9VLH7|HIS6_BACWK Imidazole glycerol phosphate synthase subunit HisF OS=Bacillus weihenstephanensis (strain KBAB4) GN=hisF PE=3 SV=1 226 541 1.0E-44
sp|Q21U91|HIS6_RHOFT Imidazole glycerol phosphate synthase subunit HisF OS=Rhodoferax ferrireducens (strain ATCC BAA-621 / DSM 15236 / T118) GN=hisF PE=3 SV=1 226 541 1.0E-44
sp|A4YJV5|HIS6_BRASO Imidazole glycerol phosphate synthase subunit HisF OS=Bradyrhizobium sp. (strain ORS278) GN=hisF PE=3 SV=1 229 541 1.0E-44
sp|B8FFL4|HIS6_DESAA Imidazole glycerol phosphate synthase subunit HisF OS=Desulfatibacillum alkenivorans (strain AK-01) GN=hisF PE=3 SV=1 226 541 2.0E-44
sp|A8HYT7|HIS6_AZOC5 Imidazole glycerol phosphate synthase subunit HisF OS=Azorhizobium caulinodans (strain ATCC 43989 / DSM 5975 / JCM 20966 / NBRC 14845 / NCIMB 13405 / ORS 571) GN=hisF PE=3 SV=1 226 542 2.0E-44
sp|Q3A137|HIS6_PELCD Imidazole glycerol phosphate synthase subunit HisF OS=Pelobacter carbinolicus (strain DSM 2380 / Gra Bd 1) GN=hisF PE=3 SV=1 226 541 2.0E-44
sp|Q5KVD0|HIS6_GEOKA Imidazole glycerol phosphate synthase subunit HisF OS=Geobacillus kaustophilus (strain HTA426) GN=hisF PE=3 SV=1 226 541 2.0E-44
sp|A0AG15|HIS6_LISW6 Imidazole glycerol phosphate synthase subunit HisF OS=Listeria welshimeri serovar 6b (strain ATCC 35897 / DSM 20650 / SLCC5334) GN=hisF PE=3 SV=1 226 541 2.0E-44
sp|Q6AF73|HIS6_LEIXX Imidazole glycerol phosphate synthase subunit HisF OS=Leifsonia xyli subsp. xyli (strain CTCB07) GN=hisF PE=3 SV=1 225 541 2.0E-44
sp|A8ZVD2|HIS6_DESOH Imidazole glycerol phosphate synthase subunit HisF OS=Desulfococcus oleovorans (strain DSM 6200 / Hxd3) GN=hisF PE=3 SV=1 226 542 2.0E-44
sp|Q9K0H4|HIS6_NEIMB Imidazole glycerol phosphate synthase subunit HisF OS=Neisseria meningitidis serogroup B (strain MC58) GN=hisF PE=3 SV=1 226 541 2.0E-44
sp|A1KAV4|HIS6_AZOSB Imidazole glycerol phosphate synthase subunit HisF OS=Azoarcus sp. (strain BH72) GN=hisF PE=3 SV=1 226 541 2.0E-44
sp|A5I246|HIS6_CLOBH Imidazole glycerol phosphate synthase subunit HisF OS=Clostridium botulinum (strain Hall / ATCC 3502 / NCTC 13319 / Type A) GN=hisF PE=3 SV=1 226 541 3.0E-44
sp|A7FU82|HIS6_CLOB1 Imidazole glycerol phosphate synthase subunit HisF OS=Clostridium botulinum (strain ATCC 19397 / Type A) GN=hisF PE=3 SV=1 226 541 3.0E-44
sp|Q8DTR3|HIS6_STRMU Imidazole glycerol phosphate synthase subunit HisF OS=Streptococcus mutans serotype c (strain ATCC 700610 / UA159) GN=hisF PE=3 SV=1 226 541 4.0E-44
sp|Q3AD48|HIS6_CARHZ Imidazole glycerol phosphate synthase subunit HisF OS=Carboxydothermus hydrogenoformans (strain ATCC BAA-161 / DSM 6008 / Z-2901) GN=hisF PE=3 SV=1 226 541 4.0E-44
sp|A8FHQ9|HIS6_BACP2 Imidazole glycerol phosphate synthase subunit HisF OS=Bacillus pumilus (strain SAFR-032) GN=hisF PE=3 SV=1 226 541 4.0E-44
sp|B7HKD4|HIS6_BACC7 Imidazole glycerol phosphate synthase subunit HisF OS=Bacillus cereus (strain AH187) GN=hisF PE=3 SV=1 226 541 5.0E-44
sp|B8J216|HIS6_DESDA Imidazole glycerol phosphate synthase subunit HisF OS=Desulfovibrio desulfuricans (strain ATCC 27774 / DSM 6949) GN=hisF PE=3 SV=1 226 541 5.0E-44
sp|Q1QRX0|HIS6_NITHX Imidazole glycerol phosphate synthase subunit HisF OS=Nitrobacter hamburgensis (strain X14 / DSM 10229) GN=hisF PE=3 SV=1 229 541 5.0E-44
sp|Q12FC7|HIS6_POLSJ Imidazole glycerol phosphate synthase subunit HisF OS=Polaromonas sp. (strain JS666 / ATCC BAA-500) GN=hisF PE=3 SV=1 226 541 5.0E-44
sp|C4XS73|HIS6_DESMR Imidazole glycerol phosphate synthase subunit HisF OS=Desulfovibrio magneticus (strain ATCC 700980 / DSM 13731 / RS-1) GN=hisF PE=3 SV=1 226 543 6.0E-44
sp|A8EQW5|HIS6_ARCB4 Imidazole glycerol phosphate synthase subunit HisF OS=Arcobacter butzleri (strain RM4018) GN=hisF PE=3 SV=1 224 541 6.0E-44
sp|B4SFM7|HIS6_PELPB Imidazole glycerol phosphate synthase subunit HisF OS=Pelodictyon phaeoclathratiforme (strain DSM 5477 / BU-1) GN=hisF PE=3 SV=1 226 541 6.0E-44
sp|A7GDQ7|HIS6_CLOBL Imidazole glycerol phosphate synthase subunit HisF OS=Clostridium botulinum (strain Langeland / NCTC 10281 / Type F) GN=hisF PE=3 SV=1 226 541 6.0E-44
sp|Q13E40|HIS6_RHOPS Imidazole glycerol phosphate synthase subunit HisF OS=Rhodopseudomonas palustris (strain BisB5) GN=hisF PE=3 SV=1 229 541 6.0E-44
sp|C1FN42|HIS6_CLOBJ Imidazole glycerol phosphate synthase subunit HisF OS=Clostridium botulinum (strain Kyoto / Type A2) GN=hisF PE=3 SV=1 226 541 7.0E-44
sp|Q63DW8|HIS6_BACCZ Imidazole glycerol phosphate synthase subunit HisF OS=Bacillus cereus (strain ZK / E33L) GN=hisF PE=3 SV=1 226 541 7.0E-44
sp|B7JFZ5|HIS6_BACC0 Imidazole glycerol phosphate synthase subunit HisF OS=Bacillus cereus (strain AH820) GN=hisF PE=3 SV=1 226 541 7.0E-44
sp|A9GBI6|HIS6_SORC5 Imidazole glycerol phosphate synthase subunit HisF OS=Sorangium cellulosum (strain So ce56) GN=hisF PE=3 SV=1 226 541 7.0E-44
sp|Q21CK1|HIS6_RHOPB Imidazole glycerol phosphate synthase subunit HisF OS=Rhodopseudomonas palustris (strain BisB18) GN=hisF PE=3 SV=1 229 541 8.0E-44
sp|Q4A049|HIS6_STAS1 Imidazole glycerol phosphate synthase subunit HisF OS=Staphylococcus saprophyticus subsp. saprophyticus (strain ATCC 15305 / DSM 20229) GN=hisF PE=3 SV=1 226 541 1.0E-43
sp|A6WC96|HIS6_KINRD Imidazole glycerol phosphate synthase subunit HisF OS=Kineococcus radiotolerans (strain ATCC BAA-149 / DSM 14245 / SRS30216) GN=hisF PE=3 SV=1 229 541 1.0E-43
sp|A4ISR2|HIS6_GEOTN Imidazole glycerol phosphate synthase subunit HisF OS=Geobacillus thermodenitrificans (strain NG80-2) GN=hisF PE=3 SV=1 226 541 1.0E-43
sp|A1SL56|HIS6_NOCSJ Imidazole glycerol phosphate synthase subunit HisF OS=Nocardioides sp. (strain BAA-499 / JS614) GN=hisF PE=3 SV=1 226 541 1.0E-43
sp|A6QCU4|HIS6_SULNB Imidazole glycerol phosphate synthase subunit HisF OS=Sulfurovum sp. (strain NBC37-1) GN=hisF PE=3 SV=1 226 541 1.0E-43
sp|B9IV00|HIS6_BACCQ Imidazole glycerol phosphate synthase subunit HisF OS=Bacillus cereus (strain Q1) GN=hisF PE=3 SV=1 226 541 1.0E-43
sp|A1VK42|HIS6_POLNA Imidazole glycerol phosphate synthase subunit HisF OS=Polaromonas naphthalenivorans (strain CJ2) GN=hisF PE=3 SV=1 226 541 2.0E-43
sp|B4U7M4|HIS6_HYDS0 Imidazole glycerol phosphate synthase subunit HisF OS=Hydrogenobaculum sp. (strain Y04AAS1) GN=hisF PE=3 SV=1 226 541 2.0E-43
sp|B7GQS5|HIS6_BIFLS Imidazole glycerol phosphate synthase subunit HisF OS=Bifidobacterium longum subsp. infantis (strain ATCC 15697 / DSM 20088 / JCM 1222 / NCTC 11817 / S12) GN=hisF PE=3 SV=1 226 541 2.0E-43
sp|Q89WM4|HIS6_BRADU Imidazole glycerol phosphate synthase subunit HisF OS=Bradyrhizobium diazoefficiens (strain JCM 10833 / IAM 13628 / NBRC 14792 / USDA 110) GN=hisF PE=3 SV=1 229 541 2.0E-43
