Protein ID | OphauB2|7336 |
Gene name | |
Location | Contig_78:16728..18467 |
Strand | - |
Gene length (bp) | 1739 |
Transcript length (bp) | 1671 |
Coding sequence length (bp) | 1671 |
Protein length (aa) | 557 |
PFAM Domain ID | Short name | Long name | E-value | Start | End |
---|---|---|---|---|---|
PF00977 | His_biosynth | Histidine biosynthesis protein | 6.1E-45 | 229 | 524 |
PF00117 | GATase | Glutamine amidotransferase class-I | 4.3E-20 | 6 | 189 |
PF01174 | SNO | SNO glutamine amidotransferase family | 1.3E-07 | 11 | 189 |
Swissprot ID | Swissprot Description | Start | End | E-value |
---|---|---|---|---|
sp|Q9P4P9|HIS5_EMENI | Imidazole glycerol phosphate synthase hisHF OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=hisHF PE=3 SV=2 | 1 | 547 | 0.0E+00 |
sp|P33734|HIS5_YEAST | Imidazole glycerol phosphate synthase hisHF OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=HIS7 PE=1 SV=2 | 1 | 544 | 0.0E+00 |
sp|O94303|HIS5_SCHPO | Imidazole glycerol phosphate synthase hisHF OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=his4 PE=3 SV=3 | 4 | 541 | 0.0E+00 |
sp|Q9SZ30|HIS4_ARATH | Imidazole glycerol phosphate synthase hisHF, chloroplastic OS=Arabidopsis thaliana GN=HISN4 PE=2 SV=1 | 3 | 541 | 0.0E+00 |
sp|Q5V2C9|HIS6_HALMA | Imidazole glycerol phosphate synthase subunit HisF OS=Haloarcula marismortui (strain ATCC 43049 / DSM 3752 / JCM 8966 / VKM B-1809) GN=hisF PE=3 SV=1 | 226 | 541 | 7.0E-57 |
Swissprot ID | Swissprot Description | Start | End | E-value |
---|---|---|---|---|
sp|Q9P4P9|HIS5_EMENI | Imidazole glycerol phosphate synthase hisHF OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=hisHF PE=3 SV=2 | 1 | 547 | 0.0E+00 |
sp|P33734|HIS5_YEAST | Imidazole glycerol phosphate synthase hisHF OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=HIS7 PE=1 SV=2 | 1 | 544 | 0.0E+00 |
sp|O94303|HIS5_SCHPO | Imidazole glycerol phosphate synthase hisHF OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=his4 PE=3 SV=3 | 4 | 541 | 0.0E+00 |
sp|Q9SZ30|HIS4_ARATH | Imidazole glycerol phosphate synthase hisHF, chloroplastic OS=Arabidopsis thaliana GN=HISN4 PE=2 SV=1 | 3 | 541 | 0.0E+00 |
sp|Q5V2C9|HIS6_HALMA | Imidazole glycerol phosphate synthase subunit HisF OS=Haloarcula marismortui (strain ATCC 43049 / DSM 3752 / JCM 8966 / VKM B-1809) GN=hisF PE=3 SV=1 | 226 | 541 | 7.0E-57 |
sp|Q8TYW8|HIS6_METKA | Imidazole glycerol phosphate synthase subunit HisF OS=Methanopyrus kandleri (strain AV19 / DSM 6324 / JCM 9639 / NBRC 100938) GN=hisF PE=3 SV=1 | 226 | 542 | 1.0E-56 |
sp|Q2NI84|HIS6_METST | Imidazole glycerol phosphate synthase subunit HisF OS=Methanosphaera stadtmanae (strain ATCC 43021 / DSM 3091 / JCM 11832 / MCB-3) GN=hisF PE=3 SV=1 | 226 | 541 | 3.0E-56 |
sp|A5UMZ1|HIS6_METS3 | Imidazole glycerol phosphate synthase subunit HisF OS=Methanobrevibacter smithii (strain PS / ATCC 35061 / DSM 861) GN=hisF PE=3 SV=1 | 226 | 541 | 5.0E-56 |
sp|Q18JI3|HIS6_HALWD | Imidazole glycerol phosphate synthase subunit HisF OS=Haloquadratum walsbyi (strain DSM 16790 / HBSQ001) GN=hisF PE=3 SV=1 | 226 | 541 | 1.0E-55 |
sp|Q57854|HIS6_METJA | Imidazole glycerol phosphate synthase subunit HisF OS=Methanocaldococcus jannaschii (strain ATCC 43067 / DSM 2661 / JAL-1 / JCM 10045 / NBRC 100440) GN=hisF PE=3 SV=1 | 226 | 541 | 1.0E-55 |
sp|O27398|HIS6_METTH | Imidazole glycerol phosphate synthase subunit HisF OS=Methanothermobacter thermautotrophicus (strain ATCC 29096 / DSM 1053 / JCM 10044 / NBRC 100330 / Delta H) GN=hisF PE=3 SV=2 | 226 | 541 | 2.0E-55 |
sp|A2STB8|HIS6_METLZ | Imidazole glycerol phosphate synthase subunit HisF OS=Methanocorpusculum labreanum (strain ATCC 43576 / DSM 4855 / Z) GN=hisF PE=3 SV=1 | 225 | 541 | 2.0E-54 |
sp|Q8TT96|HIS6_METAC | Imidazole glycerol phosphate synthase subunit HisF OS=Methanosarcina acetivorans (strain ATCC 35395 / DSM 2834 / JCM 12185 / C2A) GN=hisF PE=3 SV=1 | 226 | 541 | 5.0E-54 |
sp|Q8R885|HIS6_CALS4 | Imidazole glycerol phosphate synthase subunit HisF OS=Caldanaerobacter subterraneus subsp. tengcongensis (strain DSM 15242 / JCM 11007 / NBRC 100824 / MB4) GN=hisF PE=3 SV=1 | 226 | 541 | 1.0E-53 |
sp|Q8PW92|HIS6_METMA | Imidazole glycerol phosphate synthase subunit HisF OS=Methanosarcina mazei (strain ATCC BAA-159 / DSM 3647 / Goe1 / Go1 / JCM 11833 / OCM 88) GN=hisF PE=3 SV=1 | 226 | 541 | 2.0E-53 |
sp|B0K629|HIS6_THEPX | Imidazole glycerol phosphate synthase subunit HisF OS=Thermoanaerobacter sp. (strain X514) GN=hisF PE=3 SV=1 | 226 | 541 | 4.0E-53 |
sp|A3CT78|HIS6_METMJ | Imidazole glycerol phosphate synthase subunit HisF OS=Methanoculleus marisnigri (strain ATCC 35101 / DSM 1498 / JR1) GN=hisF PE=3 SV=1 | 226 | 541 | 6.0E-53 |
sp|Q8FNZ9|HIS6_COREF | Imidazole glycerol phosphate synthase subunit HisF OS=Corynebacterium efficiens (strain DSM 44549 / YS-314 / AJ 12310 / JCM 11189 / NBRC 100395) GN=hisF PE=3 SV=1 | 225 | 542 | 9.0E-53 |
sp|Q46CC5|HIS6_METBF | Imidazole glycerol phosphate synthase subunit HisF OS=Methanosarcina barkeri (strain Fusaro / DSM 804) GN=hisF PE=3 SV=1 | 226 | 541 | 1.0E-52 |
sp|Q820Q0|HIS6_NITEU | Imidazole glycerol phosphate synthase subunit HisF OS=Nitrosomonas europaea (strain ATCC 19718 / NBRC 14298) GN=hisF PE=3 SV=1 | 225 | 541 | 1.0E-52 |
sp|Q2FPV1|HIS6_METHJ | Imidazole glycerol phosphate synthase subunit HisF OS=Methanospirillum hungatei JF-1 (strain ATCC 27890 / DSM 864 / NBRC 100397 / JF-1) GN=hisF PE=3 SV=1 | 226 | 541 | 1.0E-52 |
sp|Q0AEU1|HIS6_NITEC | Imidazole glycerol phosphate synthase subunit HisF OS=Nitrosomonas eutropha (strain C91) GN=hisF PE=3 SV=1 | 225 | 541 | 2.0E-52 |
sp|Q12UY6|HIS6_METBU | Imidazole glycerol phosphate synthase subunit HisF OS=Methanococcoides burtonii (strain DSM 6242 / NBRC 107633 / OCM 468 / ACE-M) GN=hisF PE=3 SV=1 | 226 | 541 | 3.0E-52 |
sp|A4J707|HIS6_DESRM | Imidazole glycerol phosphate synthase subunit HisF OS=Desulfotomaculum reducens (strain MI-1) GN=hisF PE=3 SV=1 | 226 | 541 | 3.0E-52 |
sp|Q4JW52|HIS6_CORJK | Imidazole glycerol phosphate synthase subunit HisF OS=Corynebacterium jeikeium (strain K411) GN=hisF PE=3 SV=1 | 226 | 541 | 3.0E-52 |
sp|P60714|HIS6_CORDI | Imidazole glycerol phosphate synthase subunit HisF OS=Corynebacterium diphtheriae (strain ATCC 700971 / NCTC 13129 / Biotype gravis) GN=hisF PE=3 SV=1 | 229 | 541 | 4.0E-52 |
sp|Q47AM3|HIS6_DECAR | Imidazole glycerol phosphate synthase subunit HisF OS=Dechloromonas aromatica (strain RCB) GN=hisF PE=3 SV=1 | 226 | 541 | 1.0E-51 |
sp|O29439|HIS6_ARCFU | Imidazole glycerol phosphate synthase subunit HisF OS=Archaeoglobus fulgidus (strain ATCC 49558 / VC-16 / DSM 4304 / JCM 9628 / NBRC 100126) GN=hisF PE=3 SV=1 | 226 | 541 | 1.0E-51 |
sp|Q7W2X9|HIS6_BORPA | Imidazole glycerol phosphate synthase subunit HisF OS=Bordetella parapertussis (strain 12822 / ATCC BAA-587 / NCTC 13253) GN=hisF PE=3 SV=1 | 223 | 541 | 1.0E-51 |
sp|A0QX87|HIS6_MYCS2 | Imidazole glycerol phosphate synthase subunit HisF OS=Mycobacterium smegmatis (strain ATCC 700084 / mc(2)155) GN=hisF PE=3 SV=1 | 223 | 541 | 1.0E-51 |
sp|Q7VSY6|HIS6_BORPE | Imidazole glycerol phosphate synthase subunit HisF OS=Bordetella pertussis (strain Tohama I / ATCC BAA-589 / NCTC 13251) GN=hisF PE=3 SV=1 | 223 | 541 | 2.0E-51 |
sp|Q7WDX9|HIS6_BORBR | Imidazole glycerol phosphate synthase subunit HisF OS=Bordetella bronchiseptica (strain ATCC BAA-588 / NCTC 13252 / RB50) GN=hisF PE=3 SV=1 | 223 | 541 | 2.0E-51 |
sp|A0QHH6|HIS6_MYCA1 | Imidazole glycerol phosphate synthase subunit HisF OS=Mycobacterium avium (strain 104) GN=hisF PE=3 SV=1 | 223 | 542 | 2.0E-51 |
sp|Q01ZU6|HIS6_SOLUE | Imidazole glycerol phosphate synthase subunit HisF OS=Solibacter usitatus (strain Ellin6076) GN=hisF PE=3 SV=1 | 226 | 541 | 4.0E-51 |
sp|Q2KTT1|HIS6_BORA1 | Imidazole glycerol phosphate synthase subunit HisF OS=Bordetella avium (strain 197N) GN=hisF PE=3 SV=1 | 223 | 541 | 5.0E-51 |
sp|P60666|HIS6_MYCPA | Imidazole glycerol phosphate synthase subunit HisF OS=Mycobacterium paratuberculosis (strain ATCC BAA-968 / K-10) GN=hisF PE=3 SV=1 | 223 | 542 | 5.0E-51 |
sp|Q2YAV0|HIS6_NITMU | Imidazole glycerol phosphate synthase subunit HisF OS=Nitrosospira multiformis (strain ATCC 25196 / NCIMB 11849) GN=hisF PE=3 SV=1 | 225 | 541 | 6.0E-51 |
sp|O66567|HIS6_AQUAE | Imidazole glycerol phosphate synthase subunit HisF OS=Aquifex aeolicus (strain VF5) GN=hisF PE=3 SV=1 | 226 | 544 | 6.0E-51 |
sp|A7I616|HIS6_METB6 | Imidazole glycerol phosphate synthase subunit HisF OS=Methanoregula boonei (strain 6A8) GN=hisF PE=3 SV=2 | 226 | 541 | 6.0E-51 |
sp|B8D116|HIS6_HALOH | Imidazole glycerol phosphate synthase subunit HisF OS=Halothermothrix orenii (strain H 168 / OCM 544 / DSM 9562) GN=hisF PE=3 SV=1 | 226 | 541 | 1.0E-50 |
sp|B8GEX3|HIS6_METPE | Imidazole glycerol phosphate synthase subunit HisF OS=Methanosphaerula palustris (strain ATCC BAA-1556 / DSM 19958 / E1-9c) GN=hisF PE=3 SV=1 | 226 | 541 | 2.0E-50 |
sp|A6UUZ9|HIS6_META3 | Imidazole glycerol phosphate synthase subunit HisF OS=Methanococcus aeolicus (strain Nankai-3 / ATCC BAA-1280) GN=hisF PE=3 SV=1 | 226 | 541 | 2.0E-50 |
sp|A4SV20|HIS6_POLSQ | Imidazole glycerol phosphate synthase subunit HisF OS=Polynucleobacter necessarius subsp. asymbioticus (strain DSM 18221 / CIP 109841 / QLW-P1DMWA-1) GN=hisF PE=3 SV=1 | 226 | 541 | 3.0E-50 |
sp|Q0W358|HIS6_METAR | Imidazole glycerol phosphate synthase subunit HisF OS=Methanocella arvoryzae (strain DSM 22066 / NBRC 105507 / MRE50) GN=hisF PE=3 SV=1 | 226 | 541 | 5.0E-50 |
sp|Q3INY2|HIS6_NATPD | Imidazole glycerol phosphate synthase subunit HisF OS=Natronomonas pharaonis (strain ATCC 35678 / DSM 2160) GN=hisF PE=3 SV=1 | 226 | 541 | 8.0E-50 |
sp|A4Y083|HIS6_PSEMY | Imidazole glycerol phosphate synthase subunit HisF OS=Pseudomonas mendocina (strain ymp) GN=hisF PE=3 SV=1 | 226 | 541 | 8.0E-50 |
sp|Q13TR0|HIS6_BURXL | Imidazole glycerol phosphate synthase subunit HisF OS=Burkholderia xenovorans (strain LB400) GN=hisF PE=3 SV=1 | 226 | 541 | 1.0E-49 |
sp|C3PHA6|HIS6_CORA7 | Imidazole glycerol phosphate synthase subunit HisF OS=Corynebacterium aurimucosum (strain ATCC 700975 / DSM 44827 / CN-1) GN=hisF PE=3 SV=1 | 226 | 542 | 1.0E-49 |
sp|B2JHX9|HIS6_BURP8 | Imidazole glycerol phosphate synthase subunit HisF OS=Burkholderia phymatum (strain DSM 17167 / STM815) GN=hisF PE=3 SV=1 | 226 | 541 | 2.0E-49 |
sp|B2SZ59|HIS6_BURPP | Imidazole glycerol phosphate synthase subunit HisF OS=Burkholderia phytofirmans (strain DSM 17436 / PsJN) GN=hisF PE=3 SV=1 | 226 | 541 | 2.0E-49 |
sp|Q1D4M4|HIS6_MYXXD | Imidazole glycerol phosphate synthase subunit HisF OS=Myxococcus xanthus (strain DK 1622) GN=hisF PE=3 SV=1 | 226 | 543 | 3.0E-49 |
sp|Q603K3|HIS6_METCA | Imidazole glycerol phosphate synthase subunit HisF OS=Methylococcus capsulatus (strain ATCC 33009 / NCIMB 11132 / Bath) GN=hisF PE=3 SV=1 | 226 | 542 | 3.0E-49 |
sp|C1DAK5|HIS6_LARHH | Imidazole glycerol phosphate synthase subunit HisF OS=Laribacter hongkongensis (strain HLHK9) GN=hisF PE=3 SV=1 | 226 | 541 | 3.0E-49 |