sp|Q3SWF1|HIS6_NITWN Imidazole glycerol phosphate synthase subunit HisF OS=Nitrobacter winogradskyi (strain Nb-255 / ATCC 25391) GN=hisF PE=3 SV=1 229 541 2.0E-43
sp|A3DJF7|HIS6_CLOTH Imidazole glycerol phosphate synthase subunit HisF OS=Clostridium thermocellum (strain ATCC 27405 / DSM 1237 / NBRC 103400 / NCIMB 10682 / NRRL B-4536 / VPI 7372) GN=hisF PE=3 SV=1 226 542 2.0E-43
sp|Q0A5D3|HIS6_ALKEH Imidazole glycerol phosphate synthase subunit HisF OS=Alkalilimnicola ehrlichii (strain ATCC BAA-1101 / DSM 17681 / MLHE-1) GN=hisF PE=3 SV=1 226 541 3.0E-43
sp|B3PGA4|HIS6_CELJU Imidazole glycerol phosphate synthase subunit HisF OS=Cellvibrio japonicus (strain Ueda107) GN=hisF PE=3 SV=1 226 541 3.0E-43
sp|Q3ATG0|HIS6_CHLCH Imidazole glycerol phosphate synthase subunit HisF OS=Chlorobium chlorochromatii (strain CaD3) GN=hisF PE=3 SV=1 226 541 4.0E-43
sp|A9KP30|HIS6_CLOPH Imidazole glycerol phosphate synthase subunit HisF OS=Clostridium phytofermentans (strain ATCC 700394 / DSM 18823 / ISDg) GN=hisF PE=3 SV=1 227 541 4.0E-43
sp|P62449|HIS6_BACC1 Imidazole glycerol phosphate synthase subunit HisF OS=Bacillus cereus (strain ATCC 10987 / NRS 248) GN=hisF PE=3 SV=1 226 541 4.0E-43
sp|Q9X7C2|HIS6_MYCLE Imidazole glycerol phosphate synthase subunit HisF OS=Mycobacterium leprae (strain TN) GN=hisF PE=3 SV=1 224 541 4.0E-43
sp|B8ZRB4|HIS6_MYCLB Imidazole glycerol phosphate synthase subunit HisF OS=Mycobacterium leprae (strain Br4923) GN=hisF PE=3 SV=1 224 541 4.0E-43
sp|A5E8E5|HIS6_BRASB Imidazole glycerol phosphate synthase subunit HisF OS=Bradyrhizobium sp. (strain BTAi1 / ATCC BAA-1182) GN=hisF PE=3 SV=1 229 541 5.0E-43
sp|C3KVX6|HIS6_CLOB6 Imidazole glycerol phosphate synthase subunit HisF OS=Clostridium botulinum (strain 657 / Type Ba4) GN=hisF PE=3 SV=1 226 541 5.0E-43
sp|Q5JFU8|HIS6_THEKO Imidazole glycerol phosphate synthase subunit HisF OS=Thermococcus kodakarensis (strain ATCC BAA-918 / JCM 12380 / KOD1) GN=hisF PE=3 SV=1 226 541 6.0E-43
sp|Q6HLE3|HIS6_BACHK Imidazole glycerol phosphate synthase subunit HisF OS=Bacillus thuringiensis subsp. konkukian (strain 97-27) GN=hisF PE=3 SV=1 226 541 6.0E-43
sp|Q81T58|HIS6_BACAN Imidazole glycerol phosphate synthase subunit HisF OS=Bacillus anthracis GN=hisF PE=3 SV=1 226 541 6.0E-43
sp|C3L9P7|HIS6_BACAC Imidazole glycerol phosphate synthase subunit HisF OS=Bacillus anthracis (strain CDC 684 / NRRL 3495) GN=hisF PE=3 SV=1 226 541 6.0E-43
sp|C3P506|HIS6_BACAA Imidazole glycerol phosphate synthase subunit HisF OS=Bacillus anthracis (strain A0248) GN=hisF PE=3 SV=1 226 541 6.0E-43
sp|Q722Y7|HIS6_LISMF Imidazole glycerol phosphate synthase subunit HisF OS=Listeria monocytogenes serotype 4b (strain F2365) GN=hisF PE=3 SV=1 226 541 6.0E-43
sp|C1L0J2|HIS6_LISMC Imidazole glycerol phosphate synthase subunit HisF OS=Listeria monocytogenes serotype 4b (strain CLIP80459) GN=hisF PE=3 SV=1 226 541 6.0E-43
sp|A0JVK5|HIS6_ARTS2 Imidazole glycerol phosphate synthase subunit HisF OS=Arthrobacter sp. (strain FB24) GN=hisF PE=3 SV=1 229 541 6.0E-43
sp|Q3B2Q6|HIS6_CHLL7 Imidazole glycerol phosphate synthase subunit HisF OS=Chlorobium luteolum (strain DSM 273 / 2530) GN=hisF PE=3 SV=1 226 541 7.0E-43
sp|B2A6X0|HIS6_NATTJ Imidazole glycerol phosphate synthase subunit HisF OS=Natranaerobius thermophilus (strain ATCC BAA-1301 / DSM 18059 / JW/NM-WN-LF) GN=hisF PE=3 SV=1 226 541 7.0E-43
sp|B3DRT8|HIS6_BIFLD Imidazole glycerol phosphate synthase subunit HisF OS=Bifidobacterium longum (strain DJO10A) GN=hisF PE=3 SV=1 226 541 8.0E-43
sp|A1VGY9|HIS6_DESVV Imidazole glycerol phosphate synthase subunit HisF OS=Desulfovibrio vulgaris subsp. vulgaris (strain DP4) GN=hisF PE=3 SV=1 226 542 9.0E-43
sp|P62450|HIS6_DESVH Imidazole glycerol phosphate synthase subunit HisF OS=Desulfovibrio vulgaris (strain Hildenborough / ATCC 29579 / NCIMB 8303) GN=hisF PE=3 SV=1 226 542 9.0E-43
sp|A3M9P1|HIS6_ACIBT Imidazole glycerol phosphate synthase subunit HisF OS=Acinetobacter baumannii (strain ATCC 17978 / CIP 53.77 / LMG 1025 / NCDC KC755 / 5377) GN=hisF PE=3 SV=2 226 541 1.0E-42
sp|B2I0P3|HIS6_ACIBC Imidazole glycerol phosphate synthase subunit HisF OS=Acinetobacter baumannii (strain ACICU) GN=hisF PE=3 SV=1 226 541 1.0E-42
sp|B7IBD7|HIS6_ACIB5 Imidazole glycerol phosphate synthase subunit HisF OS=Acinetobacter baumannii (strain AB0057) GN=hisF PE=3 SV=1 226 541 1.0E-42
sp|B7GVJ5|HIS6_ACIB3 Imidazole glycerol phosphate synthase subunit HisF OS=Acinetobacter baumannii (strain AB307-0294) GN=hisF PE=3 SV=1 226 541 1.0E-42
sp|A1WR24|HIS6_VEREI Imidazole glycerol phosphate synthase subunit HisF OS=Verminephrobacter eiseniae (strain EF01-2) GN=hisF PE=3 SV=1 226 542 1.0E-42
sp|Q4FNT7|HIS6_PELUB Imidazole glycerol phosphate synthase subunit HisF OS=Pelagibacter ubique (strain HTCC1062) GN=hisF PE=3 SV=1 226 541 1.0E-42
sp|Q3MEF5|HIS6_ANAVT Imidazole glycerol phosphate synthase subunit HisF OS=Anabaena variabilis (strain ATCC 29413 / PCC 7937) GN=hisF PE=3 SV=1 226 543 1.0E-42
sp|B9LFN2|HIS6_CHLSY Imidazole glycerol phosphate synthase subunit HisF OS=Chloroflexus aurantiacus (strain ATCC 29364 / DSM 637 / Y-400-fl) GN=hisF PE=3 SV=1 226 543 1.0E-42
sp|A9WD80|HIS6_CHLAA Imidazole glycerol phosphate synthase subunit HisF OS=Chloroflexus aurantiacus (strain ATCC 29366 / DSM 635 / J-10-fl) GN=hisF PE=3 SV=1 226 543 1.0E-42
sp|Q8YT31|HIS6_NOSS1 Imidazole glycerol phosphate synthase subunit HisF OS=Nostoc sp. (strain PCC 7120 / UTEX 2576) GN=hisF PE=3 SV=1 226 543 1.0E-42
sp|A9BXA1|HIS6_DELAS Imidazole glycerol phosphate synthase subunit HisF OS=Delftia acidovorans (strain DSM 14801 / SPH-1) GN=hisF PE=3 SV=1 226 541 2.0E-42
sp|B8DQX6|HIS6_DESVM Imidazole glycerol phosphate synthase subunit HisF OS=Desulfovibrio vulgaris (strain Miyazaki F / DSM 19637) GN=hisF PE=3 SV=1 226 542 2.0E-42
sp|Q9S2T7|HIS6_STRCO Imidazole glycerol phosphate synthase subunit HisF OS=Streptomyces coelicolor (strain ATCC BAA-471 / A3(2) / M145) GN=hisF PE=3 SV=1 226 541 2.0E-42
sp|A5UY52|HIS6_ROSS1 Imidazole glycerol phosphate synthase subunit HisF OS=Roseiflexus sp. (strain RS-1) GN=hisF PE=3 SV=1 226 541 2.0E-42
sp|C5CQK0|HIS6_VARPS Imidazole glycerol phosphate synthase subunit HisF OS=Variovorax paradoxus (strain S110) GN=hisF PE=3 SV=1 226 541 2.0E-42
sp|A7IHN9|HIS6_XANP2 Imidazole glycerol phosphate synthase subunit HisF OS=Xanthobacter autotrophicus (strain ATCC BAA-1158 / Py2) GN=hisF PE=3 SV=1 226 541 3.0E-42