sp|A4YI34|HIS6_METS5 | Imidazole glycerol phosphate synthase subunit HisF OS=Metallosphaera sedula (strain ATCC 51363 / DSM 5348) GN=hisF PE=3 SV=1 | 227 | 541 | 4.0E-49 |
sp|A6VDQ9|HIS6_PSEA7 | Imidazole glycerol phosphate synthase subunit HisF OS=Pseudomonas aeruginosa (strain PA7) GN=hisF PE=3 SV=1 | 226 | 541 | 4.0E-49 |
sp|C0Z6P4|HIS6_BREBN | Imidazole glycerol phosphate synthase subunit HisF OS=Brevibacillus brevis (strain 47 / JCM 6285 / NBRC 100599) GN=hisF PE=3 SV=1 | 226 | 541 | 4.0E-49 |
sp|B4E641|HIS6_BURCJ | Imidazole glycerol phosphate synthase subunit HisF OS=Burkholderia cenocepacia (strain ATCC BAA-245 / DSM 16553 / LMG 16656 / NCTC 13227 / J2315 / CF5610) GN=hisF PE=3 SV=1 | 226 | 541 | 4.0E-49 |
sp|Q2SUA8|HIS6_BURTA | Imidazole glycerol phosphate synthase subunit HisF OS=Burkholderia thailandensis (strain E264 / ATCC 700388 / DSM 13276 / CIP 106301) GN=hisF PE=3 SV=2 | 226 | 541 | 5.0E-49 |
sp|P62454|HIS6_METMP | Imidazole glycerol phosphate synthase subunit HisF OS=Methanococcus maripaludis (strain S2 / LL) GN=hisF PE=3 SV=1 | 226 | 541 | 5.0E-49 |
sp|A5G8S9|HIS6_GEOUR | Imidazole glycerol phosphate synthase subunit HisF OS=Geobacter uraniireducens (strain Rf4) GN=hisF PE=3 SV=1 | 226 | 541 | 5.0E-49 |
sp|Q0BIW4|HIS6_BURCM | Imidazole glycerol phosphate synthase subunit HisF OS=Burkholderia ambifaria (strain ATCC BAA-244 / AMMD) GN=hisF PE=3 SV=1 | 226 | 541 | 6.0E-49 |
sp|A0K3V8|HIS6_BURCH | Imidazole glycerol phosphate synthase subunit HisF OS=Burkholderia cenocepacia (strain HI2424) GN=hisF PE=3 SV=1 | 226 | 541 | 6.0E-49 |
sp|B1JUA5|HIS6_BURCC | Imidazole glycerol phosphate synthase subunit HisF OS=Burkholderia cenocepacia (strain MC0-3) GN=hisF PE=3 SV=1 | 226 | 541 | 6.0E-49 |
sp|Q1BS31|HIS6_BURCA | Imidazole glycerol phosphate synthase subunit HisF OS=Burkholderia cenocepacia (strain AU 1054) GN=hisF PE=3 SV=1 | 226 | 541 | 6.0E-49 |
sp|Q63Q92|HIS6_BURPS | Imidazole glycerol phosphate synthase subunit HisF OS=Burkholderia pseudomallei (strain K96243) GN=hisF PE=3 SV=2 | 226 | 541 | 7.0E-49 |
sp|A3NE93|HIS6_BURP6 | Imidazole glycerol phosphate synthase subunit HisF OS=Burkholderia pseudomallei (strain 668) GN=hisF PE=3 SV=2 | 226 | 541 | 7.0E-49 |
sp|Q3JN02|HIS6_BURP1 | Imidazole glycerol phosphate synthase subunit HisF OS=Burkholderia pseudomallei (strain 1710b) GN=hisF PE=3 SV=1 | 226 | 541 | 7.0E-49 |
sp|A3P027|HIS6_BURP0 | Imidazole glycerol phosphate synthase subunit HisF OS=Burkholderia pseudomallei (strain 1106a) GN=hisF PE=3 SV=2 | 226 | 541 | 7.0E-49 |
sp|B9M0M0|HIS6_GEODF | Imidazole glycerol phosphate synthase subunit HisF OS=Geobacter daltonii (strain DSM 22248 / JCM 15807 / FRC-32) GN=hisF PE=3 SV=1 | 226 | 541 | 8.0E-49 |
sp|Q02EM6|HIS6_PSEAB | Imidazole glycerol phosphate synthase subunit HisF OS=Pseudomonas aeruginosa (strain UCBPP-PA14) GN=hisF PE=3 SV=1 | 226 | 541 | 8.0E-49 |
sp|B7V3N3|HIS6_PSEA8 | Imidazole glycerol phosphate synthase subunit HisF OS=Pseudomonas aeruginosa (strain LESB58) GN=hisF PE=3 SV=1 | 226 | 541 | 8.0E-49 |
sp|Q9HU44|HIS61_PSEAE | Imidazole glycerol phosphate synthase subunit hisF1 OS=Pseudomonas aeruginosa (strain ATCC 15692 / PAO1 / 1C / PRS 101 / LMG 12228) GN=hisF1 PE=3 SV=1 | 226 | 541 | 8.0E-49 |
sp|Q97KH8|HIS6_CLOAB | Imidazole glycerol phosphate synthase subunit HisF OS=Clostridium acetobutylicum (strain ATCC 824 / DSM 792 / JCM 1419 / LMG 5710 / VKM B-1787) GN=hisF PE=3 SV=1 | 226 | 541 | 9.0E-49 |
sp|B1YRW1|HIS6_BURA4 | Imidazole glycerol phosphate synthase subunit HisF OS=Burkholderia ambifaria (strain MC40-6) GN=hisF PE=3 SV=1 | 226 | 541 | 9.0E-49 |
sp|A8AAK3|HIS6_IGNH4 | Imidazole glycerol phosphate synthase subunit HisF OS=Ignicoccus hospitalis (strain KIN4/I / DSM 18386 / JCM 14125) GN=hisF PE=3 SV=1 | 226 | 541 | 1.0E-48 |
sp|Q1B7H0|HIS6_MYCSS | Imidazole glycerol phosphate synthase subunit HisF OS=Mycobacterium sp. (strain MCS) GN=hisF PE=3 SV=1 | 225 | 541 | 1.0E-48 |
sp|A1UHK2|HIS6_MYCSK | Imidazole glycerol phosphate synthase subunit HisF OS=Mycobacterium sp. (strain KMS) GN=hisF PE=3 SV=1 | 225 | 541 | 1.0E-48 |
sp|A3Q125|HIS6_MYCSJ | Imidazole glycerol phosphate synthase subunit HisF OS=Mycobacterium sp. (strain JLS) GN=hisF PE=3 SV=1 | 225 | 541 | 1.0E-48 |
sp|A4JAW9|HIS6_BURVG | Imidazole glycerol phosphate synthase subunit HisF OS=Burkholderia vietnamiensis (strain G4 / LMG 22486) GN=hisF PE=3 SV=1 | 226 | 541 | 1.0E-48 |
sp|A6VHY8|HIS6_METM7 | Imidazole glycerol phosphate synthase subunit HisF OS=Methanococcus maripaludis (strain C7 / ATCC BAA-1331) GN=hisF PE=3 SV=1 | 226 | 541 | 1.0E-48 |
sp|Q39K85|HIS6_BURL3 | Imidazole glycerol phosphate synthase subunit HisF OS=Burkholderia lata (strain ATCC 17760 / LMG 22485 / NCIMB 9086 / R18194 / 383) GN=hisF PE=3 SV=1 | 226 | 541 | 1.0E-48 |
sp|Q92E88|HIS6_LISIN | Imidazole glycerol phosphate synthase subunit HisF OS=Listeria innocua serovar 6a (strain CLIP 11262) GN=hisF PE=3 SV=1 | 226 | 541 | 2.0E-48 |
sp|O31139|HIS6_CORGL | Imidazole glycerol phosphate synthase subunit HisF OS=Corynebacterium glutamicum (strain ATCC 13032 / DSM 20300 / JCM 1318 / LMG 3730 / NCIMB 10025) GN=hisF PE=3 SV=2 | 225 | 542 | 2.0E-48 |
sp|A4QFF9|HIS6_CORGB | Imidazole glycerol phosphate synthase subunit HisF OS=Corynebacterium glutamicum (strain R) GN=hisF PE=3 SV=1 | 225 | 542 | 2.0E-48 |
sp|Q3KJI5|HIS6_PSEPF | Imidazole glycerol phosphate synthase subunit HisF OS=Pseudomonas fluorescens (strain Pf0-1) GN=hisF PE=3 SV=1 | 226 | 541 | 2.0E-48 |
sp|A1V8H5|HIS6_BURMS | Imidazole glycerol phosphate synthase subunit HisF OS=Burkholderia mallei (strain SAVP1) GN=hisF PE=3 SV=2 | 226 | 541 | 2.0E-48 |
sp|Q62GE5|HIS6_BURMA | Imidazole glycerol phosphate synthase subunit HisF OS=Burkholderia mallei (strain ATCC 23344) GN=hisF PE=3 SV=1 | 226 | 541 | 2.0E-48 |
sp|A2S754|HIS6_BURM9 | Imidazole glycerol phosphate synthase subunit HisF OS=Burkholderia mallei (strain NCTC 10229) GN=hisF PE=3 SV=2 | 226 | 541 | 2.0E-48 |
sp|A3MPU4|HIS6_BURM7 | Imidazole glycerol phosphate synthase subunit HisF OS=Burkholderia mallei (strain NCTC 10247) GN=hisF PE=3 SV=2 | 226 | 541 | 2.0E-48 |
sp|Q0VM72|HIS6_ALCBS | Imidazole glycerol phosphate synthase subunit HisF OS=Alcanivorax borkumensis (strain ATCC 700651 / DSM 11573 / NCIMB 13689 / SK2) GN=hisF PE=3 SV=1 | 225 | 541 | 2.0E-48 |
sp|B2V9M8|HIS6_SULSY | Imidazole glycerol phosphate synthase subunit HisF OS=Sulfurihydrogenibium sp. (strain YO3AOP1) GN=hisF PE=3 SV=1 | 226 | 541 | 2.0E-48 |
sp|C1A0L6|HIS6_RHOE4 | Imidazole glycerol phosphate synthase subunit HisF OS=Rhodococcus erythropolis (strain PR4 / NBRC 100887) GN=hisF PE=3 SV=1 | 226 | 541 | 3.0E-48 |
sp|Q3Z7F5|HIS6_DEHM1 | Imidazole glycerol phosphate synthase subunit HisF OS=Dehalococcoides mccartyi (strain ATCC BAA-2266 / KCTC 15142 / 195) GN=hisF PE=3 SV=1 | 226 | 541 | 3.0E-48 |
sp|A1A1I5|HIS6_BIFAA | Imidazole glycerol phosphate synthase subunit HisF OS=Bifidobacterium adolescentis (strain ATCC 15703 / DSM 20083 / NCTC 11814 / E194a) GN=hisF PE=3 SV=1 | 226 | 541 | 3.0E-48 |
sp|Q5HKP2|HIS6_STAEQ | Imidazole glycerol phosphate synthase subunit HisF OS=Staphylococcus epidermidis (strain ATCC 35984 / RP62A) GN=hisF PE=3 SV=1 | 226 | 541 | 3.0E-48 |
sp|Q1I3G8|HIS6_PSEE4 | Imidazole glycerol phosphate synthase subunit HisF OS=Pseudomonas entomophila (strain L48) GN=hisF PE=3 SV=1 | 226 | 541 | 3.0E-48 |
sp|B0KI45|HIS6_PSEPG | Imidazole glycerol phosphate synthase subunit HisF OS=Pseudomonas putida (strain GB-1) GN=hisF PE=3 SV=1 | 226 | 541 | 3.0E-48 |
sp|A9A8U1|HIS6_METM6 | Imidazole glycerol phosphate synthase subunit HisF OS=Methanococcus maripaludis (strain C6 / ATCC BAA-1332) GN=hisF PE=3 SV=1 | 226 | 541 | 3.0E-48 |
sp|A4T9N2|HIS6_MYCGI | Imidazole glycerol phosphate synthase subunit HisF OS=Mycobacterium gilvum (strain PYR-GCK) GN=hisF PE=3 SV=1 | 223 | 541 | 3.0E-48 |
sp|A4VRV9|HIS6_PSEU5 | Imidazole glycerol phosphate synthase subunit HisF OS=Pseudomonas stutzeri (strain A1501) GN=hisF PE=3 SV=1 | 226 | 541 | 4.0E-48 |
sp|B1JED1|HIS6_PSEPW | Imidazole glycerol phosphate synthase subunit HisF OS=Pseudomonas putida (strain W619) GN=hisF PE=3 SV=1 | 226 | 541 | 4.0E-48 |
sp|Q7P0E9|HIS6_CHRVO | Imidazole glycerol phosphate synthase subunit HisF OS=Chromobacterium violaceum (strain ATCC 12472 / DSM 30191 / JCM 1249 / NBRC 12614 / NCIMB 9131 / NCTC 9757) GN=hisF PE=3 SV=1 | 226 | 541 | 4.0E-48 |
sp|A5FQI9|HIS6_DEHMB | Imidazole glycerol phosphate synthase subunit HisF OS=Dehalococcoides mccartyi (strain ATCC BAA-2100 / JCM 16839 / KCTC 5957 / BAV1) GN=hisF PE=3 SV=1 | 226 | 541 | 4.0E-48 |
sp|O33774|HIS6_SULSO | Imidazole glycerol phosphate synthase subunit HisF OS=Sulfolobus solfataricus (strain ATCC 35092 / DSM 1617 / JCM 11322 / P2) GN=hisF PE=3 SV=1 | 227 | 542 | 4.0E-48 |
sp|B1VH88|HIS6_CORU7 | Imidazole glycerol phosphate synthase subunit HisF OS=Corynebacterium urealyticum (strain ATCC 43042 / DSM 7109) GN=hisF PE=3 SV=1 | 229 | 533 | 4.0E-48 |
sp|Q9HR52|HIS6_HALSA | Imidazole glycerol phosphate synthase subunit HisF OS=Halobacterium salinarum (strain ATCC 700922 / JCM 11081 / NRC-1) GN=hisF PE=3 SV=1 | 226 | 541 | 4.0E-48 |
sp|B0R4B2|HIS6_HALS3 | Imidazole glycerol phosphate synthase subunit HisF OS=Halobacterium salinarum (strain ATCC 29341 / DSM 671 / R1) GN=hisF PE=3 SV=1 | 226 | 541 | 4.0E-48 |
sp|Q88R41|HIS6_PSEPK | Imidazole glycerol phosphate synthase subunit HisF OS=Pseudomonas putida (strain KT2440) GN=hisF PE=3 SV=1 | 226 | 541 | 5.0E-48 |
sp|A5VX76|HIS6_PSEP1 | Imidazole glycerol phosphate synthase subunit HisF OS=Pseudomonas putida (strain F1 / ATCC 700007) GN=hisF PE=3 SV=1 | 226 | 541 | 5.0E-48 |
sp|B1XSV3|HIS6_POLNS | Imidazole glycerol phosphate synthase subunit HisF OS=Polynucleobacter necessarius subsp. necessarius (strain STIR1) GN=hisF PE=3 SV=1 | 226 | 541 | 5.0E-48 |
sp|Q47QS3|HIS6_THEFY | Imidazole glycerol phosphate synthase subunit HisF OS=Thermobifida fusca (strain YX) GN=hisF PE=3 SV=1 | 226 | 541 | 6.0E-48 |
sp|Q1Q835|HIS6_PSYCK | Imidazole glycerol phosphate synthase subunit HisF OS=Psychrobacter cryohalolentis (strain K5) GN=hisF PE=3 SV=1 | 226 | 541 | 7.0E-48 |
sp|Q3ZY29|HIS6_DEHMC | Imidazole glycerol phosphate synthase subunit HisF OS=Dehalococcoides mccartyi (strain CBDB1) GN=hisF PE=3 SV=1 | 226 | 541 | 7.0E-48 |
sp|Q8CQ92|HIS6_STAES | Imidazole glycerol phosphate synthase subunit HisF OS=Staphylococcus epidermidis (strain ATCC 12228) GN=hisF PE=3 SV=1 | 226 | 541 | 7.0E-48 |
sp|Q4KJS4|HIS6_PSEF5 | Imidazole glycerol phosphate synthase subunit HisF OS=Pseudomonas fluorescens (strain Pf-5 / ATCC BAA-477) GN=hisF PE=3 SV=1 | 226 | 541 | 7.0E-48 |
sp|B1HVQ1|HIS6_LYSSC | Imidazole glycerol phosphate synthase subunit HisF OS=Lysinibacillus sphaericus (strain C3-41) GN=hisF PE=3 SV=1 | 226 | 541 | 1.0E-47 |
sp|B0TDM7|HIS6_HELMI | Imidazole glycerol phosphate synthase subunit HisF OS=Heliobacterium modesticaldum (strain ATCC 51547 / Ice1) GN=hisF PE=3 SV=1 | 226 | 543 | 1.0E-47 |
sp|B3WED1|HIS6_LACCB | Imidazole glycerol phosphate synthase subunit HisF OS=Lactobacillus casei (strain BL23) GN=hisF PE=3 SV=1 | 226 | 541 | 1.0E-47 |
sp|B2UEE5|HIS6_RALPJ | Imidazole glycerol phosphate synthase subunit HisF OS=Ralstonia pickettii (strain 12J) GN=hisF PE=3 SV=1 | 226 | 541 | 1.0E-47 |
sp|Q5P795|HIS6_AROAE | Imidazole glycerol phosphate synthase subunit HisF OS=Aromatoleum aromaticum (strain EbN1) GN=hisF PE=3 SV=1 | 226 | 541 | 1.0E-47 |
sp|Q7UKJ9|HIS6_RHOBA | Imidazole glycerol phosphate synthase subunit HisF OS=Rhodopirellula baltica (strain DSM 10527 / NCIMB 13988 / SH1) GN=hisF PE=3 SV=1 | 226 | 541 | 1.0E-47 |
sp|C3K6V3|HIS6_PSEFS | Imidazole glycerol phosphate synthase subunit HisF OS=Pseudomonas fluorescens (strain SBW25) GN=hisF PE=3 SV=1 | 226 | 541 | 1.0E-47 |
sp|A6UR05|HIS6_METVS | Imidazole glycerol phosphate synthase subunit HisF OS=Methanococcus vannielii (strain SB / ATCC 35089 / DSM 1224) GN=hisF PE=3 SV=1 | 226 | 541 | 2.0E-47 |
sp|P58800|HIS6_PYRFU | Imidazole glycerol phosphate synthase subunit HisF OS=Pyrococcus furiosus (strain ATCC 43587 / DSM 3638 / JCM 8422 / Vc1) GN=hisF PE=3 SV=1 | 226 | 541 | 2.0E-47 |
sp|A4G0J7|HIS6_METM5 | Imidazole glycerol phosphate synthase subunit HisF OS=Methanococcus maripaludis (strain C5 / ATCC BAA-1333) GN=hisF PE=3 SV=1 | 226 | 541 | 2.0E-47 |
sp|Q0K693|HIS6_CUPNH | Imidazole glycerol phosphate synthase subunit HisF OS=Cupriavidus necator (strain ATCC 17699 / H16 / DSM 428 / Stanier 337) GN=hisF PE=3 SV=1 | 226 | 541 | 2.0E-47 |
sp|Q4FPZ3|HIS6_PSYA2 | Imidazole glycerol phosphate synthase subunit HisF OS=Psychrobacter arcticus (strain DSM 17307 / 273-4) GN=hisF PE=3 SV=1 | 226 | 541 | 2.0E-47 |
sp|Q2YZ71|HIS6_STAAB | Imidazole glycerol phosphate synthase subunit HisF OS=Staphylococcus aureus (strain bovine RF122 / ET3-1) GN=hisF PE=3 SV=1 | 226 | 541 | 2.0E-47 |
sp|P64362|HIS6_STAAN | Imidazole glycerol phosphate synthase subunit HisF OS=Staphylococcus aureus (strain N315) GN=hisF PE=3 SV=1 | 226 | 541 | 3.0E-47 |
sp|P64361|HIS6_STAAM | Imidazole glycerol phosphate synthase subunit HisF OS=Staphylococcus aureus (strain Mu50 / ATCC 700699) GN=hisF PE=3 SV=1 | 226 | 541 | 3.0E-47 |
sp|A5IWA0|HIS6_STAA9 | Imidazole glycerol phosphate synthase subunit HisF OS=Staphylococcus aureus (strain JH9) GN=hisF PE=3 SV=1 | 226 | 541 | 3.0E-47 |
sp|A6U558|HIS6_STAA2 | Imidazole glycerol phosphate synthase subunit HisF OS=Staphylococcus aureus (strain JH1) GN=hisF PE=3 SV=1 | 226 | 541 | 3.0E-47 |
sp|A7X763|HIS6_STAA1 | Imidazole glycerol phosphate synthase subunit HisF OS=Staphylococcus aureus (strain Mu3 / ATCC 700698) GN=hisF PE=3 SV=1 | 226 | 541 | 3.0E-47 |
sp|A1U5H5|HIS6_MARHV | Imidazole glycerol phosphate synthase subunit HisF OS=Marinobacter hydrocarbonoclasticus (strain ATCC 700491 / DSM 11845 / VT8) GN=hisF PE=3 SV=1 | 226 | 541 | 3.0E-47 |
sp|A9A5X0|HIS6_NITMS | Imidazole glycerol phosphate synthase subunit HisF OS=Nitrosopumilus maritimus (strain SCM1) GN=hisF PE=3 SV=1 | 226 | 541 | 3.0E-47 |
sp|C1DJD3|HIS6_AZOVD | Imidazole glycerol phosphate synthase subunit HisF OS=Azotobacter vinelandii (strain DJ / ATCC BAA-1303) GN=hisF PE=3 SV=1 | 226 | 541 | 3.0E-47 |
sp|Q039B5|HIS6_LACC3 | Imidazole glycerol phosphate synthase subunit HisF OS=Lactobacillus casei (strain ATCC 334) GN=hisF PE=3 SV=1 | 226 | 541 | 3.0E-47 |
sp|B1MBX3|HIS6_MYCA9 | Imidazole glycerol phosphate synthase subunit HisF OS=Mycobacterium abscessus (strain ATCC 19977 / DSM 44196 / CIP 104536 / JCM 13569 / NCTC 13031 / TMC 1543) GN=hisF PE=3 SV=1 | 229 | 541 | 3.0E-47 |
sp|Q8NUI3|HIS6_STAAW | Imidazole glycerol phosphate synthase subunit HisF OS=Staphylococcus aureus (strain MW2) GN=hisF PE=3 SV=1 | 226 | 541 | 4.0E-47 |
sp|A8Z5H3|HIS6_STAAT | Imidazole glycerol phosphate synthase subunit HisF OS=Staphylococcus aureus (strain USA300 / TCH1516) GN=hisF PE=3 SV=1 | 226 | 541 | 4.0E-47 |
sp|Q6G602|HIS6_STAAS | Imidazole glycerol phosphate synthase subunit HisF OS=Staphylococcus aureus (strain MSSA476) GN=hisF PE=3 SV=1 | 226 | 541 | 4.0E-47 |
sp|A6QKG1|HIS6_STAAE | Imidazole glycerol phosphate synthase subunit HisF OS=Staphylococcus aureus (strain Newman) GN=hisF PE=3 SV=1 | 226 | 541 | 4.0E-47 |
sp|Q5HCM4|HIS6_STAAC | Imidazole glycerol phosphate synthase subunit HisF OS=Staphylococcus aureus (strain COL) GN=hisF PE=3 SV=1 | 226 | 541 | 4.0E-47 |
sp|Q2FDI8|HIS6_STAA3 | Imidazole glycerol phosphate synthase subunit HisF OS=Staphylococcus aureus (strain USA300) GN=hisF PE=3 SV=1 | 226 | 541 | 4.0E-47 |
sp|Q6GDD1|HIS6_STAAR | Imidazole glycerol phosphate synthase subunit HisF OS=Staphylococcus aureus (strain MRSA252) GN=hisF PE=3 SV=1 | 226 | 541 | 4.0E-47 |
sp|A6TKT6|HIS6_ALKMQ | Imidazole glycerol phosphate synthase subunit HisF OS=Alkaliphilus metalliredigens (strain QYMF) GN=hisF PE=3 SV=1 | 226 | 542 | 4.0E-47 |
sp|Q5YYP3|HIS6_NOCFA | Imidazole glycerol phosphate synthase subunit HisF OS=Nocardia farcinica (strain IFM 10152) GN=hisF PE=3 SV=1 | 229 | 541 | 4.0E-47 |
sp|Q8KCB0|HIS6_CHLTE | Imidazole glycerol phosphate synthase subunit HisF OS=Chlorobium tepidum (strain ATCC 49652 / DSM 12025 / NBRC 103806 / TLS) GN=hisF PE=3 SV=1 | 226 | 541 | 5.0E-47 |
sp|Q87UG4|HIS6_PSESM | Imidazole glycerol phosphate synthase subunit HisF OS=Pseudomonas syringae pv. tomato (strain DC3000) GN=hisF PE=3 SV=1 | 226 | 541 | 5.0E-47 |
sp|B7INA3|HIS6_BACC2 | Imidazole glycerol phosphate synthase subunit HisF OS=Bacillus cereus (strain G9842) GN=hisF PE=3 SV=1 | 226 | 541 | 5.0E-47 |
sp|Q31E64|HIS6_THICR | Imidazole glycerol phosphate synthase subunit HisF OS=Thiomicrospira crunogena (strain XCL-2) GN=hisF PE=3 SV=1 | 226 | 541 | 5.0E-47 |
sp|Q3J6Q1|HIS6_NITOC | Imidazole glycerol phosphate synthase subunit HisF OS=Nitrosococcus oceani (strain ATCC 19707 / NCIMB 11848) GN=hisF PE=3 SV=1 | 226 | 542 | 6.0E-47 |
sp|A0LCF3|HIS6_MAGMM | Imidazole glycerol phosphate synthase subunit HisF OS=Magnetococcus marinus (strain ATCC BAA-1437 / JCM 17883 / MC-1) GN=hisF PE=3 SV=1 | 226 | 541 | 6.0E-47 |
sp|C0Q9D3|HIS6_DESAH | Imidazole glycerol phosphate synthase subunit HisF OS=Desulfobacterium autotrophicum (strain ATCC 43914 / DSM 3382 / HRM2) GN=hisF PE=3 SV=1 | 226 | 542 | 7.0E-47 |
sp|B9KXJ6|HIS6_THERP | Imidazole glycerol phosphate synthase subunit HisF OS=Thermomicrobium roseum (strain ATCC 27502 / DSM 5159 / P-2) GN=hisF PE=3 SV=1 | 226 | 542 | 9.0E-47 |
sp|Q4ZLQ2|HIS6_PSEU2 | Imidazole glycerol phosphate synthase subunit HisF OS=Pseudomonas syringae pv. syringae (strain B728a) GN=hisF PE=3 SV=1 | 226 | 541 | 1.0E-46 |
sp|Q48C81|HIS6_PSE14 | Imidazole glycerol phosphate synthase subunit HisF OS=Pseudomonas savastanoi pv. phaseolicola (strain 1448A / Race 6) GN=hisF PE=3 SV=1 | 226 | 541 | 1.0E-46 |
sp|A6VTA6|HIS6_MARMS | Imidazole glycerol phosphate synthase subunit HisF OS=Marinomonas sp. (strain MWYL1) GN=hisF PE=3 SV=1 | 225 | 541 | 1.0E-46 |
sp|B1I556|HIS6_DESAP | Imidazole glycerol phosphate synthase subunit HisF OS=Desulforudis audaxviator (strain MP104C) GN=hisF PE=3 SV=1 | 226 | 541 | 2.0E-46 |
sp|B2HQA8|HIS6_MYCMM | Imidazole glycerol phosphate synthase subunit HisF OS=Mycobacterium marinum (strain ATCC BAA-535 / M) GN=hisF PE=3 SV=1 | 224 | 541 | 2.0E-46 |
sp|Q2RGW2|HIS6_MOOTA | Imidazole glycerol phosphate synthase subunit HisF OS=Moorella thermoacetica (strain ATCC 39073) GN=hisF PE=3 SV=1 | 226 | 541 | 2.0E-46 |
sp|C5D7N8|HIS6_GEOSW | Imidazole glycerol phosphate synthase subunit HisF OS=Geobacillus sp. (strain WCH70) GN=hisF PE=3 SV=1 | 226 | 541 | 2.0E-46 |
sp|A1T8W7|HIS6_MYCVP | Imidazole glycerol phosphate synthase subunit HisF OS=Mycobacterium vanbaalenii (strain DSM 7251 / PYR-1) GN=hisF PE=3 SV=1 | 229 | 541 | 2.0E-46 |
sp|A1W444|HIS6_ACISJ | Imidazole glycerol phosphate synthase subunit HisF OS=Acidovorax sp. (strain JS42) GN=hisF PE=3 SV=1 | 226 | 541 | 2.0E-46 |
sp|B9MDW3|HIS6_ACIET | Imidazole glycerol phosphate synthase subunit HisF OS=Acidovorax ebreus (strain TPSY) GN=hisF PE=3 SV=1 | 226 | 541 | 2.0E-46 |
sp|Q845U7|HIS6_BURM1 | Imidazole glycerol phosphate synthase subunit HisF OS=Burkholderia multivorans (strain ATCC 17616 / 249) GN=hisF PE=3 SV=1 | 226 | 541 | 2.0E-46 |
sp|B8GU32|HIS6_THISH | Imidazole glycerol phosphate synthase subunit HisF OS=Thioalkalivibrio sulfidiphilus (strain HL-EbGR7) GN=hisF PE=3 SV=1 | 226 | 541 | 2.0E-46 |
sp|B3R794|HIS6_CUPTR | Imidazole glycerol phosphate synthase subunit HisF OS=Cupriavidus taiwanensis (strain R1 / LMG 19424) GN=hisF PE=3 SV=1 | 226 | 541 | 3.0E-46 |
sp|C5BMF5|HIS6_TERTT | Imidazole glycerol phosphate synthase subunit HisF OS=Teredinibacter turnerae (strain ATCC 39867 / T7901) GN=hisF PE=3 SV=1 | 226 | 541 | 3.0E-46 |
sp|Q2SMB2|HIS6_HAHCH | Imidazole glycerol phosphate synthase subunit HisF OS=Hahella chejuensis (strain KCTC 2396) GN=hisF PE=3 SV=1 | 225 | 541 | 3.0E-46 |
sp|Q0AW41|HIS6_SYNWW | Imidazole glycerol phosphate synthase subunit HisF OS=Syntrophomonas wolfei subsp. wolfei (strain DSM 2245B / Goettingen) GN=hisF PE=3 SV=1 | 228 | 541 | 3.0E-46 |
sp|A1TL06|HIS6_ACIAC | Imidazole glycerol phosphate synthase subunit HisF OS=Acidovorax citrulli (strain AAC00-1) GN=hisF PE=3 SV=1 | 226 | 541 | 3.0E-46 |
sp|B9DIP1|HIS6_STACT | Imidazole glycerol phosphate synthase subunit HisF OS=Staphylococcus carnosus (strain TM300) GN=hisF PE=3 SV=1 | 226 | 541 | 3.0E-46 |
sp|B9L718|HIS6_NAUPA | Imidazole glycerol phosphate synthase subunit HisF OS=Nautilia profundicola (strain ATCC BAA-1463 / DSM 18972 / AmH) GN=hisF PE=3 SV=1 | 226 | 541 | 4.0E-46 |
sp|A0PP20|HIS6_MYCUA | Imidazole glycerol phosphate synthase subunit HisF OS=Mycobacterium ulcerans (strain Agy99) GN=hisF PE=3 SV=1 | 224 | 541 | 5.0E-46 |
sp|Q21NH5|HIS6_SACD2 | Imidazole glycerol phosphate synthase subunit HisF OS=Saccharophagus degradans (strain 2-40 / ATCC 43961 / DSM 17024) GN=hisF PE=3 SV=1 | 226 | 541 | 6.0E-46 |
sp|B7HHG5|HIS6_BACC4 | Imidazole glycerol phosphate synthase subunit HisF OS=Bacillus cereus (strain B4264) GN=hisF PE=3 SV=1 | 226 | 541 | 7.0E-46 |
sp|B6YWA9|HIS6_THEON | Imidazole glycerol phosphate synthase subunit HisF OS=Thermococcus onnurineus (strain NA1) GN=hisF PE=3 SV=1 | 226 | 541 | 8.0E-46 |
sp|Q970Z0|HIS6_SULTO | Imidazole glycerol phosphate synthase subunit HisF OS=Sulfolobus tokodaii (strain DSM 16993 / JCM 10545 / NBRC 100140 / 7) GN=hisF PE=3 SV=1 | 228 | 541 | 9.0E-46 |
sp|A9B5I5|HIS6_HERA2 | Imidazole glycerol phosphate synthase subunit HisF OS=Herpetosiphon aurantiacus (strain ATCC 23779 / DSM 785) GN=hisF PE=3 SV=1 | 226 | 542 | 9.0E-46 |
sp|B3EKW7|HIS6_CHLPB | Imidazole glycerol phosphate synthase subunit HisF OS=Chlorobium phaeobacteroides (strain BS1) GN=hisF PE=3 SV=1 | 226 | 541 | 9.0E-46 |
sp|Q8GDQ6|HIS6_HELMO | Imidazole glycerol phosphate synthase subunit HisF (Fragment) OS=Heliobacillus mobilis GN=hisF PE=3 SV=1 | 226 | 543 | 1.0E-45 |
sp|P60715|HIS6_GEOSL | Imidazole glycerol phosphate synthase subunit HisF OS=Geobacter sulfurreducens (strain ATCC 51573 / DSM 12127 / PCA) GN=hisF PE=3 SV=1 | 226 | 541 | 1.0E-45 |