sp|B8DUB2|HIS6_BIFA0 Imidazole glycerol phosphate synthase subunit HisF OS=Bifidobacterium animalis subsp. lactis (strain AD011) GN=hisF PE=3 SV=1 226 541 3.0E-42
sp|Q8G6F7|HIS6_BIFLO Imidazole glycerol phosphate synthase subunit HisF OS=Bifidobacterium longum (strain NCC 2705) GN=hisF PE=3 SV=1 226 541 3.0E-42
sp|B5YIB7|HIS6_THEYD Imidazole glycerol phosphate synthase subunit HisF OS=Thermodesulfovibrio yellowstonii (strain ATCC 51303 / DSM 11347 / YP87) GN=hisF PE=3 SV=1 226 541 4.0E-42
sp|Q8Y9G5|HIS6_LISMO Imidazole glycerol phosphate synthase subunit HisF OS=Listeria monocytogenes serovar 1/2a (strain ATCC BAA-679 / EGD-e) GN=hisF PE=3 SV=1 226 541 5.0E-42
sp|B7GL45|HIS6_ANOFW Imidazole glycerol phosphate synthase subunit HisF OS=Anoxybacillus flavithermus (strain DSM 21510 / WK1) GN=hisF PE=3 SV=1 226 541 5.0E-42
sp|A9BE47|HIS6_PROM4 Imidazole glycerol phosphate synthase subunit HisF OS=Prochlorococcus marinus (strain MIT 9211) GN=hisF PE=3 SV=1 229 541 7.0E-42
sp|B6JCG5|HIS6_OLICO Imidazole glycerol phosphate synthase subunit HisF OS=Oligotropha carboxidovorans (strain ATCC 49405 / DSM 1227 / OM5) GN=hisF PE=3 SV=1 229 541 9.0E-42
sp|B8GBF3|HIS6_CHLAD Imidazole glycerol phosphate synthase subunit HisF OS=Chloroflexus aggregans (strain MD-66 / DSM 9485) GN=hisF PE=3 SV=1 226 545 1.0E-41
sp|Q4J8I9|HIS6_SULAC Imidazole glycerol phosphate synthase subunit HisF OS=Sulfolobus acidocaldarius (strain ATCC 33909 / DSM 639 / JCM 8929 / NBRC 15157 / NCIMB 11770) GN=hisF PE=3 SV=1 227 542 1.0E-41
sp|Q9RPQ4|HIS6_THEP3 Imidazole glycerol phosphate synthase subunit HisF OS=Thermoanaerobacter pseudethanolicus (strain ATCC 33223 / 39E) GN=hisF PE=3 SV=1 226 542 1.0E-41
sp|C5A7A2|HIS6_THEGJ Imidazole glycerol phosphate synthase subunit HisF OS=Thermococcus gammatolerans (strain DSM 15229 / JCM 11827 / EJ3) GN=hisF PE=3 SV=1 226 541 2.0E-41
sp|Q6A7Y8|HIS6_PROAC Imidazole glycerol phosphate synthase subunit HisF OS=Propionibacterium acnes (strain KPA171202 / DSM 16379) GN=hisF PE=3 SV=1 229 541 2.0E-41
sp|B1ZX57|HIS6_OPITP Imidazole glycerol phosphate synthase subunit HisF OS=Opitutus terrae (strain DSM 11246 / PB90-1) GN=hisF PE=3 SV=1 226 541 2.0E-41
sp|C5CBK1|HIS6_MICLC Imidazole glycerol phosphate synthase subunit HisF OS=Micrococcus luteus (strain ATCC 4698 / DSM 20030 / JCM 1464 / NBRC 3333 / NCIMB 9278 / NCTC 2665 / VKM Ac-2230) GN=hisF PE=3 SV=1 226 541 2.0E-41
sp|Q316L4|HIS6_DESAG Imidazole glycerol phosphate synthase subunit HisF OS=Desulfovibrio alaskensis (strain G20) GN=hisF PE=3 SV=1 226 541 2.0E-41
sp|P26721|HIS6_AZOBR Imidazole glycerol phosphate synthase subunit HisF OS=Azospirillum brasilense GN=hisF PE=3 SV=1 226 541 3.0E-41
sp|Q6F799|HIS6_ACIAD Imidazole glycerol phosphate synthase subunit HisF OS=Acinetobacter baylyi (strain ATCC 33305 / BD413 / ADP1) GN=hisF PE=3 SV=2 226 541 3.0E-41
sp|O34727|HIS6_BACSU Imidazole glycerol phosphate synthase subunit HisF OS=Bacillus subtilis (strain 168) GN=hisF PE=3 SV=1 226 541 3.0E-41
sp|A1R5S1|HIS6_ARTAT Imidazole glycerol phosphate synthase subunit HisF OS=Arthrobacter aurescens (strain TC1) GN=hisF PE=3 SV=1 229 541 4.0E-41
sp|B2GGU9|HIS6_KOCRD Imidazole glycerol phosphate synthase subunit HisF OS=Kocuria rhizophila (strain ATCC 9341 / DSM 348 / NBRC 103217 / DC2201) GN=hisF PE=3 SV=1 225 541 4.0E-41
sp|A5CXY8|HIS6_VESOH Imidazole glycerol phosphate synthase subunit HisF OS=Vesicomyosocius okutanii subsp. Calyptogena okutanii (strain HA) GN=hisF PE=3 SV=1 226 541 4.0E-41
sp|Q65EG3|HIS6_BACLD Imidazole glycerol phosphate synthase subunit HisF OS=Bacillus licheniformis (strain ATCC 14580 / DSM 13 / JCM 2505 / NBRC 12200 / NCIMB 9375 / NRRL NRS-1264 / Gibson 46) GN=hisF PE=3 SV=1 226 541 4.0E-41
sp|C1FAD8|HIS6_ACIC5 Imidazole glycerol phosphate synthase subunit HisF OS=Acidobacterium capsulatum (strain ATCC 51196 / DSM 11244 / JCM 7670 / NBRC 15755 / NCIMB 13165 / 161) GN=hisF PE=3 SV=1 226 541 5.0E-41
sp|Q82A99|HIS6_STRAW Imidazole glycerol phosphate synthase subunit HisF OS=Streptomyces avermitilis (strain ATCC 31267 / DSM 46492 / JCM 5070 / NBRC 14893 / NCIMB 12804 / NRRL 8165 / MA-4680) GN=hisF PE=3 SV=1 226 541 5.0E-41
sp|Q8ESS2|HIS6_OCEIH Imidazole glycerol phosphate synthase subunit HisF OS=Oceanobacillus iheyensis (strain DSM 14371 / JCM 11309 / KCTC 3954 / HTE831) GN=hisF PE=3 SV=1 226 542 6.0E-41
sp|A1WW05|HIS6_HALHL Imidazole glycerol phosphate synthase subunit HisF OS=Halorhodospira halophila (strain DSM 244 / SL1) GN=hisF PE=3 SV=1 228 542 6.0E-41
sp|Q02YX1|HIS6_LACLS Imidazole glycerol phosphate synthase subunit HisF OS=Lactococcus lactis subsp. cremoris (strain SK11) GN=hisF PE=3 SV=1 226 533 7.0E-41
sp|B8I5V6|HIS6_CLOCE Imidazole glycerol phosphate synthase subunit HisF OS=Clostridium cellulolyticum (strain ATCC 35319 / DSM 5812 / JCM 6584 / H10) GN=hisF PE=3 SV=1 226 541 7.0E-41
sp|C4L176|HIS6_EXISA Imidazole glycerol phosphate synthase subunit HisF OS=Exiguobacterium sp. (strain ATCC BAA-1283 / AT1b) GN=hisF PE=3 SV=1 226 548 9.0E-41
sp|Q02133|HIS6_LACLA Imidazole glycerol phosphate synthase subunit HisF OS=Lactococcus lactis subsp. lactis (strain IL1403) GN=hisF PE=3 SV=3 226 541 1.0E-40
sp|B2UX20|HIS6_CLOBA Imidazole glycerol phosphate synthase subunit HisF OS=Clostridium botulinum (strain Alaska E43 / Type E3) GN=hisF PE=3 SV=1 227 541 1.0E-40
sp|A1AV74|HIS6_RUTMC Imidazole glycerol phosphate synthase subunit HisF OS=Ruthia magnifica subsp. Calyptogena magnifica GN=hisF PE=3 SV=1 226 541 1.0E-40
sp|Q67KI0|HIS6_SYMTH Imidazole glycerol phosphate synthase subunit HisF OS=Symbiobacterium thermophilum (strain T / IAM 14863) GN=hisF PE=3 SV=1 226 541 1.0E-40
sp|A7ZGB2|HIS6_CAMC1 Imidazole glycerol phosphate synthase subunit HisF OS=Campylobacter concisus (strain 13826) GN=hisF PE=3 SV=1 226 541 1.0E-40
sp|Q8ZY16|HIS6_PYRAE Imidazole glycerol phosphate synthase subunit HisF OS=Pyrobaculum aerophilum (strain ATCC 51768 / IM2 / DSM 7523 / JCM 9630 / NBRC 100827) GN=hisF PE=1 SV=1 229 541 2.0E-40
sp|A2SE09|HIS6_METPP Imidazole glycerol phosphate synthase subunit HisF OS=Methylibium petroleiphilum (strain PM1) GN=hisF PE=3 SV=1 226 542 2.0E-40
sp|A2RKR7|HIS6_LACLM Imidazole glycerol phosphate synthase subunit HisF OS=Lactococcus lactis subsp. cremoris (strain MG1363) GN=hisF PE=3 SV=1 226 533 2.0E-40
sp|Q88UE3|HIS6_LACPL Imidazole glycerol phosphate synthase subunit HisF OS=Lactobacillus plantarum (strain ATCC BAA-793 / NCIMB 8826 / WCFS1) GN=hisF PE=3 SV=1 226 541 2.0E-40
sp|B1W0M6|HIS6_STRGG Imidazole glycerol phosphate synthase subunit HisF OS=Streptomyces griseus subsp. griseus (strain JCM 4626 / NBRC 13350) GN=hisF PE=3 SV=1 226 541 2.0E-40