sp|A0LFI1|HIS6_SYNFM | Imidazole glycerol phosphate synthase subunit HisF OS=Syntrophobacter fumaroxidans (strain DSM 10017 / MPOB) GN=hisF PE=3 SV=1 | 226 | 542 | 1.0E-45 |
sp|Q8XV85|HIS6_RALSO | Imidazole glycerol phosphate synthase subunit HisF OS=Ralstonia solanacearum (strain GMI1000) GN=hisF PE=3 SV=1 | 226 | 542 | 1.0E-45 |
sp|B3QQ00|HIS6_CHLP8 | Imidazole glycerol phosphate synthase subunit HisF OS=Chlorobaculum parvum (strain NCIB 8327) GN=hisF PE=3 SV=1 | 226 | 541 | 1.0E-45 |
sp|A7GMV0|HIS6_BACCN | Imidazole glycerol phosphate synthase subunit HisF OS=Bacillus cytotoxicus (strain DSM 22905 / CIP 110041 / 391-98 / NVH 391-98) GN=hisF PE=3 SV=1 | 226 | 541 | 1.0E-45 |
sp|Q81G02|HIS6_BACCR | Imidazole glycerol phosphate synthase subunit HisF OS=Bacillus cereus (strain ATCC 14579 / DSM 31 / JCM 2152 / NBRC 15305 / NCIMB 9373 / NRRL B-3711) GN=hisF PE=3 SV=1 | 226 | 541 | 1.0E-45 |
sp|Q2J8L3|HIS6_FRASC | Imidazole glycerol phosphate synthase subunit HisF OS=Frankia sp. (strain CcI3) GN=hisF PE=3 SV=1 | 229 | 541 | 1.0E-45 |
sp|B2UQA2|HIS6_AKKM8 | Imidazole glycerol phosphate synthase subunit HisF OS=Akkermansia muciniphila (strain ATCC BAA-835 / Muc) GN=hisF PE=3 SV=1 | 226 | 541 | 2.0E-45 |
sp|B4S9G0|HIS6_PROA2 | Imidazole glycerol phosphate synthase subunit HisF OS=Prosthecochloris aestuarii (strain DSM 271 / SK 413) GN=hisF PE=3 SV=1 | 226 | 541 | 2.0E-45 |
sp|B3EEF2|HIS6_CHLL2 | Imidazole glycerol phosphate synthase subunit HisF OS=Chlorobium limicola (strain DSM 245 / NBRC 103803) GN=hisF PE=3 SV=1 | 226 | 541 | 2.0E-45 |
sp|C6E7F4|HIS6_GEOSM | Imidazole glycerol phosphate synthase subunit HisF OS=Geobacter sp. (strain M21) GN=hisF PE=3 SV=1 | 226 | 541 | 2.0E-45 |
sp|C1ATY7|HIS6_RHOOB | Imidazole glycerol phosphate synthase subunit HisF OS=Rhodococcus opacus (strain B4) GN=hisF PE=3 SV=1 | 226 | 541 | 2.0E-45 |
sp|Q46WL8|HIS6_CUPPJ | Imidazole glycerol phosphate synthase subunit HisF OS=Cupriavidus pinatubonensis (strain JMP 134 / LMG 1197) GN=hisF PE=3 SV=1 | 226 | 541 | 2.0E-45 |
sp|Q0SHY7|HIS6_RHOJR | Imidazole glycerol phosphate synthase subunit HisF OS=Rhodococcus jostii (strain RHA1) GN=hisF PE=3 SV=1 | 226 | 541 | 2.0E-45 |
sp|B5EDR4|HIS6_GEOBB | Imidazole glycerol phosphate synthase subunit HisF OS=Geobacter bemidjiensis (strain Bem / ATCC BAA-1014 / DSM 16622) GN=hisF PE=3 SV=1 | 226 | 541 | 3.0E-45 |
sp|A5WHT5|HIS6_PSYWF | Imidazole glycerol phosphate synthase subunit HisF OS=Psychrobacter sp. (strain PRwf-1) GN=hisF PE=3 SV=1 | 226 | 541 | 3.0E-45 |
sp|C0QPQ6|HIS6_PERMH | Imidazole glycerol phosphate synthase subunit HisF OS=Persephonella marina (strain DSM 14350 / EX-H1) GN=hisF PE=3 SV=1 | 226 | 541 | 3.0E-45 |
sp|B8FP24|HIS6_DESHD | Imidazole glycerol phosphate synthase subunit HisF OS=Desulfitobacterium hafniense (strain DCB-2 / DSM 10664) GN=hisF PE=3 SV=1 | 226 | 542 | 3.0E-45 |
sp|Q11VM1|HIS6_CYTH3 | Imidazole glycerol phosphate synthase subunit HisF OS=Cytophaga hutchinsonii (strain ATCC 33406 / NCIMB 9469) GN=hisF PE=3 SV=1 | 226 | 542 | 3.0E-45 |
sp|Q1IKB2|HIS6_KORVE | Imidazole glycerol phosphate synthase subunit HisF OS=Koribacter versatilis (strain Ellin345) GN=hisF PE=3 SV=1 | 226 | 541 | 4.0E-45 |
sp|Q39YP2|HIS6_GEOMG | Imidazole glycerol phosphate synthase subunit HisF OS=Geobacter metallireducens (strain GS-15 / ATCC 53774 / DSM 7210) GN=hisF PE=3 SV=1 | 226 | 541 | 4.0E-45 |
sp|Q1R080|HIS6_CHRSD | Imidazole glycerol phosphate synthase subunit HisF OS=Chromohalobacter salexigens (strain DSM 3043 / ATCC BAA-138 / NCIMB 13768) GN=hisF PE=3 SV=1 | 226 | 541 | 4.0E-45 |
sp|Q24QJ5|HIS6_DESHY | Imidazole glycerol phosphate synthase subunit HisF OS=Desulfitobacterium hafniense (strain Y51) GN=hisF PE=3 SV=1 | 226 | 542 | 4.0E-45 |
sp|A5CZ73|HIS6_PELTS | Imidazole glycerol phosphate synthase subunit HisF OS=Pelotomaculum thermopropionicum (strain DSM 13744 / JCM 10971 / SI) GN=hisF PE=3 SV=1 | 226 | 541 | 4.0E-45 |
sp|A9WR62|HIS6_RENSM | Imidazole glycerol phosphate synthase subunit HisF OS=Renibacterium salmoninarum (strain ATCC 33209 / DSM 20767 / JCM 11484 / NBRC 15589 / NCIMB 2235) GN=hisF PE=3 SV=1 | 229 | 541 | 5.0E-45 |
sp|Q3SEU8|HIS6_THIDA | Imidazole glycerol phosphate synthase subunit HisF OS=Thiobacillus denitrificans (strain ATCC 25259) GN=hisF PE=3 SV=1 | 226 | 541 | 5.0E-45 |
sp|A6Q117|HIS6_NITSB | Imidazole glycerol phosphate synthase subunit HisF OS=Nitratiruptor sp. (strain SB155-2) GN=hisF PE=3 SV=1 | 226 | 541 | 5.0E-45 |
sp|C1ANM7|HIS6_MYCBT | Imidazole glycerol phosphate synthase subunit HisF OS=Mycobacterium bovis (strain BCG / Tokyo 172 / ATCC 35737 / TMC 1019) GN=hisF PE=3 SV=1 | 223 | 541 | 5.0E-45 |
sp|A1KJ21|HIS6_MYCBP | Imidazole glycerol phosphate synthase subunit HisF OS=Mycobacterium bovis (strain BCG / Pasteur 1173P2) GN=hisF PE=3 SV=1 | 223 | 541 | 5.0E-45 |
sp|Q7VEW8|HIS6_MYCBO | Imidazole glycerol phosphate synthase subunit HisF OS=Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97) GN=hisF PE=3 SV=1 | 223 | 541 | 5.0E-45 |
sp|A4SFU1|HIS6_CHLPM | Imidazole glycerol phosphate synthase subunit HisF OS=Chlorobium phaeovibrioides (strain DSM 265 / 1930) GN=hisF PE=3 SV=1 | 226 | 541 | 6.0E-45 |
sp|A4G9I6|HIS6_HERAR | Imidazole glycerol phosphate synthase subunit HisF OS=Herminiimonas arsenicoxydans GN=hisF PE=3 SV=1 | 226 | 541 | 6.0E-45 |
sp|B3Q951|HIS6_RHOPT | Imidazole glycerol phosphate synthase subunit HisF OS=Rhodopseudomonas palustris (strain TIE-1) GN=hisF PE=3 SV=1 | 229 | 541 | 7.0E-45 |
sp|P60667|HIS6_RHOPA | Imidazole glycerol phosphate synthase subunit HisF OS=Rhodopseudomonas palustris (strain ATCC BAA-98 / CGA009) GN=hisF PE=3 SV=1 | 229 | 541 | 7.0E-45 |
sp|P9WMM3|HIS6_MYCTU | Imidazole glycerol phosphate synthase subunit HisF OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=hisF PE=1 SV=1 | 223 | 541 | 7.0E-45 |
sp|P9WMM2|HIS6_MYCTO | Imidazole glycerol phosphate synthase subunit HisF OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) GN=hisF PE=3 SV=1 | 223 | 541 | 7.0E-45 |
sp|A5U2W1|HIS6_MYCTA | Imidazole glycerol phosphate synthase subunit HisF OS=Mycobacterium tuberculosis (strain ATCC 25177 / H37Ra) GN=hisF PE=3 SV=1 | 223 | 541 | 7.0E-45 |
sp|Q1LIB2|HIS6_CUPMC | Imidazole glycerol phosphate synthase subunit HisF OS=Cupriavidus metallidurans (strain ATCC 43123 / DSM 2839 / NBRC 102507 / CH34) GN=hisF PE=3 SV=1 | 226 | 542 | 8.0E-45 |
sp|A1BHP6|HIS6_CHLPD | Imidazole glycerol phosphate synthase subunit HisF OS=Chlorobium phaeobacteroides (strain DSM 266) GN=hisF PE=3 SV=1 | 226 | 541 | 8.0E-45 |
sp|B1ILB0|HIS6_CLOBK | Imidazole glycerol phosphate synthase subunit HisF OS=Clostridium botulinum (strain Okra / Type B1) GN=hisF PE=3 SV=1 | 226 | 541 | 8.0E-45 |
sp|C1EMQ7|HIS6_BACC3 | Imidazole glycerol phosphate synthase subunit HisF OS=Bacillus cereus (strain 03BB102) GN=hisF PE=3 SV=1 | 226 | 541 | 9.0E-45 |
sp|A0RBM2|HIS6_BACAH | Imidazole glycerol phosphate synthase subunit HisF OS=Bacillus thuringiensis (strain Al Hakam) GN=hisF PE=3 SV=1 | 226 | 541 | 9.0E-45 |
sp|A1KSN6|HIS6_NEIMF | Imidazole glycerol phosphate synthase subunit HisF OS=Neisseria meningitidis serogroup C / serotype 2a (strain ATCC 700532 / DSM 15464 / FAM18) GN=hisF PE=3 SV=1 | 226 | 541 | 9.0E-45 |
sp|Q1H4R2|HIS6_METFK | Imidazole glycerol phosphate synthase subunit HisF OS=Methylobacillus flagellatus (strain KT / ATCC 51484 / DSM 6875) GN=hisF PE=3 SV=1 | 226 | 541 | 9.0E-45 |
sp|Q9JVH5|HIS6_NEIMA | Imidazole glycerol phosphate synthase subunit HisF OS=Neisseria meningitidis serogroup A / serotype 4A (strain Z2491) GN=hisF PE=3 SV=1 | 226 | 541 | 1.0E-44 |
sp|B4RJN3|HIS6_NEIG2 | Imidazole glycerol phosphate synthase subunit HisF OS=Neisseria gonorrhoeae (strain NCCP11945) GN=hisF PE=3 SV=1 | 226 | 541 | 1.0E-44 |
sp|Q5FA23|HIS6_NEIG1 | Imidazole glycerol phosphate synthase subunit HisF OS=Neisseria gonorrhoeae (strain ATCC 700825 / FA 1090) GN=hisF PE=3 SV=1 | 226 | 541 | 1.0E-44 |
sp|B3E617|HIS6_GEOLS | Imidazole glycerol phosphate synthase subunit HisF OS=Geobacter lovleyi (strain ATCC BAA-1151 / DSM 17278 / SZ) GN=hisF PE=3 SV=1 | 226 | 541 | 1.0E-44 |
sp|B5EQF2|HIS6_ACIF5 | Imidazole glycerol phosphate synthase subunit HisF OS=Acidithiobacillus ferrooxidans (strain ATCC 53993) GN=hisF PE=3 SV=1 | 226 | 541 | 1.0E-44 |
sp|B7JA19|HIS6_ACIF2 | Imidazole glycerol phosphate synthase subunit HisF OS=Acidithiobacillus ferrooxidans (strain ATCC 23270 / DSM 14882 / CIP 104768 / NCIMB 8455) GN=hisF PE=3 SV=1 | 226 | 541 | 1.0E-44 |
sp|A9M2Q5|HIS6_NEIM0 | Imidazole glycerol phosphate synthase subunit HisF OS=Neisseria meningitidis serogroup C (strain 053442) GN=hisF PE=3 SV=1 | 226 | 541 | 1.0E-44 |
sp|Q2J340|HIS6_RHOP2 | Imidazole glycerol phosphate synthase subunit HisF OS=Rhodopseudomonas palustris (strain HaA2) GN=hisF PE=3 SV=1 | 229 | 541 | 1.0E-44 |
sp|Q07UQ9|HIS6_RHOP5 | Imidazole glycerol phosphate synthase subunit HisF OS=Rhodopseudomonas palustris (strain BisA53) GN=hisF PE=3 SV=1 | 229 | 541 | 1.0E-44 |
sp|A6T376|HIS6_JANMA | Imidazole glycerol phosphate synthase subunit HisF OS=Janthinobacterium sp. (strain Marseille) GN=hisF PE=3 SV=1 | 226 | 541 | 1.0E-44 |
sp|A9VLH7|HIS6_BACWK | Imidazole glycerol phosphate synthase subunit HisF OS=Bacillus weihenstephanensis (strain KBAB4) GN=hisF PE=3 SV=1 | 226 | 541 | 1.0E-44 |
sp|Q21U91|HIS6_RHOFT | Imidazole glycerol phosphate synthase subunit HisF OS=Rhodoferax ferrireducens (strain ATCC BAA-621 / DSM 15236 / T118) GN=hisF PE=3 SV=1 | 226 | 541 | 1.0E-44 |
sp|A4YJV5|HIS6_BRASO | Imidazole glycerol phosphate synthase subunit HisF OS=Bradyrhizobium sp. (strain ORS278) GN=hisF PE=3 SV=1 | 229 | 541 | 1.0E-44 |
sp|B8FFL4|HIS6_DESAA | Imidazole glycerol phosphate synthase subunit HisF OS=Desulfatibacillum alkenivorans (strain AK-01) GN=hisF PE=3 SV=1 | 226 | 541 | 2.0E-44 |
sp|A8HYT7|HIS6_AZOC5 | Imidazole glycerol phosphate synthase subunit HisF OS=Azorhizobium caulinodans (strain ATCC 43989 / DSM 5975 / JCM 20966 / NBRC 14845 / NCIMB 13405 / ORS 571) GN=hisF PE=3 SV=1 | 226 | 542 | 2.0E-44 |
sp|Q3A137|HIS6_PELCD | Imidazole glycerol phosphate synthase subunit HisF OS=Pelobacter carbinolicus (strain DSM 2380 / Gra Bd 1) GN=hisF PE=3 SV=1 | 226 | 541 | 2.0E-44 |
sp|Q5KVD0|HIS6_GEOKA | Imidazole glycerol phosphate synthase subunit HisF OS=Geobacillus kaustophilus (strain HTA426) GN=hisF PE=3 SV=1 | 226 | 541 | 2.0E-44 |
sp|A0AG15|HIS6_LISW6 | Imidazole glycerol phosphate synthase subunit HisF OS=Listeria welshimeri serovar 6b (strain ATCC 35897 / DSM 20650 / SLCC5334) GN=hisF PE=3 SV=1 | 226 | 541 | 2.0E-44 |
sp|Q6AF73|HIS6_LEIXX | Imidazole glycerol phosphate synthase subunit HisF OS=Leifsonia xyli subsp. xyli (strain CTCB07) GN=hisF PE=3 SV=1 | 225 | 541 | 2.0E-44 |
sp|A8ZVD2|HIS6_DESOH | Imidazole glycerol phosphate synthase subunit HisF OS=Desulfococcus oleovorans (strain DSM 6200 / Hxd3) GN=hisF PE=3 SV=1 | 226 | 542 | 2.0E-44 |
sp|Q9K0H4|HIS6_NEIMB | Imidazole glycerol phosphate synthase subunit HisF OS=Neisseria meningitidis serogroup B (strain MC58) GN=hisF PE=3 SV=1 | 226 | 541 | 2.0E-44 |
sp|A1KAV4|HIS6_AZOSB | Imidazole glycerol phosphate synthase subunit HisF OS=Azoarcus sp. (strain BH72) GN=hisF PE=3 SV=1 | 226 | 541 | 2.0E-44 |
sp|A5I246|HIS6_CLOBH | Imidazole glycerol phosphate synthase subunit HisF OS=Clostridium botulinum (strain Hall / ATCC 3502 / NCTC 13319 / Type A) GN=hisF PE=3 SV=1 | 226 | 541 | 3.0E-44 |
sp|A7FU82|HIS6_CLOB1 | Imidazole glycerol phosphate synthase subunit HisF OS=Clostridium botulinum (strain ATCC 19397 / Type A) GN=hisF PE=3 SV=1 | 226 | 541 | 3.0E-44 |
sp|Q8DTR3|HIS6_STRMU | Imidazole glycerol phosphate synthase subunit HisF OS=Streptococcus mutans serotype c (strain ATCC 700610 / UA159) GN=hisF PE=3 SV=1 | 226 | 541 | 4.0E-44 |
sp|Q3AD48|HIS6_CARHZ | Imidazole glycerol phosphate synthase subunit HisF OS=Carboxydothermus hydrogenoformans (strain ATCC BAA-161 / DSM 6008 / Z-2901) GN=hisF PE=3 SV=1 | 226 | 541 | 4.0E-44 |
sp|A8FHQ9|HIS6_BACP2 | Imidazole glycerol phosphate synthase subunit HisF OS=Bacillus pumilus (strain SAFR-032) GN=hisF PE=3 SV=1 | 226 | 541 | 4.0E-44 |
sp|B7HKD4|HIS6_BACC7 | Imidazole glycerol phosphate synthase subunit HisF OS=Bacillus cereus (strain AH187) GN=hisF PE=3 SV=1 | 226 | 541 | 5.0E-44 |
sp|B8J216|HIS6_DESDA | Imidazole glycerol phosphate synthase subunit HisF OS=Desulfovibrio desulfuricans (strain ATCC 27774 / DSM 6949) GN=hisF PE=3 SV=1 | 226 | 541 | 5.0E-44 |
sp|Q1QRX0|HIS6_NITHX | Imidazole glycerol phosphate synthase subunit HisF OS=Nitrobacter hamburgensis (strain X14 / DSM 10229) GN=hisF PE=3 SV=1 | 229 | 541 | 5.0E-44 |
sp|Q12FC7|HIS6_POLSJ | Imidazole glycerol phosphate synthase subunit HisF OS=Polaromonas sp. (strain JS666 / ATCC BAA-500) GN=hisF PE=3 SV=1 | 226 | 541 | 5.0E-44 |
sp|C4XS73|HIS6_DESMR | Imidazole glycerol phosphate synthase subunit HisF OS=Desulfovibrio magneticus (strain ATCC 700980 / DSM 13731 / RS-1) GN=hisF PE=3 SV=1 | 226 | 543 | 6.0E-44 |
sp|A8EQW5|HIS6_ARCB4 | Imidazole glycerol phosphate synthase subunit HisF OS=Arcobacter butzleri (strain RM4018) GN=hisF PE=3 SV=1 | 224 | 541 | 6.0E-44 |
sp|B4SFM7|HIS6_PELPB | Imidazole glycerol phosphate synthase subunit HisF OS=Pelodictyon phaeoclathratiforme (strain DSM 5477 / BU-1) GN=hisF PE=3 SV=1 | 226 | 541 | 6.0E-44 |
sp|A7GDQ7|HIS6_CLOBL | Imidazole glycerol phosphate synthase subunit HisF OS=Clostridium botulinum (strain Langeland / NCTC 10281 / Type F) GN=hisF PE=3 SV=1 | 226 | 541 | 6.0E-44 |
sp|Q13E40|HIS6_RHOPS | Imidazole glycerol phosphate synthase subunit HisF OS=Rhodopseudomonas palustris (strain BisB5) GN=hisF PE=3 SV=1 | 229 | 541 | 6.0E-44 |
sp|C1FN42|HIS6_CLOBJ | Imidazole glycerol phosphate synthase subunit HisF OS=Clostridium botulinum (strain Kyoto / Type A2) GN=hisF PE=3 SV=1 | 226 | 541 | 7.0E-44 |
sp|Q63DW8|HIS6_BACCZ | Imidazole glycerol phosphate synthase subunit HisF OS=Bacillus cereus (strain ZK / E33L) GN=hisF PE=3 SV=1 | 226 | 541 | 7.0E-44 |
sp|B7JFZ5|HIS6_BACC0 | Imidazole glycerol phosphate synthase subunit HisF OS=Bacillus cereus (strain AH820) GN=hisF PE=3 SV=1 | 226 | 541 | 7.0E-44 |
sp|A9GBI6|HIS6_SORC5 | Imidazole glycerol phosphate synthase subunit HisF OS=Sorangium cellulosum (strain So ce56) GN=hisF PE=3 SV=1 | 226 | 541 | 7.0E-44 |
sp|Q21CK1|HIS6_RHOPB | Imidazole glycerol phosphate synthase subunit HisF OS=Rhodopseudomonas palustris (strain BisB18) GN=hisF PE=3 SV=1 | 229 | 541 | 8.0E-44 |
sp|Q4A049|HIS6_STAS1 | Imidazole glycerol phosphate synthase subunit HisF OS=Staphylococcus saprophyticus subsp. saprophyticus (strain ATCC 15305 / DSM 20229) GN=hisF PE=3 SV=1 | 226 | 541 | 1.0E-43 |
sp|A6WC96|HIS6_KINRD | Imidazole glycerol phosphate synthase subunit HisF OS=Kineococcus radiotolerans (strain ATCC BAA-149 / DSM 14245 / SRS30216) GN=hisF PE=3 SV=1 | 229 | 541 | 1.0E-43 |
sp|A4ISR2|HIS6_GEOTN | Imidazole glycerol phosphate synthase subunit HisF OS=Geobacillus thermodenitrificans (strain NG80-2) GN=hisF PE=3 SV=1 | 226 | 541 | 1.0E-43 |
sp|A1SL56|HIS6_NOCSJ | Imidazole glycerol phosphate synthase subunit HisF OS=Nocardioides sp. (strain BAA-499 / JS614) GN=hisF PE=3 SV=1 | 226 | 541 | 1.0E-43 |
sp|A6QCU4|HIS6_SULNB | Imidazole glycerol phosphate synthase subunit HisF OS=Sulfurovum sp. (strain NBC37-1) GN=hisF PE=3 SV=1 | 226 | 541 | 1.0E-43 |
sp|B9IV00|HIS6_BACCQ | Imidazole glycerol phosphate synthase subunit HisF OS=Bacillus cereus (strain Q1) GN=hisF PE=3 SV=1 | 226 | 541 | 1.0E-43 |
sp|A1VK42|HIS6_POLNA | Imidazole glycerol phosphate synthase subunit HisF OS=Polaromonas naphthalenivorans (strain CJ2) GN=hisF PE=3 SV=1 | 226 | 541 | 2.0E-43 |
sp|B4U7M4|HIS6_HYDS0 | Imidazole glycerol phosphate synthase subunit HisF OS=Hydrogenobaculum sp. (strain Y04AAS1) GN=hisF PE=3 SV=1 | 226 | 541 | 2.0E-43 |
sp|B7GQS5|HIS6_BIFLS | Imidazole glycerol phosphate synthase subunit HisF OS=Bifidobacterium longum subsp. infantis (strain ATCC 15697 / DSM 20088 / JCM 1222 / NCTC 11817 / S12) GN=hisF PE=3 SV=1 | 226 | 541 | 2.0E-43 |
sp|Q89WM4|HIS6_BRADU | Imidazole glycerol phosphate synthase subunit HisF OS=Bradyrhizobium diazoefficiens (strain JCM 10833 / IAM 13628 / NBRC 14792 / USDA 110) GN=hisF PE=3 SV=1 | 229 | 541 | 2.0E-43 |
sp|Q3SWF1|HIS6_NITWN | Imidazole glycerol phosphate synthase subunit HisF OS=Nitrobacter winogradskyi (strain Nb-255 / ATCC 25391) GN=hisF PE=3 SV=1 | 229 | 541 | 2.0E-43 |
sp|A3DJF7|HIS6_CLOTH | Imidazole glycerol phosphate synthase subunit HisF OS=Clostridium thermocellum (strain ATCC 27405 / DSM 1237 / NBRC 103400 / NCIMB 10682 / NRRL B-4536 / VPI 7372) GN=hisF PE=3 SV=1 | 226 | 542 | 2.0E-43 |
sp|Q0A5D3|HIS6_ALKEH | Imidazole glycerol phosphate synthase subunit HisF OS=Alkalilimnicola ehrlichii (strain ATCC BAA-1101 / DSM 17681 / MLHE-1) GN=hisF PE=3 SV=1 | 226 | 541 | 3.0E-43 |
sp|B3PGA4|HIS6_CELJU | Imidazole glycerol phosphate synthase subunit HisF OS=Cellvibrio japonicus (strain Ueda107) GN=hisF PE=3 SV=1 | 226 | 541 | 3.0E-43 |
sp|Q3ATG0|HIS6_CHLCH | Imidazole glycerol phosphate synthase subunit HisF OS=Chlorobium chlorochromatii (strain CaD3) GN=hisF PE=3 SV=1 | 226 | 541 | 4.0E-43 |
sp|A9KP30|HIS6_CLOPH | Imidazole glycerol phosphate synthase subunit HisF OS=Clostridium phytofermentans (strain ATCC 700394 / DSM 18823 / ISDg) GN=hisF PE=3 SV=1 | 227 | 541 | 4.0E-43 |
sp|P62449|HIS6_BACC1 | Imidazole glycerol phosphate synthase subunit HisF OS=Bacillus cereus (strain ATCC 10987 / NRS 248) GN=hisF PE=3 SV=1 | 226 | 541 | 4.0E-43 |
sp|Q9X7C2|HIS6_MYCLE | Imidazole glycerol phosphate synthase subunit HisF OS=Mycobacterium leprae (strain TN) GN=hisF PE=3 SV=1 | 224 | 541 | 4.0E-43 |
sp|B8ZRB4|HIS6_MYCLB | Imidazole glycerol phosphate synthase subunit HisF OS=Mycobacterium leprae (strain Br4923) GN=hisF PE=3 SV=1 | 224 | 541 | 4.0E-43 |
sp|A5E8E5|HIS6_BRASB | Imidazole glycerol phosphate synthase subunit HisF OS=Bradyrhizobium sp. (strain BTAi1 / ATCC BAA-1182) GN=hisF PE=3 SV=1 | 229 | 541 | 5.0E-43 |
sp|C3KVX6|HIS6_CLOB6 | Imidazole glycerol phosphate synthase subunit HisF OS=Clostridium botulinum (strain 657 / Type Ba4) GN=hisF PE=3 SV=1 | 226 | 541 | 5.0E-43 |
sp|Q5JFU8|HIS6_THEKO | Imidazole glycerol phosphate synthase subunit HisF OS=Thermococcus kodakarensis (strain ATCC BAA-918 / JCM 12380 / KOD1) GN=hisF PE=3 SV=1 | 226 | 541 | 6.0E-43 |
sp|Q6HLE3|HIS6_BACHK | Imidazole glycerol phosphate synthase subunit HisF OS=Bacillus thuringiensis subsp. konkukian (strain 97-27) GN=hisF PE=3 SV=1 | 226 | 541 | 6.0E-43 |
sp|Q81T58|HIS6_BACAN | Imidazole glycerol phosphate synthase subunit HisF OS=Bacillus anthracis GN=hisF PE=3 SV=1 | 226 | 541 | 6.0E-43 |
sp|C3L9P7|HIS6_BACAC | Imidazole glycerol phosphate synthase subunit HisF OS=Bacillus anthracis (strain CDC 684 / NRRL 3495) GN=hisF PE=3 SV=1 | 226 | 541 | 6.0E-43 |
sp|C3P506|HIS6_BACAA | Imidazole glycerol phosphate synthase subunit HisF OS=Bacillus anthracis (strain A0248) GN=hisF PE=3 SV=1 | 226 | 541 | 6.0E-43 |
sp|Q722Y7|HIS6_LISMF | Imidazole glycerol phosphate synthase subunit HisF OS=Listeria monocytogenes serotype 4b (strain F2365) GN=hisF PE=3 SV=1 | 226 | 541 | 6.0E-43 |
sp|C1L0J2|HIS6_LISMC | Imidazole glycerol phosphate synthase subunit HisF OS=Listeria monocytogenes serotype 4b (strain CLIP80459) GN=hisF PE=3 SV=1 | 226 | 541 | 6.0E-43 |
sp|A0JVK5|HIS6_ARTS2 | Imidazole glycerol phosphate synthase subunit HisF OS=Arthrobacter sp. (strain FB24) GN=hisF PE=3 SV=1 | 229 | 541 | 6.0E-43 |
sp|Q3B2Q6|HIS6_CHLL7 | Imidazole glycerol phosphate synthase subunit HisF OS=Chlorobium luteolum (strain DSM 273 / 2530) GN=hisF PE=3 SV=1 | 226 | 541 | 7.0E-43 |
sp|B2A6X0|HIS6_NATTJ | Imidazole glycerol phosphate synthase subunit HisF OS=Natranaerobius thermophilus (strain ATCC BAA-1301 / DSM 18059 / JW/NM-WN-LF) GN=hisF PE=3 SV=1 | 226 | 541 | 7.0E-43 |
sp|B3DRT8|HIS6_BIFLD | Imidazole glycerol phosphate synthase subunit HisF OS=Bifidobacterium longum (strain DJO10A) GN=hisF PE=3 SV=1 | 226 | 541 | 8.0E-43 |
sp|A1VGY9|HIS6_DESVV | Imidazole glycerol phosphate synthase subunit HisF OS=Desulfovibrio vulgaris subsp. vulgaris (strain DP4) GN=hisF PE=3 SV=1 | 226 | 542 | 9.0E-43 |
sp|P62450|HIS6_DESVH | Imidazole glycerol phosphate synthase subunit HisF OS=Desulfovibrio vulgaris (strain Hildenborough / ATCC 29579 / NCIMB 8303) GN=hisF PE=3 SV=1 | 226 | 542 | 9.0E-43 |
sp|A3M9P1|HIS6_ACIBT | Imidazole glycerol phosphate synthase subunit HisF OS=Acinetobacter baumannii (strain ATCC 17978 / CIP 53.77 / LMG 1025 / NCDC KC755 / 5377) GN=hisF PE=3 SV=2 | 226 | 541 | 1.0E-42 |
sp|B2I0P3|HIS6_ACIBC | Imidazole glycerol phosphate synthase subunit HisF OS=Acinetobacter baumannii (strain ACICU) GN=hisF PE=3 SV=1 | 226 | 541 | 1.0E-42 |
sp|B7IBD7|HIS6_ACIB5 | Imidazole glycerol phosphate synthase subunit HisF OS=Acinetobacter baumannii (strain AB0057) GN=hisF PE=3 SV=1 | 226 | 541 | 1.0E-42 |
sp|B7GVJ5|HIS6_ACIB3 | Imidazole glycerol phosphate synthase subunit HisF OS=Acinetobacter baumannii (strain AB307-0294) GN=hisF PE=3 SV=1 | 226 | 541 | 1.0E-42 |
sp|A1WR24|HIS6_VEREI | Imidazole glycerol phosphate synthase subunit HisF OS=Verminephrobacter eiseniae (strain EF01-2) GN=hisF PE=3 SV=1 | 226 | 542 | 1.0E-42 |
sp|Q4FNT7|HIS6_PELUB | Imidazole glycerol phosphate synthase subunit HisF OS=Pelagibacter ubique (strain HTCC1062) GN=hisF PE=3 SV=1 | 226 | 541 | 1.0E-42 |
sp|Q3MEF5|HIS6_ANAVT | Imidazole glycerol phosphate synthase subunit HisF OS=Anabaena variabilis (strain ATCC 29413 / PCC 7937) GN=hisF PE=3 SV=1 | 226 | 543 | 1.0E-42 |
sp|B9LFN2|HIS6_CHLSY | Imidazole glycerol phosphate synthase subunit HisF OS=Chloroflexus aurantiacus (strain ATCC 29364 / DSM 637 / Y-400-fl) GN=hisF PE=3 SV=1 | 226 | 543 | 1.0E-42 |
sp|A9WD80|HIS6_CHLAA | Imidazole glycerol phosphate synthase subunit HisF OS=Chloroflexus aurantiacus (strain ATCC 29366 / DSM 635 / J-10-fl) GN=hisF PE=3 SV=1 | 226 | 543 | 1.0E-42 |
sp|Q8YT31|HIS6_NOSS1 | Imidazole glycerol phosphate synthase subunit HisF OS=Nostoc sp. (strain PCC 7120 / UTEX 2576) GN=hisF PE=3 SV=1 | 226 | 543 | 1.0E-42 |