sp|Q3M5W4|HIS5_ANAVT Imidazole glycerol phosphate synthase subunit HisH OS=Anabaena variabilis (strain ATCC 29413 / PCC 7937) GN=hisH PE=3 SV=1 1 202 3.0E-40
sp|A9BJZ9|HIS6_PETMO Imidazole glycerol phosphate synthase subunit HisF OS=Petrotoga mobilis (strain DSM 10674 / SJ95) GN=hisF PE=3 SV=1 226 541 4.0E-40
sp|B8H6U2|HIS6_ARTCA Imidazole glycerol phosphate synthase subunit HisF OS=Arthrobacter chlorophenolicus (strain ATCC 700700 / DSM 12829 / JCM 12360 / NCIMB 13794 / A6) GN=hisF PE=3 SV=1 229 541 4.0E-40
sp|A3CNT0|HIS6_STRSV Imidazole glycerol phosphate synthase subunit HisF OS=Streptococcus sanguinis (strain SK36) GN=hisF PE=3 SV=1 226 541 5.0E-40
sp|B8EM84|HIS6_METSB Imidazole glycerol phosphate synthase subunit HisF OS=Methylocella silvestris (strain BL2 / DSM 15510 / NCIMB 13906) GN=hisF PE=3 SV=1 226 541 5.0E-40
sp|Q7MAS1|HIS6_WOLSU Imidazole glycerol phosphate synthase subunit HisF OS=Wolinella succinogenes (strain ATCC 29543 / DSM 1740 / LMG 7466 / NCTC 11488 / FDC 602W) GN=hisF PE=3 SV=1 226 541 5.0E-40
sp|B3QSI0|HIS6_CHLT3 Imidazole glycerol phosphate synthase subunit HisF OS=Chloroherpeton thalassium (strain ATCC 35110 / GB-78) GN=hisF PE=3 SV=1 226 541 6.0E-40
sp|B2J1A3|HIS5_NOSP7 Imidazole glycerol phosphate synthase subunit HisH OS=Nostoc punctiforme (strain ATCC 29133 / PCC 73102) GN=hisH PE=3 SV=1 1 201 8.0E-40
sp|Q8DJN7|HIS6_THEEB Imidazole glycerol phosphate synthase subunit HisF OS=Thermosynechococcus elongatus (strain BP-1) GN=hisF PE=3 SV=1 226 544 9.0E-40
sp|P74106|HIS6_SYNY3 Imidazole glycerol phosphate synthase subunit HisF OS=Synechocystis sp. (strain PCC 6803 / Kazusa) GN=hisF PE=3 SV=1 226 542 9.0E-40
sp|B0JY78|HIS6_MICAN Imidazole glycerol phosphate synthase subunit HisF OS=Microcystis aeruginosa (strain NIES-843) GN=hisF PE=3 SV=1 226 541 9.0E-40
sp|Q5FTN3|HIS6_GLUOX Imidazole glycerol phosphate synthase subunit HisF OS=Gluconobacter oxydans (strain 621H) GN=hisF PE=3 SV=1 226 544 1.0E-39
sp|B8HUR1|HIS5_CYAP4 Imidazole glycerol phosphate synthase subunit HisH OS=Cyanothece sp. (strain PCC 7425 / ATCC 29141) GN=hisH PE=3 SV=1 1 202 2.0E-39
sp|B6IWI7|HIS6_RHOCS Imidazole glycerol phosphate synthase subunit HisF OS=Rhodospirillum centenum (strain ATCC 51521 / SW) GN=hisF PE=3 SV=1 226 541 2.0E-39
sp|Q7NDC1|HIS6_GLOVI Imidazole glycerol phosphate synthase subunit HisF OS=Gloeobacter violaceus (strain PCC 7421) GN=hisF PE=3 SV=1 226 542 2.0E-39
sp|B1YL09|HIS6_EXIS2 Imidazole glycerol phosphate synthase subunit HisF OS=Exiguobacterium sibiricum (strain DSM 17290 / JCM 13490 / 255-15) GN=hisF PE=3 SV=1 226 541 3.0E-39
sp|P59119|HIS6_LEPIN Imidazole glycerol phosphate synthase subunit HisF OS=Leptospira interrogans serogroup Icterohaemorrhagiae serovar Lai (strain 56601) GN=hisF PE=3 SV=1 224 541 3.0E-39
sp|P62451|HIS6_LEPIC Imidazole glycerol phosphate synthase subunit HisF OS=Leptospira interrogans serogroup Icterohaemorrhagiae serovar copenhageni (strain Fiocruz L1-130) GN=hisF PE=3 SV=1 224 541 3.0E-39
sp|Q7VGZ1|HIS6_HELHP Imidazole glycerol phosphate synthase subunit HisF OS=Helicobacter hepaticus (strain ATCC 51449 / 3B1) GN=hisF PE=3 SV=1 226 541 3.0E-39
sp|A2C0N7|HIS6_PROM1 Imidazole glycerol phosphate synthase subunit HisF OS=Prochlorococcus marinus (strain NATL1A) GN=hisF PE=3 SV=1 229 544 3.0E-39
sp|B0BYP8|HIS5_ACAM1 Imidazole glycerol phosphate synthase subunit HisH OS=Acaryochloris marina (strain MBIC 11017) GN=hisH PE=3 SV=1 1 201 4.0E-39
sp|A8AY24|HIS6_STRGC Imidazole glycerol phosphate synthase subunit HisF OS=Streptococcus gordonii (strain Challis / ATCC 35105 / CH1 / DL1 / V288) GN=hisF PE=3 SV=1 226 541 5.0E-39
sp|Q2JVR1|HIS5_SYNJA Imidazole glycerol phosphate synthase subunit HisH OS=Synechococcus sp. (strain JA-3-3Ab) GN=hisH PE=3 SV=1 6 201 5.0E-39
sp|Q8DIP5|HIS5_THEEB Imidazole glycerol phosphate synthase subunit HisH OS=Thermosynechococcus elongatus (strain BP-1) GN=hisH PE=3 SV=1 2 201 6.0E-39
sp|Q18C74|HIS6_PEPD6 Imidazole glycerol phosphate synthase subunit HisF OS=Peptoclostridium difficile (strain 630) GN=hisF PE=3 SV=1 226 541 7.0E-39
sp|Q5WDI2|HIS6_BACSK Imidazole glycerol phosphate synthase subunit HisF OS=Bacillus clausii (strain KSM-K16) GN=hisF PE=3 SV=1 226 541 8.0E-39
sp|A7Z962|HIS6_BACMF Imidazole glycerol phosphate synthase subunit HisF OS=Bacillus methylotrophicus (strain DSM 23117 / BGSC 10A6 / FZB42) GN=hisF PE=3 SV=1 226 541 8.0E-39
sp|C5BV99|HIS6_BEUC1 Imidazole glycerol phosphate synthase subunit HisF OS=Beutenbergia cavernae (strain ATCC BAA-8 / DSM 12333 / NBRC 16432) GN=hisF PE=3 SV=1 229 541 8.0E-39
sp|B7KPM8|HIS6_METC4 Imidazole glycerol phosphate synthase subunit HisF OS=Methylobacterium extorquens (strain CM4 / NCIMB 13688) GN=hisF PE=3 SV=1 226 541 9.0E-39
sp|B2ICL0|HIS6_BEII9 Imidazole glycerol phosphate synthase subunit HisF OS=Beijerinckia indica subsp. indica (strain ATCC 9039 / DSM 1715 / NCIB 8712) GN=hisF PE=3 SV=1 226 551 1.0E-38
sp|Q3A135|HIS5_PELCD Imidazole glycerol phosphate synthase subunit HisH OS=Pelobacter carbinolicus (strain DSM 2380 / Gra Bd 1) GN=hisH PE=3 SV=1 6 200 2.0E-38
sp|Q64RT2|HIS6_BACFR Imidazole glycerol phosphate synthase subunit HisF OS=Bacteroides fragilis (strain YCH46) GN=hisF PE=3 SV=1 226 541 2.0E-38
sp|A0RRT8|HIS6_CAMFF Imidazole glycerol phosphate synthase subunit HisF OS=Campylobacter fetus subsp. fetus (strain 82-40) GN=hisF PE=3 SV=1 226 541 2.0E-38
sp|A5CRW2|HIS6_CLAM3 Imidazole glycerol phosphate synthase subunit HisF OS=Clavibacter michiganensis subsp. michiganensis (strain NCPPB 382) GN=hisF PE=3 SV=1 226 542 2.0E-38
sp|Q8YX49|HIS5_NOSS1 Imidazole glycerol phosphate synthase subunit HisH OS=Nostoc sp. (strain PCC 7120 / UTEX 2576) GN=hisH PE=3 SV=1 1 202 3.0E-38
sp|B1ZAD6|HIS6_METPB Imidazole glycerol phosphate synthase subunit HisF OS=Methylobacterium populi (strain ATCC BAA-705 / NCIMB 13946 / BJ001) GN=hisF PE=3 SV=1 226 541 3.0E-38
sp|B1H0E6|HIS6_UNCTG Imidazole glycerol phosphate synthase subunit HisF OS=Uncultured termite group 1 bacterium phylotype Rs-D17 GN=hisF PE=3 SV=1 229 547 3.0E-38
sp|A9W5U0|HIS6_METEP Imidazole glycerol phosphate synthase subunit HisF OS=Methylobacterium extorquens (strain PA1) GN=hisF PE=3 SV=1 226 541 4.0E-38
sp|Q5LBD7|HIS6_BACFN Imidazole glycerol phosphate synthase subunit HisF OS=Bacteroides fragilis (strain ATCC 25285 / DSM 2151 / JCM 11019 / NCTC 9343) GN=hisF PE=3 SV=1 226 541 4.0E-38
sp|A6GY75|HIS6_FLAPJ Imidazole glycerol phosphate synthase subunit HisF OS=Flavobacterium psychrophilum (strain JIP02/86 / ATCC 49511) GN=hisF PE=3 SV=1 226 541 4.0E-38