sp|A9BXA1|HIS6_DELAS | Imidazole glycerol phosphate synthase subunit HisF OS=Delftia acidovorans (strain DSM 14801 / SPH-1) GN=hisF PE=3 SV=1 | 226 | 541 | 2.0E-42 |
sp|B8DQX6|HIS6_DESVM | Imidazole glycerol phosphate synthase subunit HisF OS=Desulfovibrio vulgaris (strain Miyazaki F / DSM 19637) GN=hisF PE=3 SV=1 | 226 | 542 | 2.0E-42 |
sp|Q9S2T7|HIS6_STRCO | Imidazole glycerol phosphate synthase subunit HisF OS=Streptomyces coelicolor (strain ATCC BAA-471 / A3(2) / M145) GN=hisF PE=3 SV=1 | 226 | 541 | 2.0E-42 |
sp|A5UY52|HIS6_ROSS1 | Imidazole glycerol phosphate synthase subunit HisF OS=Roseiflexus sp. (strain RS-1) GN=hisF PE=3 SV=1 | 226 | 541 | 2.0E-42 |
sp|C5CQK0|HIS6_VARPS | Imidazole glycerol phosphate synthase subunit HisF OS=Variovorax paradoxus (strain S110) GN=hisF PE=3 SV=1 | 226 | 541 | 2.0E-42 |
sp|A7IHN9|HIS6_XANP2 | Imidazole glycerol phosphate synthase subunit HisF OS=Xanthobacter autotrophicus (strain ATCC BAA-1158 / Py2) GN=hisF PE=3 SV=1 | 226 | 541 | 3.0E-42 |
sp|B8DUB2|HIS6_BIFA0 | Imidazole glycerol phosphate synthase subunit HisF OS=Bifidobacterium animalis subsp. lactis (strain AD011) GN=hisF PE=3 SV=1 | 226 | 541 | 3.0E-42 |
sp|Q8G6F7|HIS6_BIFLO | Imidazole glycerol phosphate synthase subunit HisF OS=Bifidobacterium longum (strain NCC 2705) GN=hisF PE=3 SV=1 | 226 | 541 | 3.0E-42 |
sp|B5YIB7|HIS6_THEYD | Imidazole glycerol phosphate synthase subunit HisF OS=Thermodesulfovibrio yellowstonii (strain ATCC 51303 / DSM 11347 / YP87) GN=hisF PE=3 SV=1 | 226 | 541 | 4.0E-42 |
sp|Q8Y9G5|HIS6_LISMO | Imidazole glycerol phosphate synthase subunit HisF OS=Listeria monocytogenes serovar 1/2a (strain ATCC BAA-679 / EGD-e) GN=hisF PE=3 SV=1 | 226 | 541 | 5.0E-42 |
sp|B7GL45|HIS6_ANOFW | Imidazole glycerol phosphate synthase subunit HisF OS=Anoxybacillus flavithermus (strain DSM 21510 / WK1) GN=hisF PE=3 SV=1 | 226 | 541 | 5.0E-42 |
sp|A9BE47|HIS6_PROM4 | Imidazole glycerol phosphate synthase subunit HisF OS=Prochlorococcus marinus (strain MIT 9211) GN=hisF PE=3 SV=1 | 229 | 541 | 7.0E-42 |
sp|B6JCG5|HIS6_OLICO | Imidazole glycerol phosphate synthase subunit HisF OS=Oligotropha carboxidovorans (strain ATCC 49405 / DSM 1227 / OM5) GN=hisF PE=3 SV=1 | 229 | 541 | 9.0E-42 |
sp|B8GBF3|HIS6_CHLAD | Imidazole glycerol phosphate synthase subunit HisF OS=Chloroflexus aggregans (strain MD-66 / DSM 9485) GN=hisF PE=3 SV=1 | 226 | 545 | 1.0E-41 |
sp|Q4J8I9|HIS6_SULAC | Imidazole glycerol phosphate synthase subunit HisF OS=Sulfolobus acidocaldarius (strain ATCC 33909 / DSM 639 / JCM 8929 / NBRC 15157 / NCIMB 11770) GN=hisF PE=3 SV=1 | 227 | 542 | 1.0E-41 |
sp|Q9RPQ4|HIS6_THEP3 | Imidazole glycerol phosphate synthase subunit HisF OS=Thermoanaerobacter pseudethanolicus (strain ATCC 33223 / 39E) GN=hisF PE=3 SV=1 | 226 | 542 | 1.0E-41 |
sp|C5A7A2|HIS6_THEGJ | Imidazole glycerol phosphate synthase subunit HisF OS=Thermococcus gammatolerans (strain DSM 15229 / JCM 11827 / EJ3) GN=hisF PE=3 SV=1 | 226 | 541 | 2.0E-41 |
sp|Q6A7Y8|HIS6_PROAC | Imidazole glycerol phosphate synthase subunit HisF OS=Propionibacterium acnes (strain KPA171202 / DSM 16379) GN=hisF PE=3 SV=1 | 229 | 541 | 2.0E-41 |
sp|B1ZX57|HIS6_OPITP | Imidazole glycerol phosphate synthase subunit HisF OS=Opitutus terrae (strain DSM 11246 / PB90-1) GN=hisF PE=3 SV=1 | 226 | 541 | 2.0E-41 |
sp|C5CBK1|HIS6_MICLC | Imidazole glycerol phosphate synthase subunit HisF OS=Micrococcus luteus (strain ATCC 4698 / DSM 20030 / JCM 1464 / NBRC 3333 / NCIMB 9278 / NCTC 2665 / VKM Ac-2230) GN=hisF PE=3 SV=1 | 226 | 541 | 2.0E-41 |
sp|Q316L4|HIS6_DESAG | Imidazole glycerol phosphate synthase subunit HisF OS=Desulfovibrio alaskensis (strain G20) GN=hisF PE=3 SV=1 | 226 | 541 | 2.0E-41 |
sp|P26721|HIS6_AZOBR | Imidazole glycerol phosphate synthase subunit HisF OS=Azospirillum brasilense GN=hisF PE=3 SV=1 | 226 | 541 | 3.0E-41 |
sp|Q6F799|HIS6_ACIAD | Imidazole glycerol phosphate synthase subunit HisF OS=Acinetobacter baylyi (strain ATCC 33305 / BD413 / ADP1) GN=hisF PE=3 SV=2 | 226 | 541 | 3.0E-41 |
sp|O34727|HIS6_BACSU | Imidazole glycerol phosphate synthase subunit HisF OS=Bacillus subtilis (strain 168) GN=hisF PE=3 SV=1 | 226 | 541 | 3.0E-41 |
sp|A1R5S1|HIS6_ARTAT | Imidazole glycerol phosphate synthase subunit HisF OS=Arthrobacter aurescens (strain TC1) GN=hisF PE=3 SV=1 | 229 | 541 | 4.0E-41 |
sp|B2GGU9|HIS6_KOCRD | Imidazole glycerol phosphate synthase subunit HisF OS=Kocuria rhizophila (strain ATCC 9341 / DSM 348 / NBRC 103217 / DC2201) GN=hisF PE=3 SV=1 | 225 | 541 | 4.0E-41 |
sp|A5CXY8|HIS6_VESOH | Imidazole glycerol phosphate synthase subunit HisF OS=Vesicomyosocius okutanii subsp. Calyptogena okutanii (strain HA) GN=hisF PE=3 SV=1 | 226 | 541 | 4.0E-41 |
sp|Q65EG3|HIS6_BACLD | Imidazole glycerol phosphate synthase subunit HisF OS=Bacillus licheniformis (strain ATCC 14580 / DSM 13 / JCM 2505 / NBRC 12200 / NCIMB 9375 / NRRL NRS-1264 / Gibson 46) GN=hisF PE=3 SV=1 | 226 | 541 | 4.0E-41 |
sp|C1FAD8|HIS6_ACIC5 | Imidazole glycerol phosphate synthase subunit HisF OS=Acidobacterium capsulatum (strain ATCC 51196 / DSM 11244 / JCM 7670 / NBRC 15755 / NCIMB 13165 / 161) GN=hisF PE=3 SV=1 | 226 | 541 | 5.0E-41 |
sp|Q82A99|HIS6_STRAW | Imidazole glycerol phosphate synthase subunit HisF OS=Streptomyces avermitilis (strain ATCC 31267 / DSM 46492 / JCM 5070 / NBRC 14893 / NCIMB 12804 / NRRL 8165 / MA-4680) GN=hisF PE=3 SV=1 | 226 | 541 | 5.0E-41 |
sp|Q8ESS2|HIS6_OCEIH | Imidazole glycerol phosphate synthase subunit HisF OS=Oceanobacillus iheyensis (strain DSM 14371 / JCM 11309 / KCTC 3954 / HTE831) GN=hisF PE=3 SV=1 | 226 | 542 | 6.0E-41 |
sp|A1WW05|HIS6_HALHL | Imidazole glycerol phosphate synthase subunit HisF OS=Halorhodospira halophila (strain DSM 244 / SL1) GN=hisF PE=3 SV=1 | 228 | 542 | 6.0E-41 |
sp|Q02YX1|HIS6_LACLS | Imidazole glycerol phosphate synthase subunit HisF OS=Lactococcus lactis subsp. cremoris (strain SK11) GN=hisF PE=3 SV=1 | 226 | 533 | 7.0E-41 |
sp|B8I5V6|HIS6_CLOCE | Imidazole glycerol phosphate synthase subunit HisF OS=Clostridium cellulolyticum (strain ATCC 35319 / DSM 5812 / JCM 6584 / H10) GN=hisF PE=3 SV=1 | 226 | 541 | 7.0E-41 |
sp|C4L176|HIS6_EXISA | Imidazole glycerol phosphate synthase subunit HisF OS=Exiguobacterium sp. (strain ATCC BAA-1283 / AT1b) GN=hisF PE=3 SV=1 | 226 | 548 | 9.0E-41 |
sp|Q02133|HIS6_LACLA | Imidazole glycerol phosphate synthase subunit HisF OS=Lactococcus lactis subsp. lactis (strain IL1403) GN=hisF PE=3 SV=3 | 226 | 541 | 1.0E-40 |
sp|B2UX20|HIS6_CLOBA | Imidazole glycerol phosphate synthase subunit HisF OS=Clostridium botulinum (strain Alaska E43 / Type E3) GN=hisF PE=3 SV=1 | 227 | 541 | 1.0E-40 |
sp|A1AV74|HIS6_RUTMC | Imidazole glycerol phosphate synthase subunit HisF OS=Ruthia magnifica subsp. Calyptogena magnifica GN=hisF PE=3 SV=1 | 226 | 541 | 1.0E-40 |
sp|Q67KI0|HIS6_SYMTH | Imidazole glycerol phosphate synthase subunit HisF OS=Symbiobacterium thermophilum (strain T / IAM 14863) GN=hisF PE=3 SV=1 | 226 | 541 | 1.0E-40 |
sp|A7ZGB2|HIS6_CAMC1 | Imidazole glycerol phosphate synthase subunit HisF OS=Campylobacter concisus (strain 13826) GN=hisF PE=3 SV=1 | 226 | 541 | 1.0E-40 |
sp|Q8ZY16|HIS6_PYRAE | Imidazole glycerol phosphate synthase subunit HisF OS=Pyrobaculum aerophilum (strain ATCC 51768 / IM2 / DSM 7523 / JCM 9630 / NBRC 100827) GN=hisF PE=1 SV=1 | 229 | 541 | 2.0E-40 |
sp|A2SE09|HIS6_METPP | Imidazole glycerol phosphate synthase subunit HisF OS=Methylibium petroleiphilum (strain PM1) GN=hisF PE=3 SV=1 | 226 | 542 | 2.0E-40 |
sp|A2RKR7|HIS6_LACLM | Imidazole glycerol phosphate synthase subunit HisF OS=Lactococcus lactis subsp. cremoris (strain MG1363) GN=hisF PE=3 SV=1 | 226 | 533 | 2.0E-40 |
sp|Q88UE3|HIS6_LACPL | Imidazole glycerol phosphate synthase subunit HisF OS=Lactobacillus plantarum (strain ATCC BAA-793 / NCIMB 8826 / WCFS1) GN=hisF PE=3 SV=1 | 226 | 541 | 2.0E-40 |
sp|B1W0M6|HIS6_STRGG | Imidazole glycerol phosphate synthase subunit HisF OS=Streptomyces griseus subsp. griseus (strain JCM 4626 / NBRC 13350) GN=hisF PE=3 SV=1 | 226 | 541 | 2.0E-40 |
sp|Q3M5W4|HIS5_ANAVT | Imidazole glycerol phosphate synthase subunit HisH OS=Anabaena variabilis (strain ATCC 29413 / PCC 7937) GN=hisH PE=3 SV=1 | 1 | 202 | 3.0E-40 |
sp|A9BJZ9|HIS6_PETMO | Imidazole glycerol phosphate synthase subunit HisF OS=Petrotoga mobilis (strain DSM 10674 / SJ95) GN=hisF PE=3 SV=1 | 226 | 541 | 4.0E-40 |
sp|B8H6U2|HIS6_ARTCA | Imidazole glycerol phosphate synthase subunit HisF OS=Arthrobacter chlorophenolicus (strain ATCC 700700 / DSM 12829 / JCM 12360 / NCIMB 13794 / A6) GN=hisF PE=3 SV=1 | 229 | 541 | 4.0E-40 |
sp|A3CNT0|HIS6_STRSV | Imidazole glycerol phosphate synthase subunit HisF OS=Streptococcus sanguinis (strain SK36) GN=hisF PE=3 SV=1 | 226 | 541 | 5.0E-40 |
sp|B8EM84|HIS6_METSB | Imidazole glycerol phosphate synthase subunit HisF OS=Methylocella silvestris (strain BL2 / DSM 15510 / NCIMB 13906) GN=hisF PE=3 SV=1 | 226 | 541 | 5.0E-40 |
sp|Q7MAS1|HIS6_WOLSU | Imidazole glycerol phosphate synthase subunit HisF OS=Wolinella succinogenes (strain ATCC 29543 / DSM 1740 / LMG 7466 / NCTC 11488 / FDC 602W) GN=hisF PE=3 SV=1 | 226 | 541 | 5.0E-40 |
sp|B3QSI0|HIS6_CHLT3 | Imidazole glycerol phosphate synthase subunit HisF OS=Chloroherpeton thalassium (strain ATCC 35110 / GB-78) GN=hisF PE=3 SV=1 | 226 | 541 | 6.0E-40 |
sp|B2J1A3|HIS5_NOSP7 | Imidazole glycerol phosphate synthase subunit HisH OS=Nostoc punctiforme (strain ATCC 29133 / PCC 73102) GN=hisH PE=3 SV=1 | 1 | 201 | 8.0E-40 |
sp|Q8DJN7|HIS6_THEEB | Imidazole glycerol phosphate synthase subunit HisF OS=Thermosynechococcus elongatus (strain BP-1) GN=hisF PE=3 SV=1 | 226 | 544 | 9.0E-40 |
sp|P74106|HIS6_SYNY3 | Imidazole glycerol phosphate synthase subunit HisF OS=Synechocystis sp. (strain PCC 6803 / Kazusa) GN=hisF PE=3 SV=1 | 226 | 542 | 9.0E-40 |
sp|B0JY78|HIS6_MICAN | Imidazole glycerol phosphate synthase subunit HisF OS=Microcystis aeruginosa (strain NIES-843) GN=hisF PE=3 SV=1 | 226 | 541 | 9.0E-40 |
sp|Q5FTN3|HIS6_GLUOX | Imidazole glycerol phosphate synthase subunit HisF OS=Gluconobacter oxydans (strain 621H) GN=hisF PE=3 SV=1 | 226 | 544 | 1.0E-39 |
sp|B8HUR1|HIS5_CYAP4 | Imidazole glycerol phosphate synthase subunit HisH OS=Cyanothece sp. (strain PCC 7425 / ATCC 29141) GN=hisH PE=3 SV=1 | 1 | 202 | 2.0E-39 |
sp|B6IWI7|HIS6_RHOCS | Imidazole glycerol phosphate synthase subunit HisF OS=Rhodospirillum centenum (strain ATCC 51521 / SW) GN=hisF PE=3 SV=1 | 226 | 541 | 2.0E-39 |
sp|Q7NDC1|HIS6_GLOVI | Imidazole glycerol phosphate synthase subunit HisF OS=Gloeobacter violaceus (strain PCC 7421) GN=hisF PE=3 SV=1 | 226 | 542 | 2.0E-39 |
sp|B1YL09|HIS6_EXIS2 | Imidazole glycerol phosphate synthase subunit HisF OS=Exiguobacterium sibiricum (strain DSM 17290 / JCM 13490 / 255-15) GN=hisF PE=3 SV=1 | 226 | 541 | 3.0E-39 |
sp|P59119|HIS6_LEPIN | Imidazole glycerol phosphate synthase subunit HisF OS=Leptospira interrogans serogroup Icterohaemorrhagiae serovar Lai (strain 56601) GN=hisF PE=3 SV=1 | 224 | 541 | 3.0E-39 |
sp|P62451|HIS6_LEPIC | Imidazole glycerol phosphate synthase subunit HisF OS=Leptospira interrogans serogroup Icterohaemorrhagiae serovar copenhageni (strain Fiocruz L1-130) GN=hisF PE=3 SV=1 | 224 | 541 | 3.0E-39 |
sp|Q7VGZ1|HIS6_HELHP | Imidazole glycerol phosphate synthase subunit HisF OS=Helicobacter hepaticus (strain ATCC 51449 / 3B1) GN=hisF PE=3 SV=1 | 226 | 541 | 3.0E-39 |
sp|A2C0N7|HIS6_PROM1 | Imidazole glycerol phosphate synthase subunit HisF OS=Prochlorococcus marinus (strain NATL1A) GN=hisF PE=3 SV=1 | 229 | 544 | 3.0E-39 |
sp|B0BYP8|HIS5_ACAM1 | Imidazole glycerol phosphate synthase subunit HisH OS=Acaryochloris marina (strain MBIC 11017) GN=hisH PE=3 SV=1 | 1 | 201 | 4.0E-39 |
sp|A8AY24|HIS6_STRGC | Imidazole glycerol phosphate synthase subunit HisF OS=Streptococcus gordonii (strain Challis / ATCC 35105 / CH1 / DL1 / V288) GN=hisF PE=3 SV=1 | 226 | 541 | 5.0E-39 |
sp|Q2JVR1|HIS5_SYNJA | Imidazole glycerol phosphate synthase subunit HisH OS=Synechococcus sp. (strain JA-3-3Ab) GN=hisH PE=3 SV=1 | 6 | 201 | 5.0E-39 |
sp|Q8DIP5|HIS5_THEEB | Imidazole glycerol phosphate synthase subunit HisH OS=Thermosynechococcus elongatus (strain BP-1) GN=hisH PE=3 SV=1 | 2 | 201 | 6.0E-39 |
sp|Q18C74|HIS6_PEPD6 | Imidazole glycerol phosphate synthase subunit HisF OS=Peptoclostridium difficile (strain 630) GN=hisF PE=3 SV=1 | 226 | 541 | 7.0E-39 |
sp|Q5WDI2|HIS6_BACSK | Imidazole glycerol phosphate synthase subunit HisF OS=Bacillus clausii (strain KSM-K16) GN=hisF PE=3 SV=1 | 226 | 541 | 8.0E-39 |
sp|A7Z962|HIS6_BACMF | Imidazole glycerol phosphate synthase subunit HisF OS=Bacillus methylotrophicus (strain DSM 23117 / BGSC 10A6 / FZB42) GN=hisF PE=3 SV=1 | 226 | 541 | 8.0E-39 |
sp|C5BV99|HIS6_BEUC1 | Imidazole glycerol phosphate synthase subunit HisF OS=Beutenbergia cavernae (strain ATCC BAA-8 / DSM 12333 / NBRC 16432) GN=hisF PE=3 SV=1 | 229 | 541 | 8.0E-39 |
sp|B7KPM8|HIS6_METC4 | Imidazole glycerol phosphate synthase subunit HisF OS=Methylobacterium extorquens (strain CM4 / NCIMB 13688) GN=hisF PE=3 SV=1 | 226 | 541 | 9.0E-39 |
sp|B2ICL0|HIS6_BEII9 | Imidazole glycerol phosphate synthase subunit HisF OS=Beijerinckia indica subsp. indica (strain ATCC 9039 / DSM 1715 / NCIB 8712) GN=hisF PE=3 SV=1 | 226 | 551 | 1.0E-38 |
sp|Q3A135|HIS5_PELCD | Imidazole glycerol phosphate synthase subunit HisH OS=Pelobacter carbinolicus (strain DSM 2380 / Gra Bd 1) GN=hisH PE=3 SV=1 | 6 | 200 | 2.0E-38 |
sp|Q64RT2|HIS6_BACFR | Imidazole glycerol phosphate synthase subunit HisF OS=Bacteroides fragilis (strain YCH46) GN=hisF PE=3 SV=1 | 226 | 541 | 2.0E-38 |
sp|A0RRT8|HIS6_CAMFF | Imidazole glycerol phosphate synthase subunit HisF OS=Campylobacter fetus subsp. fetus (strain 82-40) GN=hisF PE=3 SV=1 | 226 | 541 | 2.0E-38 |
sp|A5CRW2|HIS6_CLAM3 | Imidazole glycerol phosphate synthase subunit HisF OS=Clavibacter michiganensis subsp. michiganensis (strain NCPPB 382) GN=hisF PE=3 SV=1 | 226 | 542 | 2.0E-38 |
sp|Q8YX49|HIS5_NOSS1 | Imidazole glycerol phosphate synthase subunit HisH OS=Nostoc sp. (strain PCC 7120 / UTEX 2576) GN=hisH PE=3 SV=1 | 1 | 202 | 3.0E-38 |
sp|B1ZAD6|HIS6_METPB | Imidazole glycerol phosphate synthase subunit HisF OS=Methylobacterium populi (strain ATCC BAA-705 / NCIMB 13946 / BJ001) GN=hisF PE=3 SV=1 | 226 | 541 | 3.0E-38 |
sp|B1H0E6|HIS6_UNCTG | Imidazole glycerol phosphate synthase subunit HisF OS=Uncultured termite group 1 bacterium phylotype Rs-D17 GN=hisF PE=3 SV=1 | 229 | 547 | 3.0E-38 |
sp|A9W5U0|HIS6_METEP | Imidazole glycerol phosphate synthase subunit HisF OS=Methylobacterium extorquens (strain PA1) GN=hisF PE=3 SV=1 | 226 | 541 | 4.0E-38 |
sp|Q5LBD7|HIS6_BACFN | Imidazole glycerol phosphate synthase subunit HisF OS=Bacteroides fragilis (strain ATCC 25285 / DSM 2151 / JCM 11019 / NCTC 9343) GN=hisF PE=3 SV=1 | 226 | 541 | 4.0E-38 |
sp|A6GY75|HIS6_FLAPJ | Imidazole glycerol phosphate synthase subunit HisF OS=Flavobacterium psychrophilum (strain JIP02/86 / ATCC 49511) GN=hisF PE=3 SV=1 | 226 | 541 | 4.0E-38 |
sp|B0SRP0|HIS6_LEPBP | Imidazole glycerol phosphate synthase subunit HisF OS=Leptospira biflexa serovar Patoc (strain Patoc 1 / ATCC 23582 / Paris) GN=hisF PE=3 SV=1 | 226 | 541 | 4.0E-38 |
sp|B0S8V2|HIS6_LEPBA | Imidazole glycerol phosphate synthase subunit HisF OS=Leptospira biflexa serovar Patoc (strain Patoc 1 / Ames) GN=hisF PE=3 SV=1 | 226 | 541 | 4.0E-38 |
sp|B7KGN3|HIS5_CYAP7 | Imidazole glycerol phosphate synthase subunit HisH OS=Cyanothece sp. (strain PCC 7424) GN=hisH PE=3 SV=1 | 1 | 202 | 5.0E-38 |
sp|Q30NR6|HIS6_SULDN | Imidazole glycerol phosphate synthase subunit HisF OS=Sulfurimonas denitrificans (strain ATCC 33889 / DSM 1251) GN=hisF PE=3 SV=1 | 226 | 541 | 5.0E-38 |
sp|A6LT22|HIS6_CLOB8 | Imidazole glycerol phosphate synthase subunit HisF OS=Clostridium beijerinckii (strain ATCC 51743 / NCIMB 8052) GN=hisF PE=3 SV=1 | 227 | 541 | 5.0E-38 |
sp|Q2JN09|HIS5_SYNJB | Imidazole glycerol phosphate synthase subunit HisH OS=Synechococcus sp. (strain JA-2-3B'a(2-13)) GN=hisH PE=3 SV=1 | 6 | 201 | 5.0E-38 |
sp|B2KEU8|HIS6_ELUMP | Imidazole glycerol phosphate synthase subunit HisF OS=Elusimicrobium minutum (strain Pei191) GN=hisF PE=3 SV=1 | 226 | 541 | 5.0E-38 |
sp|B0JFQ9|HIS5_MICAN | Imidazole glycerol phosphate synthase subunit HisH OS=Microcystis aeruginosa (strain NIES-843) GN=hisH PE=3 SV=1 | 1 | 201 | 6.0E-38 |
sp|A5FYE5|HIS6_ACICJ | Imidazole glycerol phosphate synthase subunit HisF OS=Acidiphilium cryptum (strain JF-5) GN=hisF PE=3 SV=1 | 226 | 541 | 7.0E-38 |
sp|Q39YP4|HIS5_GEOMG | Imidazole glycerol phosphate synthase subunit HisH OS=Geobacter metallireducens (strain GS-15 / ATCC 53774 / DSM 7210) GN=hisH PE=3 SV=1 | 1 | 200 | 9.0E-38 |
sp|Q7SIB9|HIS6_THET8 | Imidazole glycerol phosphate synthase subunit HisF OS=Thermus thermophilus (strain HB8 / ATCC 27634 / DSM 579) GN=hisF PE=1 SV=1 | 226 | 541 | 1.0E-37 |
sp|B2GBR5|HIS6_LACF3 | Imidazole glycerol phosphate synthase subunit HisF OS=Lactobacillus fermentum (strain NBRC 3956 / LMG 18251) GN=hisF PE=3 SV=1 | 226 | 541 | 1.0E-37 |
sp|P62453|HIS6_THET2 | Imidazole glycerol phosphate synthase subunit HisF OS=Thermus thermophilus (strain HB27 / ATCC BAA-163 / DSM 7039) GN=hisF PE=3 SV=1 | 226 | 541 | 1.0E-37 |
sp|A2BV90|HIS6_PROM5 | Imidazole glycerol phosphate synthase subunit HisF OS=Prochlorococcus marinus (strain MIT 9515) GN=hisF PE=3 SV=1 | 229 | 544 | 1.0E-37 |
sp|Q1IX39|HIS6_DEIGD | Imidazole glycerol phosphate synthase subunit HisF OS=Deinococcus geothermalis (strain DSM 11300) GN=hisF PE=3 SV=1 | 226 | 541 | 1.0E-37 |
sp|Q28NK0|HIS6_JANSC | Imidazole glycerol phosphate synthase subunit HisF OS=Jannaschia sp. (strain CCS1) GN=hisF PE=3 SV=1 | 226 | 541 | 2.0E-37 |
sp|Q1GEZ3|HIS6_RUEST | Imidazole glycerol phosphate synthase subunit HisF OS=Ruegeria sp. (strain TM1040) GN=hisF PE=3 SV=1 | 226 | 541 | 2.0E-37 |
sp|A7GVW5|HIS6_CAMC5 | Imidazole glycerol phosphate synthase subunit HisF OS=Campylobacter curvus (strain 525.92) GN=hisF PE=3 SV=1 | 226 | 541 | 2.0E-37 |
sp|Q46GY9|HIS6_PROMT | Imidazole glycerol phosphate synthase subunit HisF OS=Prochlorococcus marinus (strain NATL2A) GN=hisF PE=3 SV=1 | 229 | 544 | 3.0E-37 |
sp|Q050D2|HIS6_LEPBL | Imidazole glycerol phosphate synthase subunit HisF OS=Leptospira borgpetersenii serovar Hardjo-bovis (strain L550) GN=hisF PE=3 SV=1 | 224 | 541 | 3.0E-37 |
sp|Q04SA6|HIS6_LEPBJ | Imidazole glycerol phosphate synthase subunit HisF OS=Leptospira borgpetersenii serovar Hardjo-bovis (strain JB197) GN=hisF PE=3 SV=1 | 224 | 541 | 3.0E-37 |
sp|Q6F7A7|HIS5_ACIAD | Imidazole glycerol phosphate synthase subunit HisH OS=Acinetobacter baylyi (strain ATCC 33305 / BD413 / ADP1) GN=hisH PE=3 SV=1 | 1 | 201 | 4.0E-37 |
sp|B6YQ30|HIS6_AZOPC | Imidazole glycerol phosphate synthase subunit HisF OS=Azobacteroides pseudotrichonymphae genomovar. CFP2 GN=hisF PE=3 SV=1 | 226 | 542 | 5.0E-37 |
sp|Q5NMD6|HIS6_ZYMMO | Imidazole glycerol phosphate synthase subunit HisF OS=Zymomonas mobilis subsp. mobilis (strain ATCC 31821 / ZM4 / CP4) GN=hisF PE=3 SV=1 | 226 | 542 | 5.0E-37 |
sp|A6L6Z2|HIS6_BACV8 | Imidazole glycerol phosphate synthase subunit HisF OS=Bacteroides vulgatus (strain ATCC 8482 / DSM 1447 / NCTC 11154) GN=hisF PE=3 SV=1 | 226 | 541 | 5.0E-37 |
sp|A8G3E4|HIS6_PROM2 | Imidazole glycerol phosphate synthase subunit HisF OS=Prochlorococcus marinus (strain MIT 9215) GN=hisF PE=3 SV=1 | 229 | 544 | 6.0E-37 |
sp|Q9X0C6|HIS6_THEMA | Imidazole glycerol phosphate synthase subunit HisF OS=Thermotoga maritima (strain ATCC 43589 / MSB8 / DSM 3109 / JCM 10099) GN=hisF PE=1 SV=1 | 226 | 541 | 7.0E-37 |
sp|B8IPH3|HIS6_METNO | Imidazole glycerol phosphate synthase subunit HisF OS=Methylobacterium nodulans (strain ORS2060 / LMG 21967) GN=hisF PE=3 SV=1 | 226 | 541 | 9.0E-37 |
sp|Q113E7|HIS5_TRIEI | Imidazole glycerol phosphate synthase subunit HisH OS=Trichodesmium erythraeum (strain IMS101) GN=hisH PE=3 SV=1 | 1 | 213 | 1.0E-36 |
sp|A2BPR2|HIS6_PROMS | Imidazole glycerol phosphate synthase subunit HisF OS=Prochlorococcus marinus (strain AS9601) GN=hisF PE=3 SV=1 | 229 | 544 | 1.0E-36 |
sp|B1L873|HIS6_THESQ | Imidazole glycerol phosphate synthase subunit HisF OS=Thermotoga sp. (strain RQ2) GN=hisF PE=3 SV=1 | 226 | 541 | 1.0E-36 |
sp|A5FFX6|HIS6_FLAJ1 | Imidazole glycerol phosphate synthase subunit HisF OS=Flavobacterium johnsoniae (strain ATCC 17061 / DSM 2064 / UW101) GN=hisF PE=3 SV=1 | 226 | 541 | 1.0E-36 |
sp|Q9RX89|HIS5_DEIRA | Imidazole glycerol phosphate synthase subunit HisH OS=Deinococcus radiodurans (strain ATCC 13939 / DSM 20539 / JCM 16871 / LMG 4051 / NBRC 15346 / NCIMB 9279 / R1 / VKM B-1422) GN=hisH PE=3 SV=1 | 2 | 200 | 1.0E-36 |
sp|B0T798|HIS6_CAUSK | Imidazole glycerol phosphate synthase subunit HisF OS=Caulobacter sp. (strain K31) GN=hisF PE=3 SV=1 | 226 | 541 | 1.0E-36 |
sp|Q2S295|HIS6_SALRD | Imidazole glycerol phosphate synthase subunit HisF OS=Salinibacter ruber (strain DSM 13855 / M31) GN=hisF PE=3 SV=1 | 226 | 541 | 1.0E-36 |
sp|A8LHX5|HIS6_DINSH | Imidazole glycerol phosphate synthase subunit HisF OS=Dinoroseobacter shibae (strain DSM 16493 / NCIMB 14021 / DFL 12) GN=hisF PE=3 SV=1 | 226 | 541 | 1.0E-36 |
sp|A1W0U9|HIS51_CAMJJ | Imidazole glycerol phosphate synthase subunit HisH 1 OS=Campylobacter jejuni subsp. jejuni serotype O:23/36 (strain 81-176) GN=hisH1 PE=3 SV=1 | 3 | 200 | 2.0E-36 |
sp|Q9K6Z6|HIS6_BACHD | Imidazole glycerol phosphate synthase subunit HisF OS=Bacillus halodurans (strain ATCC BAA-125 / DSM 18197 / FERM 7344 / JCM 9153 / C-125) GN=hisF PE=3 SV=1 | 226 | 541 | 2.0E-36 |
sp|A1B388|HIS6_PARDP | Imidazole glycerol phosphate synthase subunit HisF OS=Paracoccus denitrificans (strain Pd 1222) GN=hisF PE=3 SV=1 | 226 | 541 | 2.0E-36 |
sp|Q3J6Q3|HIS5_NITOC | Imidazole glycerol phosphate synthase subunit HisH OS=Nitrosococcus oceani (strain ATCC 19707 / NCIMB 11848) GN=hisH PE=3 SV=1 | 1 | 207 | 2.0E-36 |
sp|B8E2C8|HIS6_DICTD | Imidazole glycerol phosphate synthase subunit HisF OS=Dictyoglomus turgidum (strain Z-1310 / DSM 6724) GN=hisF PE=3 SV=1 | 226 | 541 | 2.0E-36 |