sp|B0SRP0|HIS6_LEPBP Imidazole glycerol phosphate synthase subunit HisF OS=Leptospira biflexa serovar Patoc (strain Patoc 1 / ATCC 23582 / Paris) GN=hisF PE=3 SV=1 226 541 4.0E-38
sp|B0S8V2|HIS6_LEPBA Imidazole glycerol phosphate synthase subunit HisF OS=Leptospira biflexa serovar Patoc (strain Patoc 1 / Ames) GN=hisF PE=3 SV=1 226 541 4.0E-38
sp|B7KGN3|HIS5_CYAP7 Imidazole glycerol phosphate synthase subunit HisH OS=Cyanothece sp. (strain PCC 7424) GN=hisH PE=3 SV=1 1 202 5.0E-38
sp|Q30NR6|HIS6_SULDN Imidazole glycerol phosphate synthase subunit HisF OS=Sulfurimonas denitrificans (strain ATCC 33889 / DSM 1251) GN=hisF PE=3 SV=1 226 541 5.0E-38
sp|A6LT22|HIS6_CLOB8 Imidazole glycerol phosphate synthase subunit HisF OS=Clostridium beijerinckii (strain ATCC 51743 / NCIMB 8052) GN=hisF PE=3 SV=1 227 541 5.0E-38
sp|Q2JN09|HIS5_SYNJB Imidazole glycerol phosphate synthase subunit HisH OS=Synechococcus sp. (strain JA-2-3B'a(2-13)) GN=hisH PE=3 SV=1 6 201 5.0E-38
sp|B2KEU8|HIS6_ELUMP Imidazole glycerol phosphate synthase subunit HisF OS=Elusimicrobium minutum (strain Pei191) GN=hisF PE=3 SV=1 226 541 5.0E-38
sp|B0JFQ9|HIS5_MICAN Imidazole glycerol phosphate synthase subunit HisH OS=Microcystis aeruginosa (strain NIES-843) GN=hisH PE=3 SV=1 1 201 6.0E-38
sp|A5FYE5|HIS6_ACICJ Imidazole glycerol phosphate synthase subunit HisF OS=Acidiphilium cryptum (strain JF-5) GN=hisF PE=3 SV=1 226 541 7.0E-38
sp|Q39YP4|HIS5_GEOMG Imidazole glycerol phosphate synthase subunit HisH OS=Geobacter metallireducens (strain GS-15 / ATCC 53774 / DSM 7210) GN=hisH PE=3 SV=1 1 200 9.0E-38
sp|Q7SIB9|HIS6_THET8 Imidazole glycerol phosphate synthase subunit HisF OS=Thermus thermophilus (strain HB8 / ATCC 27634 / DSM 579) GN=hisF PE=1 SV=1 226 541 1.0E-37
sp|B2GBR5|HIS6_LACF3 Imidazole glycerol phosphate synthase subunit HisF OS=Lactobacillus fermentum (strain NBRC 3956 / LMG 18251) GN=hisF PE=3 SV=1 226 541 1.0E-37
sp|P62453|HIS6_THET2 Imidazole glycerol phosphate synthase subunit HisF OS=Thermus thermophilus (strain HB27 / ATCC BAA-163 / DSM 7039) GN=hisF PE=3 SV=1 226 541 1.0E-37
sp|A2BV90|HIS6_PROM5 Imidazole glycerol phosphate synthase subunit HisF OS=Prochlorococcus marinus (strain MIT 9515) GN=hisF PE=3 SV=1 229 544 1.0E-37
sp|Q1IX39|HIS6_DEIGD Imidazole glycerol phosphate synthase subunit HisF OS=Deinococcus geothermalis (strain DSM 11300) GN=hisF PE=3 SV=1 226 541 1.0E-37
sp|Q28NK0|HIS6_JANSC Imidazole glycerol phosphate synthase subunit HisF OS=Jannaschia sp. (strain CCS1) GN=hisF PE=3 SV=1 226 541 2.0E-37
sp|Q1GEZ3|HIS6_RUEST Imidazole glycerol phosphate synthase subunit HisF OS=Ruegeria sp. (strain TM1040) GN=hisF PE=3 SV=1 226 541 2.0E-37
sp|A7GVW5|HIS6_CAMC5 Imidazole glycerol phosphate synthase subunit HisF OS=Campylobacter curvus (strain 525.92) GN=hisF PE=3 SV=1 226 541 2.0E-37
sp|Q46GY9|HIS6_PROMT Imidazole glycerol phosphate synthase subunit HisF OS=Prochlorococcus marinus (strain NATL2A) GN=hisF PE=3 SV=1 229 544 3.0E-37
sp|Q050D2|HIS6_LEPBL Imidazole glycerol phosphate synthase subunit HisF OS=Leptospira borgpetersenii serovar Hardjo-bovis (strain L550) GN=hisF PE=3 SV=1 224 541 3.0E-37
sp|Q04SA6|HIS6_LEPBJ Imidazole glycerol phosphate synthase subunit HisF OS=Leptospira borgpetersenii serovar Hardjo-bovis (strain JB197) GN=hisF PE=3 SV=1 224 541 3.0E-37
sp|Q6F7A7|HIS5_ACIAD Imidazole glycerol phosphate synthase subunit HisH OS=Acinetobacter baylyi (strain ATCC 33305 / BD413 / ADP1) GN=hisH PE=3 SV=1 1 201 4.0E-37
sp|B6YQ30|HIS6_AZOPC Imidazole glycerol phosphate synthase subunit HisF OS=Azobacteroides pseudotrichonymphae genomovar. CFP2 GN=hisF PE=3 SV=1 226 542 5.0E-37
sp|Q5NMD6|HIS6_ZYMMO Imidazole glycerol phosphate synthase subunit HisF OS=Zymomonas mobilis subsp. mobilis (strain ATCC 31821 / ZM4 / CP4) GN=hisF PE=3 SV=1 226 542 5.0E-37
sp|A6L6Z2|HIS6_BACV8 Imidazole glycerol phosphate synthase subunit HisF OS=Bacteroides vulgatus (strain ATCC 8482 / DSM 1447 / NCTC 11154) GN=hisF PE=3 SV=1 226 541 5.0E-37
sp|A8G3E4|HIS6_PROM2 Imidazole glycerol phosphate synthase subunit HisF OS=Prochlorococcus marinus (strain MIT 9215) GN=hisF PE=3 SV=1 229 544 6.0E-37
sp|Q9X0C6|HIS6_THEMA Imidazole glycerol phosphate synthase subunit HisF OS=Thermotoga maritima (strain ATCC 43589 / MSB8 / DSM 3109 / JCM 10099) GN=hisF PE=1 SV=1 226 541 7.0E-37
sp|B8IPH3|HIS6_METNO Imidazole glycerol phosphate synthase subunit HisF OS=Methylobacterium nodulans (strain ORS2060 / LMG 21967) GN=hisF PE=3 SV=1 226 541 9.0E-37
sp|Q113E7|HIS5_TRIEI Imidazole glycerol phosphate synthase subunit HisH OS=Trichodesmium erythraeum (strain IMS101) GN=hisH PE=3 SV=1 1 213 1.0E-36
sp|A2BPR2|HIS6_PROMS Imidazole glycerol phosphate synthase subunit HisF OS=Prochlorococcus marinus (strain AS9601) GN=hisF PE=3 SV=1 229 544 1.0E-36
sp|B1L873|HIS6_THESQ Imidazole glycerol phosphate synthase subunit HisF OS=Thermotoga sp. (strain RQ2) GN=hisF PE=3 SV=1 226 541 1.0E-36
sp|A5FFX6|HIS6_FLAJ1 Imidazole glycerol phosphate synthase subunit HisF OS=Flavobacterium johnsoniae (strain ATCC 17061 / DSM 2064 / UW101) GN=hisF PE=3 SV=1 226 541 1.0E-36
sp|Q9RX89|HIS5_DEIRA Imidazole glycerol phosphate synthase subunit HisH OS=Deinococcus radiodurans (strain ATCC 13939 / DSM 20539 / JCM 16871 / LMG 4051 / NBRC 15346 / NCIMB 9279 / R1 / VKM B-1422) GN=hisH PE=3 SV=1 2 200 1.0E-36
sp|B0T798|HIS6_CAUSK Imidazole glycerol phosphate synthase subunit HisF OS=Caulobacter sp. (strain K31) GN=hisF PE=3 SV=1 226 541 1.0E-36
sp|Q2S295|HIS6_SALRD Imidazole glycerol phosphate synthase subunit HisF OS=Salinibacter ruber (strain DSM 13855 / M31) GN=hisF PE=3 SV=1 226 541 1.0E-36
sp|A8LHX5|HIS6_DINSH Imidazole glycerol phosphate synthase subunit HisF OS=Dinoroseobacter shibae (strain DSM 16493 / NCIMB 14021 / DFL 12) GN=hisF PE=3 SV=1 226 541 1.0E-36
sp|A1W0U9|HIS51_CAMJJ Imidazole glycerol phosphate synthase subunit HisH 1 OS=Campylobacter jejuni subsp. jejuni serotype O:23/36 (strain 81-176) GN=hisH1 PE=3 SV=1 3 200 2.0E-36
sp|Q9K6Z6|HIS6_BACHD Imidazole glycerol phosphate synthase subunit HisF OS=Bacillus halodurans (strain ATCC BAA-125 / DSM 18197 / FERM 7344 / JCM 9153 / C-125) GN=hisF PE=3 SV=1 226 541 2.0E-36
sp|A1B388|HIS6_PARDP Imidazole glycerol phosphate synthase subunit HisF OS=Paracoccus denitrificans (strain Pd 1222) GN=hisF PE=3 SV=1 226 541 2.0E-36
sp|Q3J6Q3|HIS5_NITOC Imidazole glycerol phosphate synthase subunit HisH OS=Nitrosococcus oceani (strain ATCC 19707 / NCIMB 11848) GN=hisH PE=3 SV=1 1 207 2.0E-36
sp|B8E2C8|HIS6_DICTD Imidazole glycerol phosphate synthase subunit HisF OS=Dictyoglomus turgidum (strain Z-1310 / DSM 6724) GN=hisF PE=3 SV=1 226 541 2.0E-36
sp|A6WX52|HIS6_OCHA4 Imidazole glycerol phosphate synthase subunit HisF OS=Ochrobactrum anthropi (strain ATCC 49188 / DSM 6882 / NCTC 12168) GN=hisF PE=3 SV=1 226 541 3.0E-36
sp|Q5HT90|HIS51_CAMJR Imidazole glycerol phosphate synthase subunit HisH 1 OS=Campylobacter jejuni (strain RM1221) GN=hisH1 PE=3 SV=1 3 201 3.0E-36
sp|Q8A7Z6|HIS6_BACTN Imidazole glycerol phosphate synthase subunit HisF OS=Bacteroides thetaiotaomicron (strain ATCC 29148 / DSM 2079 / NCTC 10582 / E50 / VPI-5482) GN=hisF PE=3 SV=1 226 541 4.0E-36
sp|A8LX55|HIS6_SALAI Imidazole glycerol phosphate synthase subunit HisF OS=Salinispora arenicola (strain CNS-205) GN=hisF PE=3 SV=1 226 541 4.0E-36
sp|Q31CA5|HIS6_PROM9 Imidazole glycerol phosphate synthase subunit HisF OS=Prochlorococcus marinus (strain MIT 9312) GN=hisF PE=3 SV=1 229 544 5.0E-36
sp|Q162Q1|HIS6_ROSDO Imidazole glycerol phosphate synthase subunit HisF OS=Roseobacter denitrificans (strain ATCC 33942 / OCh 114) GN=hisF PE=3 SV=1 226 541 5.0E-36
sp|Q9A229|HIS6_CAUCR Imidazole glycerol phosphate synthase subunit HisF OS=Caulobacter crescentus (strain ATCC 19089 / CB15) GN=hisF PE=3 SV=1 226 541 6.0E-36
sp|B8GW15|HIS6_CAUCN Imidazole glycerol phosphate synthase subunit HisF OS=Caulobacter crescentus (strain NA1000 / CB15N) GN=hisF PE=3 SV=1 226 541 6.0E-36
sp|Q0P8U2|HIS51_CAMJE Imidazole glycerol phosphate synthase subunit HisH 1 OS=Campylobacter jejuni subsp. jejuni serotype O:2 (strain ATCC 700819 / NCTC 11168) GN=hisH1 PE=1 SV=1 3 200 6.0E-36
sp|A9GZW9|HIS6_GLUDA Imidazole glycerol phosphate synthase subunit HisF OS=Gluconacetobacter diazotrophicus (strain ATCC 49037 / DSM 5601 / PAl5) GN=hisF PE=3 SV=1 226 542 6.0E-36
sp|A5INE6|HIS6_THEP1 Imidazole glycerol phosphate synthase subunit HisF OS=Thermotoga petrophila (strain RKU-1 / ATCC BAA-488 / DSM 13995) GN=hisF PE=3 SV=1 226 541 1.0E-35
sp|Q5LU99|HIS6_RUEPO Imidazole glycerol phosphate synthase subunit HisF OS=Ruegeria pomeroyi (strain ATCC 700808 / DSM 15171 / DSS-3) GN=hisF PE=3 SV=1 226 541 1.0E-35
sp|A4WUS8|HIS6_RHOS5 Imidazole glycerol phosphate synthase subunit HisF OS=Rhodobacter sphaeroides (strain ATCC 17025 / ATH 2.4.3) GN=hisF PE=3 SV=1 226 541 1.0E-35
sp|P60599|HIS5_GEOSL Imidazole glycerol phosphate synthase subunit HisH OS=Geobacter sulfurreducens (strain ATCC 51573 / DSM 12127 / PCA) GN=hisH PE=3 SV=1 1 200 1.0E-35
sp|Q03VY0|HIS6_LEUMM Imidazole glycerol phosphate synthase subunit HisF OS=Leuconostoc mesenteroides subsp. mesenteroides (strain ATCC 8293 / NCDO 523) GN=hisF PE=3 SV=1 226 541 1.0E-35
sp|B1LUA2|HIS6_METRJ Imidazole glycerol phosphate synthase subunit HisF OS=Methylobacterium radiotolerans (strain ATCC 27329 / DSM 1819 / JCM 2831) GN=hisF PE=3 SV=1 226 541 1.0E-35
sp|A6LDI7|HIS6_PARD8 Imidazole glycerol phosphate synthase subunit HisF OS=Parabacteroides distasonis (strain ATCC 8503 / DSM 20701 / NCTC 11152) GN=hisF PE=3 SV=1 226 541 1.0E-35
sp|C3MBC1|HIS6_RHISN Imidazole glycerol phosphate synthase subunit HisF OS=Rhizobium sp. (strain NGR234) GN=hisF PE=3 SV=1 226 541 2.0E-35
sp|P45603|HIS6_KLEOX Imidazole glycerol phosphate synthase subunit HisF OS=Klebsiella oxytoca GN=hisF PE=3 SV=1 226 541 2.0E-35
sp|A0M283|HIS6_GRAFK Imidazole glycerol phosphate synthase subunit HisF OS=Gramella forsetii (strain KT0803) GN=hisF PE=3 SV=1 226 541 2.0E-35
sp|Q2VYJ0|HIS6_MAGSA Imidazole glycerol phosphate synthase subunit HisF OS=Magnetospirillum magneticum (strain AMB-1 / ATCC 700264) GN=hisF PE=3 SV=1 226 541 2.0E-35
sp|A5V9W0|HIS6_SPHWW Imidazole glycerol phosphate synthase subunit HisF OS=Sphingomonas wittichii (strain RW1 / DSM 6014 / JCM 10273) GN=hisF PE=3 SV=1 229 542 2.0E-35
sp|Q7ULP3|HIS5_RHOBA Imidazole glycerol phosphate synthase subunit HisH OS=Rhodopirellula baltica (strain DSM 10527 / NCIMB 13988 / SH1) GN=hisH PE=3 SV=1 4 202 2.0E-35
sp|B5YE90|HIS6_DICT6 Imidazole glycerol phosphate synthase subunit HisF OS=Dictyoglomus thermophilum (strain ATCC 35947 / DSM 3960 / H-6-12) GN=hisF PE=3 SV=1 226 541 2.0E-35
sp|C5BG16|HIS6_EDWI9 Imidazole glycerol phosphate synthase subunit HisF OS=Edwardsiella ictaluri (strain 93-146) GN=hisF PE=3 SV=1 226 541 2.0E-35
sp|Q8YE37|HIS6_BRUME Imidazole glycerol phosphate synthase subunit HisF OS=Brucella melitensis biotype 1 (strain 16M / ATCC 23456 / NCTC 10094) GN=hisF PE=3 SV=1 226 541 3.0E-35
sp|C0RFX3|HIS6_BRUMB Imidazole glycerol phosphate synthase subunit HisF OS=Brucella melitensis biotype 2 (strain ATCC 23457) GN=hisF PE=3 SV=1 226 541 3.0E-35
sp|B0UHR5|HIS6_METS4 Imidazole glycerol phosphate synthase subunit HisF OS=Methylobacterium sp. (strain 4-46) GN=hisF PE=3 SV=1 226 541 3.0E-35
sp|A7HSH0|HIS6_PARL1 Imidazole glycerol phosphate synthase subunit HisF OS=Parvibaculum lavamentivorans (strain DS-1 / DSM 13023 / NCIMB 13966) GN=hisF PE=3 SV=1 226 541 3.0E-35
sp|Q7SIC0|HIS5_THET8 Imidazole glycerol phosphate synthase subunit HisH OS=Thermus thermophilus (strain HB8 / ATCC 27634 / DSM 579) GN=hisH PE=1 SV=1 6 194 3.0E-35
sp|Q8FY07|HIS6_BRUSU Imidazole glycerol phosphate synthase subunit HisF OS=Brucella suis biovar 1 (strain 1330) GN=hisF PE=3 SV=1 226 541 4.0E-35
sp|B0CJI6|HIS6_BRUSI Imidazole glycerol phosphate synthase subunit HisF OS=Brucella suis (strain ATCC 23445 / NCTC 10510) GN=hisF PE=3 SV=1 226 541 4.0E-35
sp|A5VT43|HIS6_BRUO2 Imidazole glycerol phosphate synthase subunit HisF OS=Brucella ovis (strain ATCC 25840 / 63/290 / NCTC 10512) GN=hisF PE=3 SV=1 226 541 4.0E-35
sp|A9M9R9|HIS6_BRUC2 Imidazole glycerol phosphate synthase subunit HisF OS=Brucella canis (strain ATCC 23365 / NCTC 10854) GN=hisF PE=3 SV=1 226 541 4.0E-35
sp|Q57AH3|HIS6_BRUAB Imidazole glycerol phosphate synthase subunit HisF OS=Brucella abortus biovar 1 (strain 9-941) GN=hisF PE=3 SV=1 226 541 4.0E-35
sp|Q2YQY8|HIS6_BRUA2 Imidazole glycerol phosphate synthase subunit HisF OS=Brucella abortus (strain 2308) GN=hisF PE=3 SV=1 226 541 4.0E-35
sp|B2S984|HIS6_BRUA1 Imidazole glycerol phosphate synthase subunit HisF OS=Brucella abortus (strain S19) GN=hisF PE=3 SV=1 226 541 4.0E-35
sp|P61781|HIS5_THET2 Imidazole glycerol phosphate synthase subunit HisH OS=Thermus thermophilus (strain HB27 / ATCC BAA-163 / DSM 7039) GN=hisH PE=3 SV=1 6 194 4.0E-35
sp|Q2RNA7|HIS6_RHORT Imidazole glycerol phosphate synthase subunit HisF OS=Rhodospirillum rubrum (strain ATCC 11170 / ATH 1.1.1 / DSM 467 / LMG 4362 / NCIB 8255 / S1) GN=hisF PE=3 SV=1 226 541 4.0E-35