sp|A6WX52|HIS6_OCHA4 | Imidazole glycerol phosphate synthase subunit HisF OS=Ochrobactrum anthropi (strain ATCC 49188 / DSM 6882 / NCTC 12168) GN=hisF PE=3 SV=1 | 226 | 541 | 3.0E-36 |
sp|Q5HT90|HIS51_CAMJR | Imidazole glycerol phosphate synthase subunit HisH 1 OS=Campylobacter jejuni (strain RM1221) GN=hisH1 PE=3 SV=1 | 3 | 201 | 3.0E-36 |
sp|Q8A7Z6|HIS6_BACTN | Imidazole glycerol phosphate synthase subunit HisF OS=Bacteroides thetaiotaomicron (strain ATCC 29148 / DSM 2079 / NCTC 10582 / E50 / VPI-5482) GN=hisF PE=3 SV=1 | 226 | 541 | 4.0E-36 |
sp|A8LX55|HIS6_SALAI | Imidazole glycerol phosphate synthase subunit HisF OS=Salinispora arenicola (strain CNS-205) GN=hisF PE=3 SV=1 | 226 | 541 | 4.0E-36 |
sp|Q31CA5|HIS6_PROM9 | Imidazole glycerol phosphate synthase subunit HisF OS=Prochlorococcus marinus (strain MIT 9312) GN=hisF PE=3 SV=1 | 229 | 544 | 5.0E-36 |
sp|Q162Q1|HIS6_ROSDO | Imidazole glycerol phosphate synthase subunit HisF OS=Roseobacter denitrificans (strain ATCC 33942 / OCh 114) GN=hisF PE=3 SV=1 | 226 | 541 | 5.0E-36 |
sp|Q9A229|HIS6_CAUCR | Imidazole glycerol phosphate synthase subunit HisF OS=Caulobacter crescentus (strain ATCC 19089 / CB15) GN=hisF PE=3 SV=1 | 226 | 541 | 6.0E-36 |
sp|B8GW15|HIS6_CAUCN | Imidazole glycerol phosphate synthase subunit HisF OS=Caulobacter crescentus (strain NA1000 / CB15N) GN=hisF PE=3 SV=1 | 226 | 541 | 6.0E-36 |
sp|Q0P8U2|HIS51_CAMJE | Imidazole glycerol phosphate synthase subunit HisH 1 OS=Campylobacter jejuni subsp. jejuni serotype O:2 (strain ATCC 700819 / NCTC 11168) GN=hisH1 PE=1 SV=1 | 3 | 200 | 6.0E-36 |
sp|A9GZW9|HIS6_GLUDA | Imidazole glycerol phosphate synthase subunit HisF OS=Gluconacetobacter diazotrophicus (strain ATCC 49037 / DSM 5601 / PAl5) GN=hisF PE=3 SV=1 | 226 | 542 | 6.0E-36 |
sp|A5INE6|HIS6_THEP1 | Imidazole glycerol phosphate synthase subunit HisF OS=Thermotoga petrophila (strain RKU-1 / ATCC BAA-488 / DSM 13995) GN=hisF PE=3 SV=1 | 226 | 541 | 1.0E-35 |
sp|Q5LU99|HIS6_RUEPO | Imidazole glycerol phosphate synthase subunit HisF OS=Ruegeria pomeroyi (strain ATCC 700808 / DSM 15171 / DSS-3) GN=hisF PE=3 SV=1 | 226 | 541 | 1.0E-35 |
sp|A4WUS8|HIS6_RHOS5 | Imidazole glycerol phosphate synthase subunit HisF OS=Rhodobacter sphaeroides (strain ATCC 17025 / ATH 2.4.3) GN=hisF PE=3 SV=1 | 226 | 541 | 1.0E-35 |
sp|P60599|HIS5_GEOSL | Imidazole glycerol phosphate synthase subunit HisH OS=Geobacter sulfurreducens (strain ATCC 51573 / DSM 12127 / PCA) GN=hisH PE=3 SV=1 | 1 | 200 | 1.0E-35 |
sp|Q03VY0|HIS6_LEUMM | Imidazole glycerol phosphate synthase subunit HisF OS=Leuconostoc mesenteroides subsp. mesenteroides (strain ATCC 8293 / NCDO 523) GN=hisF PE=3 SV=1 | 226 | 541 | 1.0E-35 |
sp|B1LUA2|HIS6_METRJ | Imidazole glycerol phosphate synthase subunit HisF OS=Methylobacterium radiotolerans (strain ATCC 27329 / DSM 1819 / JCM 2831) GN=hisF PE=3 SV=1 | 226 | 541 | 1.0E-35 |
sp|A6LDI7|HIS6_PARD8 | Imidazole glycerol phosphate synthase subunit HisF OS=Parabacteroides distasonis (strain ATCC 8503 / DSM 20701 / NCTC 11152) GN=hisF PE=3 SV=1 | 226 | 541 | 1.0E-35 |
sp|C3MBC1|HIS6_RHISN | Imidazole glycerol phosphate synthase subunit HisF OS=Rhizobium sp. (strain NGR234) GN=hisF PE=3 SV=1 | 226 | 541 | 2.0E-35 |
sp|P45603|HIS6_KLEOX | Imidazole glycerol phosphate synthase subunit HisF OS=Klebsiella oxytoca GN=hisF PE=3 SV=1 | 226 | 541 | 2.0E-35 |
sp|A0M283|HIS6_GRAFK | Imidazole glycerol phosphate synthase subunit HisF OS=Gramella forsetii (strain KT0803) GN=hisF PE=3 SV=1 | 226 | 541 | 2.0E-35 |
sp|Q2VYJ0|HIS6_MAGSA | Imidazole glycerol phosphate synthase subunit HisF OS=Magnetospirillum magneticum (strain AMB-1 / ATCC 700264) GN=hisF PE=3 SV=1 | 226 | 541 | 2.0E-35 |
sp|A5V9W0|HIS6_SPHWW | Imidazole glycerol phosphate synthase subunit HisF OS=Sphingomonas wittichii (strain RW1 / DSM 6014 / JCM 10273) GN=hisF PE=3 SV=1 | 229 | 542 | 2.0E-35 |
sp|Q7ULP3|HIS5_RHOBA | Imidazole glycerol phosphate synthase subunit HisH OS=Rhodopirellula baltica (strain DSM 10527 / NCIMB 13988 / SH1) GN=hisH PE=3 SV=1 | 4 | 202 | 2.0E-35 |
sp|B5YE90|HIS6_DICT6 | Imidazole glycerol phosphate synthase subunit HisF OS=Dictyoglomus thermophilum (strain ATCC 35947 / DSM 3960 / H-6-12) GN=hisF PE=3 SV=1 | 226 | 541 | 2.0E-35 |
sp|C5BG16|HIS6_EDWI9 | Imidazole glycerol phosphate synthase subunit HisF OS=Edwardsiella ictaluri (strain 93-146) GN=hisF PE=3 SV=1 | 226 | 541 | 2.0E-35 |
sp|Q8YE37|HIS6_BRUME | Imidazole glycerol phosphate synthase subunit HisF OS=Brucella melitensis biotype 1 (strain 16M / ATCC 23456 / NCTC 10094) GN=hisF PE=3 SV=1 | 226 | 541 | 3.0E-35 |
sp|C0RFX3|HIS6_BRUMB | Imidazole glycerol phosphate synthase subunit HisF OS=Brucella melitensis biotype 2 (strain ATCC 23457) GN=hisF PE=3 SV=1 | 226 | 541 | 3.0E-35 |
sp|B0UHR5|HIS6_METS4 | Imidazole glycerol phosphate synthase subunit HisF OS=Methylobacterium sp. (strain 4-46) GN=hisF PE=3 SV=1 | 226 | 541 | 3.0E-35 |
sp|A7HSH0|HIS6_PARL1 | Imidazole glycerol phosphate synthase subunit HisF OS=Parvibaculum lavamentivorans (strain DS-1 / DSM 13023 / NCIMB 13966) GN=hisF PE=3 SV=1 | 226 | 541 | 3.0E-35 |
sp|Q7SIC0|HIS5_THET8 | Imidazole glycerol phosphate synthase subunit HisH OS=Thermus thermophilus (strain HB8 / ATCC 27634 / DSM 579) GN=hisH PE=1 SV=1 | 6 | 194 | 3.0E-35 |
sp|Q8FY07|HIS6_BRUSU | Imidazole glycerol phosphate synthase subunit HisF OS=Brucella suis biovar 1 (strain 1330) GN=hisF PE=3 SV=1 | 226 | 541 | 4.0E-35 |
sp|B0CJI6|HIS6_BRUSI | Imidazole glycerol phosphate synthase subunit HisF OS=Brucella suis (strain ATCC 23445 / NCTC 10510) GN=hisF PE=3 SV=1 | 226 | 541 | 4.0E-35 |
sp|A5VT43|HIS6_BRUO2 | Imidazole glycerol phosphate synthase subunit HisF OS=Brucella ovis (strain ATCC 25840 / 63/290 / NCTC 10512) GN=hisF PE=3 SV=1 | 226 | 541 | 4.0E-35 |
sp|A9M9R9|HIS6_BRUC2 | Imidazole glycerol phosphate synthase subunit HisF OS=Brucella canis (strain ATCC 23365 / NCTC 10854) GN=hisF PE=3 SV=1 | 226 | 541 | 4.0E-35 |
sp|Q57AH3|HIS6_BRUAB | Imidazole glycerol phosphate synthase subunit HisF OS=Brucella abortus biovar 1 (strain 9-941) GN=hisF PE=3 SV=1 | 226 | 541 | 4.0E-35 |
sp|Q2YQY8|HIS6_BRUA2 | Imidazole glycerol phosphate synthase subunit HisF OS=Brucella abortus (strain 2308) GN=hisF PE=3 SV=1 | 226 | 541 | 4.0E-35 |
sp|B2S984|HIS6_BRUA1 | Imidazole glycerol phosphate synthase subunit HisF OS=Brucella abortus (strain S19) GN=hisF PE=3 SV=1 | 226 | 541 | 4.0E-35 |
sp|P61781|HIS5_THET2 | Imidazole glycerol phosphate synthase subunit HisH OS=Thermus thermophilus (strain HB27 / ATCC BAA-163 / DSM 7039) GN=hisH PE=3 SV=1 | 6 | 194 | 4.0E-35 |
sp|Q2RNA7|HIS6_RHORT | Imidazole glycerol phosphate synthase subunit HisF OS=Rhodospirillum rubrum (strain ATCC 11170 / ATH 1.1.1 / DSM 467 / LMG 4362 / NCIB 8255 / S1) GN=hisF PE=3 SV=1 | 226 | 541 | 4.0E-35 |
sp|A4X9P7|HIS6_SALTO | Imidazole glycerol phosphate synthase subunit HisF OS=Salinispora tropica (strain ATCC BAA-916 / DSM 44818 / CNB-440) GN=hisF PE=3 SV=1 | 226 | 541 | 6.0E-35 |
sp|B4ESZ8|HIS6_PROMH | Imidazole glycerol phosphate synthase subunit HisF OS=Proteus mirabilis (strain HI4320) GN=hisF PE=3 SV=1 | 226 | 541 | 6.0E-35 |
sp|O30724|HIS6_RHOCB | Imidazole glycerol phosphate synthase subunit HisF OS=Rhodobacter capsulatus (strain ATCC BAA-309 / NBRC 16581 / SB1003) GN=hisF PE=3 SV=2 | 226 | 541 | 8.0E-35 |
sp|Q5N0H4|HIS6_SYNP6 | Imidazole glycerol phosphate synthase subunit HisF OS=Synechococcus sp. (strain ATCC 27144 / PCC 6301 / SAUG 1402/1) GN=hisF PE=3 SV=1 | 226 | 541 | 1.0E-34 |
sp|A3PBF2|HIS6_PROM0 | Imidazole glycerol phosphate synthase subunit HisF OS=Prochlorococcus marinus (strain MIT 9301) GN=hisF PE=3 SV=1 | 229 | 544 | 1.0E-34 |
sp|Q11CK7|HIS6_CHESB | Imidazole glycerol phosphate synthase subunit HisF OS=Chelativorans sp. (strain BNC1) GN=hisF PE=3 SV=1 | 226 | 541 | 1.0E-34 |
sp|P59118|HIS5_LEPIN | Imidazole glycerol phosphate synthase subunit HisH OS=Leptospira interrogans serogroup Icterohaemorrhagiae serovar Lai (strain 56601) GN=hisH PE=3 SV=1 | 6 | 201 | 2.0E-34 |
sp|P61780|HIS5_LEPIC | Imidazole glycerol phosphate synthase subunit HisH OS=Leptospira interrogans serogroup Icterohaemorrhagiae serovar copenhageni (strain Fiocruz L1-130) GN=hisH PE=3 SV=1 | 6 | 201 | 2.0E-34 |
sp|Q7VDF1|HIS6_PROMA | Imidazole glycerol phosphate synthase subunit HisF OS=Prochlorococcus marinus (strain SARG / CCMP1375 / SS120) GN=hisF PE=3 SV=1 | 229 | 541 | 2.0E-34 |
sp|Q7NNK4|HIS5_GLOVI | Imidazole glycerol phosphate synthase subunit HisH OS=Gloeobacter violaceus (strain PCC 7421) GN=hisH PE=3 SV=1 | 2 | 208 | 3.0E-34 |
sp|C3LLI5|HIS6_VIBCM | Imidazole glycerol phosphate synthase subunit HisF OS=Vibrio cholerae serotype O1 (strain M66-2) GN=hisF PE=3 SV=1 | 226 | 542 | 3.0E-34 |
sp|Q9KSW8|HIS6_VIBCH | Imidazole glycerol phosphate synthase subunit HisF OS=Vibrio cholerae serotype O1 (strain ATCC 39315 / El Tor Inaba N16961) GN=hisF PE=3 SV=1 | 226 | 542 | 3.0E-34 |
sp|A5F289|HIS6_VIBC3 | Imidazole glycerol phosphate synthase subunit HisF OS=Vibrio cholerae serotype O1 (strain ATCC 39541 / Classical Ogawa 395 / O395) GN=hisF PE=3 SV=1 | 226 | 542 | 3.0E-34 |
sp|A7ZNJ7|HIS6_ECO24 | Imidazole glycerol phosphate synthase subunit HisF OS=Escherichia coli O139:H28 (strain E24377A / ETEC) GN=hisF PE=3 SV=1 | 226 | 541 | 4.0E-34 |
sp|B3GZH3|HIS6_ACTP7 | Imidazole glycerol phosphate synthase subunit HisF OS=Actinobacillus pleuropneumoniae serotype 7 (strain AP76) GN=hisF PE=3 SV=1 | 226 | 542 | 4.0E-34 |
sp|A8AEJ9|HIS6_CITK8 | Imidazole glycerol phosphate synthase subunit HisF OS=Citrobacter koseri (strain ATCC BAA-895 / CDC 4225-83 / SGSC4696) GN=hisF PE=3 SV=1 | 226 | 541 | 4.0E-34 |
sp|Q7N6I5|HIS6_PHOLL | Imidazole glycerol phosphate synthase subunit HisF OS=Photorhabdus luminescens subsp. laumondii (strain TT01) GN=hisF PE=3 SV=1 | 226 | 541 | 4.0E-34 |
sp|A7I416|HIS6_CAMHC | Imidazole glycerol phosphate synthase subunit HisF OS=Campylobacter hominis (strain ATCC BAA-381 / LMG 19568 / NCTC 13146 / CH001A) GN=hisF PE=3 SV=1 | 224 | 541 | 5.0E-34 |
sp|Q0C643|HIS6_HYPNA | Imidazole glycerol phosphate synthase subunit HisF OS=Hyphomonas neptunium (strain ATCC 15444) GN=hisF PE=3 SV=1 | 226 | 522 | 5.0E-34 |
sp|B9KPC8|HIS6_RHOSK | Imidazole glycerol phosphate synthase subunit HisF OS=Rhodobacter sphaeroides (strain KD131 / KCTC 12085) GN=hisF PE=3 SV=1 | 226 | 541 | 5.0E-34 |
sp|Q92TB3|HIS6_RHIME | Imidazole glycerol phosphate synthase subunit HisF OS=Rhizobium meliloti (strain 1021) GN=hisF PE=3 SV=1 | 226 | 541 | 6.0E-34 |
sp|B5XPE2|HIS6_KLEP3 | Imidazole glycerol phosphate synthase subunit HisF OS=Klebsiella pneumoniae (strain 342) GN=hisF PE=3 SV=1 | 226 | 541 | 6.0E-34 |
sp|A6UEK3|HIS6_SINMW | Imidazole glycerol phosphate synthase subunit HisF OS=Sinorhizobium medicae (strain WSM419) GN=hisF PE=3 SV=1 | 226 | 541 | 7.0E-34 |
sp|Q7V2P2|HIS6_PROMP | Imidazole glycerol phosphate synthase subunit HisF OS=Prochlorococcus marinus subsp. pastoris (strain CCMP1986 / MED4) GN=hisF PE=3 SV=1 | 229 | 541 | 8.0E-34 |
GO Term | Description | Terminal node |
---|---|---|
GO