sp|A4X9P7|HIS6_SALTO Imidazole glycerol phosphate synthase subunit HisF OS=Salinispora tropica (strain ATCC BAA-916 / DSM 44818 / CNB-440) GN=hisF PE=3 SV=1 226 541 6.0E-35
sp|B4ESZ8|HIS6_PROMH Imidazole glycerol phosphate synthase subunit HisF OS=Proteus mirabilis (strain HI4320) GN=hisF PE=3 SV=1 226 541 6.0E-35
sp|O30724|HIS6_RHOCB Imidazole glycerol phosphate synthase subunit HisF OS=Rhodobacter capsulatus (strain ATCC BAA-309 / NBRC 16581 / SB1003) GN=hisF PE=3 SV=2 226 541 8.0E-35
sp|Q5N0H4|HIS6_SYNP6 Imidazole glycerol phosphate synthase subunit HisF OS=Synechococcus sp. (strain ATCC 27144 / PCC 6301 / SAUG 1402/1) GN=hisF PE=3 SV=1 226 541 1.0E-34
sp|A3PBF2|HIS6_PROM0 Imidazole glycerol phosphate synthase subunit HisF OS=Prochlorococcus marinus (strain MIT 9301) GN=hisF PE=3 SV=1 229 544 1.0E-34
sp|Q11CK7|HIS6_CHESB Imidazole glycerol phosphate synthase subunit HisF OS=Chelativorans sp. (strain BNC1) GN=hisF PE=3 SV=1 226 541 1.0E-34
sp|P59118|HIS5_LEPIN Imidazole glycerol phosphate synthase subunit HisH OS=Leptospira interrogans serogroup Icterohaemorrhagiae serovar Lai (strain 56601) GN=hisH PE=3 SV=1 6 201 2.0E-34
sp|P61780|HIS5_LEPIC Imidazole glycerol phosphate synthase subunit HisH OS=Leptospira interrogans serogroup Icterohaemorrhagiae serovar copenhageni (strain Fiocruz L1-130) GN=hisH PE=3 SV=1 6 201 2.0E-34
sp|Q7VDF1|HIS6_PROMA Imidazole glycerol phosphate synthase subunit HisF OS=Prochlorococcus marinus (strain SARG / CCMP1375 / SS120) GN=hisF PE=3 SV=1 229 541 2.0E-34
sp|Q7NNK4|HIS5_GLOVI Imidazole glycerol phosphate synthase subunit HisH OS=Gloeobacter violaceus (strain PCC 7421) GN=hisH PE=3 SV=1 2 208 3.0E-34
sp|C3LLI5|HIS6_VIBCM Imidazole glycerol phosphate synthase subunit HisF OS=Vibrio cholerae serotype O1 (strain M66-2) GN=hisF PE=3 SV=1 226 542 3.0E-34
sp|Q9KSW8|HIS6_VIBCH Imidazole glycerol phosphate synthase subunit HisF OS=Vibrio cholerae serotype O1 (strain ATCC 39315 / El Tor Inaba N16961) GN=hisF PE=3 SV=1 226 542 3.0E-34
sp|A5F289|HIS6_VIBC3 Imidazole glycerol phosphate synthase subunit HisF OS=Vibrio cholerae serotype O1 (strain ATCC 39541 / Classical Ogawa 395 / O395) GN=hisF PE=3 SV=1 226 542 3.0E-34
sp|A7ZNJ7|HIS6_ECO24 Imidazole glycerol phosphate synthase subunit HisF OS=Escherichia coli O139:H28 (strain E24377A / ETEC) GN=hisF PE=3 SV=1 226 541 4.0E-34
sp|B3GZH3|HIS6_ACTP7 Imidazole glycerol phosphate synthase subunit HisF OS=Actinobacillus pleuropneumoniae serotype 7 (strain AP76) GN=hisF PE=3 SV=1 226 542 4.0E-34
sp|A8AEJ9|HIS6_CITK8 Imidazole glycerol phosphate synthase subunit HisF OS=Citrobacter koseri (strain ATCC BAA-895 / CDC 4225-83 / SGSC4696) GN=hisF PE=3 SV=1 226 541 4.0E-34
sp|Q7N6I5|HIS6_PHOLL Imidazole glycerol phosphate synthase subunit HisF OS=Photorhabdus luminescens subsp. laumondii (strain TT01) GN=hisF PE=3 SV=1 226 541 4.0E-34
sp|A7I416|HIS6_CAMHC Imidazole glycerol phosphate synthase subunit HisF OS=Campylobacter hominis (strain ATCC BAA-381 / LMG 19568 / NCTC 13146 / CH001A) GN=hisF PE=3 SV=1 224 541 5.0E-34
sp|Q0C643|HIS6_HYPNA Imidazole glycerol phosphate synthase subunit HisF OS=Hyphomonas neptunium (strain ATCC 15444) GN=hisF PE=3 SV=1 226 522 5.0E-34
sp|B9KPC8|HIS6_RHOSK Imidazole glycerol phosphate synthase subunit HisF OS=Rhodobacter sphaeroides (strain KD131 / KCTC 12085) GN=hisF PE=3 SV=1 226 541 5.0E-34
sp|Q92TB3|HIS6_RHIME Imidazole glycerol phosphate synthase subunit HisF OS=Rhizobium meliloti (strain 1021) GN=hisF PE=3 SV=1 226 541 6.0E-34
sp|B5XPE2|HIS6_KLEP3 Imidazole glycerol phosphate synthase subunit HisF OS=Klebsiella pneumoniae (strain 342) GN=hisF PE=3 SV=1 226 541 6.0E-34
sp|A6UEK3|HIS6_SINMW Imidazole glycerol phosphate synthase subunit HisF OS=Sinorhizobium medicae (strain WSM419) GN=hisF PE=3 SV=1 226 541 7.0E-34
sp|Q7V2P2|HIS6_PROMP Imidazole glycerol phosphate synthase subunit HisF OS=Prochlorococcus marinus subsp. pastoris (strain CCMP1986 / MED4) GN=hisF PE=3 SV=1 229 541 8.0E-34
[Show less]

GO

GO Term Description Terminal node
GO:0042823 pyridoxal phosphate biosynthetic process Yes
GO:0000105 histidine biosynthetic process Yes
GO:0004359 glutaminase activity Yes
GO:0042819 vitamin B6 biosynthetic process Yes
GO:0019637 organophosphate metabolic process No
GO:0019438 aromatic compound biosynthetic process No
GO:0006807 nitrogen compound metabolic process No
GO:0018130 heterocycle biosynthetic process No
GO:0016811 hydrolase activity, acting on carbon-nitrogen (but not peptide) bonds, in linear amides No
GO:0006081 cellular aldehyde metabolic process No
GO:0006796 phosphate-containing compound metabolic process No
GO:0043436 oxoacid metabolic process No
GO:0008652 cellular amino acid biosynthetic process No
GO:1901576 organic substance biosynthetic process No
GO:0006520 cellular amino acid metabolic process No
GO:0072525 pyridine-containing compound biosynthetic process No
GO:0046394 carboxylic acid biosynthetic process No
GO:0034641 cellular nitrogen compound metabolic process No
GO:0006793 phosphorus metabolic process No
GO:0042364 water-soluble vitamin biosynthetic process No
GO:0003674 molecular_function No
GO:0016787 hydrolase activity No
GO:0008150 biological_process No
GO:0090407 organophosphate biosynthetic process No
GO:0006082 organic acid metabolic process No
GO:0019752 carboxylic acid metabolic process No
GO:0006766 vitamin metabolic process No
GO:0006725 cellular aromatic compound metabolic process No
GO:0042816 vitamin B6 metabolic process No
GO:0008152 metabolic process No
GO:1901617 organic hydroxy compound biosynthetic process No
GO:0046184 aldehyde biosynthetic process No
GO:0006767 water-soluble vitamin metabolic process No
GO:0009110 vitamin biosynthetic process No
GO:0046483 heterocycle metabolic process No
GO:1901615 organic hydroxy compound metabolic process No
GO:1901564 organonitrogen compound metabolic process No
GO:0009058 biosynthetic process No
GO:0044238 primary metabolic process No
GO:0042822 pyridoxal phosphate metabolic process No
GO:0009987 cellular process No
GO:1901362 organic cyclic compound biosynthetic process No
GO:1901360 organic cyclic compound metabolic process No
GO:0016053 organic acid biosynthetic process No
GO:1901566 organonitrogen compound biosynthetic process No
GO:0044237 cellular metabolic process No
GO:0044281 small molecule metabolic process No
GO:0071704 organic substance metabolic process No
GO:0044283 small molecule biosynthetic process No
GO:0044249 cellular biosynthetic process No
GO:0016810 hydrolase activity, acting on carbon-nitrogen (but not peptide) bonds No
GO:0003824 catalytic activity No
GO:0044271 cellular nitrogen compound biosynthetic process No
GO:0006547 histidine metabolic process No
GO:0072524 pyridine-containing compound metabolic process No

Deeploc

Deeploc data not available for this genome

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

No expression data available for this genome

Orthologs

Orthofinder run ID4
Orthogroup3611
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|1861
Ophiocordyceps australis map64 (Brazil) OphauB2|7336 (this protein)
Ophiocordyceps camponoti-floridani Ophcf2|02014
Ophiocordyceps camponoti-rufipedis Ophun1|4307
Ophiocordyceps kimflemingae Ophio5|3319
Ophiocordyceps subramaniannii Hirsu2|6967

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >OphauB2|7336
MPTVHLLDYVAGNIHSLVNAIEKLGYSVEWIKSPQDVSKAQKLILPGVGHFGHCLSQLDRAGFLPAIKAHIDSGK
PFMGICVGLQALFEGSLEDSAVPGLGIIAGCLGRFDDAQKSVPHIGWNSASSSMYQLSPASKYYYVHTYRFPYVE
GQLEAQGWSVATATYGSETFVGAVAKGNVYATQFHPEKSGVAGLRTIGAFLTGEGAASLGNASANGSANKTLSSG
LTRRVIACLDVRANDQGDLVVTKGDQYDVRLKSSDRSVRNLGKPVELARRYYNDGADEVTFLNITSFRDCPAADL
PMLEVLRQTSATVFVPLTIGGGIRDTVDPDGSTLSALDIASLYFRSGADKVSIGSDAVAAAEQYYASGRRLTGST
AIEQISRAYGNQAVVVSIDPRRVYLDSPDSCPRHRQHVIETCFPGPAGERFCWYVCTVRGGRETRDLDVVELAQA
VQAMGAGELLLNSIDRDGSNSGFDLELIAQVKACVKIPVIASSGAGNPSHFEQVFTQTSTDAALGAGIFHRGEYS
VRQVKDYLSSKGLLVRQFEGDLDTHAVAIQS*
Coding >OphauB2|7336
ATGCCTACGGTCCATTTGCTAGACTACGTCGCCGGCAACATCCACAGCCTCGTCAATGCCATTGAGAAGCTAGGC
TACAGCGTCGAGTGGATAAAGTCGCCCCAAGATGTTTCCAAGGCTCAAAAACTCATCCTCCCCGGCGTCGGCCAC
TTTGGCCATTGTCTCTCGCAGCTAGACCGCGCCGGCTTCCTCCCTGCAATCAAGGCTCACATTGACAGCGGGAAG
CCCTTTATGGGCATCTGCGTCGGCCTGCAGGCTCTCTTTGAAGGCTCGCTGGAAGACTCAGCCGTGCCTGGGCTG
GGCATCATTGCCGGCTGTCTGGGTCGCTTTGATGACGCTCAAAAGTCGGTTCCTCATATTGGCTGGAACAGCGCC
TCCAGCTCCATGTATCAGCTCAGCCCGGCTTCCAAATACTACTATGTCCATACCTATCGCTTCCCCTACGTCGAG
GGCCAGCTCGAGGCCCAGGGCTGGTCCGTCGCCACGGCCACGTATGGCTCAGAGACGTTTGTCGGCGCCGTCGCA
AAGGGCAATGTCTACGCCACCCAGTTCCACCCTGAAAAGTCTGGCGTCGCCGGCCTGCGCACCATTGGCGCCTTT
TTGACGGGCGAGGGCGCCGCTTCCCTGGGCAATGCGTCTGCCAATGGCTCGGCCAACAAGACGCTCTCCTCGGGC
CTGACACGCCGCGTCATTGCCTGTCTCGACGTCCGCGCCAATGACCAAGGCGACCTCGTCGTCACAAAGGGCGAC
CAGTACGACGTGCGCCTCAAATCCTCTGACCGCTCCGTCCGCAACCTCGGCAAGCCCGTCGAGCTTGCCCGCCGC
TACTACAATGACGGCGCCGACGAAGTCACCTTTCTCAACATCACCTCGTTTCGCGACTGTCCCGCTGCCGACTTG
CCCATGCTCGAGGTTCTCCGTCAAACATCTGCCACCGTCTTTGTGCCCCTGACGATTGGCGGCGGCATTCGCGAT
ACTGTCGACCCCGACGGCTCAACCCTCTCCGCCCTCGACATTGCCTCGCTCTACTTCCGCTCCGGCGCCGACAAG
GTGTCGATTGGCTCCGACGCCGTGGCCGCCGCAGAGCAATACTACGCCTCTGGCCGTCGTCTCACCGGCTCCACC
GCCATTGAGCAAATCTCGCGCGCCTACGGCAACCAAGCCGTCGTTGTCAGCATCGATCCCCGCCGCGTCTACCTC
GATAGCCCCGACTCTTGTCCCCGTCACCGGCAGCACGTCATCGAGACTTGTTTTCCCGGCCCGGCTGGCGAGCGC
TTTTGCTGGTACGTCTGCACCGTCCGCGGCGGTCGCGAGACGCGTGATCTGGACGTGGTTGAGCTCGCCCAGGCT
GTCCAAGCCATGGGTGCCGGCGAGCTCCTCCTCAACTCGATTGACCGTGACGGCTCAAACTCGGGCTTTGATCTC
GAGCTCATTGCCCAGGTCAAGGCTTGTGTCAAAATCCCCGTCATTGCCTCGAGTGGTGCTGGCAACCCATCCCAC
TTTGAACAAGTCTTTACACAAACTTCAACCGACGCTGCCCTCGGTGCCGGCATCTTCCACCGTGGAGAGTACAGC
GTCAGACAGGTCAAGGATTATCTCAGCTCCAAGGGGCTTCTTGTGCGTCAGTTTGAGGGCGATTTGGATACTCAT
GCTGTTGCAATACAATCATAG
Transcript >OphauB2|7336
ATGCCTACGGTCCATTTGCTAGACTACGTCGCCGGCAACATCCACAGCCTCGTCAATGCCATTGAGAAGCTAGGC
TACAGCGTCGAGTGGATAAAGTCGCCCCAAGATGTTTCCAAGGCTCAAAAACTCATCCTCCCCGGCGTCGGCCAC
TTTGGCCATTGTCTCTCGCAGCTAGACCGCGCCGGCTTCCTCCCTGCAATCAAGGCTCACATTGACAGCGGGAAG
CCCTTTATGGGCATCTGCGTCGGCCTGCAGGCTCTCTTTGAAGGCTCGCTGGAAGACTCAGCCGTGCCTGGGCTG
GGCATCATTGCCGGCTGTCTGGGTCGCTTTGATGACGCTCAAAAGTCGGTTCCTCATATTGGCTGGAACAGCGCC
TCCAGCTCCATGTATCAGCTCAGCCCGGCTTCCAAATACTACTATGTCCATACCTATCGCTTCCCCTACGTCGAG
GGCCAGCTCGAGGCCCAGGGCTGGTCCGTCGCCACGGCCACGTATGGCTCAGAGACGTTTGTCGGCGCCGTCGCA
AAGGGCAATGTCTACGCCACCCAGTTCCACCCTGAAAAGTCTGGCGTCGCCGGCCTGCGCACCATTGGCGCCTTT
TTGACGGGCGAGGGCGCCGCTTCCCTGGGCAATGCGTCTGCCAATGGCTCGGCCAACAAGACGCTCTCCTCGGGC
CTGACACGCCGCGTCATTGCCTGTCTCGACGTCCGCGCCAATGACCAAGGCGACCTCGTCGTCACAAAGGGCGAC
CAGTACGACGTGCGCCTCAAATCCTCTGACCGCTCCGTCCGCAACCTCGGCAAGCCCGTCGAGCTTGCCCGCCGC
TACTACAATGACGGCGCCGACGAAGTCACCTTTCTCAACATCACCTCGTTTCGCGACTGTCCCGCTGCCGACTTG
CCCATGCTCGAGGTTCTCCGTCAAACATCTGCCACCGTCTTTGTGCCCCTGACGATTGGCGGCGGCATTCGCGAT
ACTGTCGACCCCGACGGCTCAACCCTCTCCGCCCTCGACATTGCCTCGCTCTACTTCCGCTCCGGCGCCGACAAG
GTGTCGATTGGCTCCGACGCCGTGGCCGCCGCAGAGCAATACTACGCCTCTGGCCGTCGTCTCACCGGCTCCACC
GCCATTGAGCAAATCTCGCGCGCCTACGGCAACCAAGCCGTCGTTGTCAGCATCGATCCCCGCCGCGTCTACCTC
GATAGCCCCGACTCTTGTCCCCGTCACCGGCAGCACGTCATCGAGACTTGTTTTCCCGGCCCGGCTGGCGAGCGC
TTTTGCTGGTACGTCTGCACCGTCCGCGGCGGTCGCGAGACGCGTGATCTGGACGTGGTTGAGCTCGCCCAGGCT
GTCCAAGCCATGGGTGCCGGCGAGCTCCTCCTCAACTCGATTGACCGTGACGGCTCAAACTCGGGCTTTGATCTC
GAGCTCATTGCCCAGGTCAAGGCTTGTGTCAAAATCCCCGTCATTGCCTCGAGTGGTGCTGGCAACCCATCCCAC
TTTGAACAAGTCTTTACACAAACTTCAACCGACGCTGCCCTCGGTGCCGGCATCTTCCACCGTGGAGAGTACAGC
GTCAGACAGGTCAAGGATTATCTCAGCTCCAAGGGGCTTCTTGTGCGTCAGTTTGAGGGCGATTTGGATACTCAT
GCTGTTGCAATACAATCATAG
Gene >OphauB2|7336
ATGCCTACGGTCCATTTGCTAGACTACGTCGCCGGCAACATCCACAGCCTCGTCAATGCCATTGAGAAGCTAGGC
TACAGCGTCGAGTGGATAAAGTCGCCCCAAGATGTTTCCAAGGCTCAAGTCGGCCACCCCTTGTTTGCTCCTTGT
CCGTCAATATCCAGTCTTTGCCTTCTGACTTTGGTCTGCAGAAACTCATCCTCCCCGGCGTCGGCCACTTTGGCC
ATTGTCTCTCGCAGCTAGACCGCGCCGGCTTCCTCCCTGCAATCAAGGCTCACATTGACAGCGGGAAGCCCTTTA
TGGGCATCTGCGTCGGCCTGCAGGCTCTCTTTGAAGGCTCGCTGGAAGACTCAGCCGTGCCTGGGCTGGGCATCA
TTGCCGGCTGTCTGGGTCGCTTTGATGACGCTCAAAAGTCGGTTCCTCATATTGGCTGGAACAGCGCCTCCAGCT
CCATGTATCAGCTCAGCCCGGCTTCCAAATACTACTATGTCCATACCTATCGCTTCCCCTACGTCGAGGGCCAGC
TCGAGGCCCAGGGCTGGTCCGTCGCCACGGCCACGTATGGCTCAGAGACGTTTGTCGGCGCCGTCGCAAAGGGCA
ATGTCTACGCCACCCAGTTCCACCCTGAAAAGTCTGGCGTCGCCGGCCTGCGCACCATTGGCGCCTTTTTGACGG
GCGAGGGCGCCGCTTCCCTGGGCAATGCGTCTGCCAATGGCTCGGCCAACAAGACGCTCTCCTCGGGCCTGACAC
GCCGCGTCATTGCCTGTCTCGACGTCCGCGCCAATGACCAAGGCGACCTCGTCGTCACAAAGGGCGACCAGTACG
ACGTGCGCCTCAAATCCTCTGACCGCTCCGTCCGCAACCTCGGCAAGCCCGTCGAGCTTGCCCGCCGCTACTACA
ATGACGGCGCCGACGAAGTCACCTTTCTCAACATCACCTCGTTTCGCGACTGTCCCGCTGCCGACTTGCCCATGC
TCGAGGTTCTCCGTCAAACATCTGCCACCGTCTTTGTGCCCCTGACGATTGGCGGCGGCATTCGCGATACTGTCG
ACCCCGACGGCTCAACCCTCTCCGCCCTCGACATTGCCTCGCTCTACTTCCGCTCCGGCGCCGACAAGGTGTCGA
TTGGCTCCGACGCCGTGGCCGCCGCAGAGCAATACTACGCCTCTGGCCGTCGTCTCACCGGCTCCACCGCCATTG
AGCAAATCTCGCGCGCCTACGGCAACCAAGCCGTCGTTGTCAGCATCGATCCCCGCCGCGTCTACCTCGATAGCC
CCGACTCTTGTCCCCGTCACCGGCAGCACGTCATCGAGACTTGTTTTCCCGGCCCGGCTGGCGAGCGCTTTTGCT
GGTACGTCTGCACCGTCCGCGGCGGTCGCGAGACGCGTGATCTGGACGTGGTTGAGCTCGCCCAGGCTGTCCAAG
CCATGGGTGCCGGCGAGCTCCTCCTCAACTCGATTGACCGTGACGGCTCAAACTCGGGCTTTGATCTCGAGCTCA
TTGCCCAGGTCAAGGCTTGTGTCAAAATCCCCGTCATTGCCTCGAGTGGTGCTGGCAACCCATCCCACTTTGAAC
AAGTCTTTACACAAACTTCAACCGACGCTGCCCTCGGTGCCGGCATCTTCCACCGTGGAGAGTACAGCGTCAGAC
AGGTCAAGGATTATCTCAGCTCCAAGGGGCTTCTTGTGCGTCAGTTTGAGGGCGATTTGGATACTCATGCTGTTG
CAATACAATCATAG

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail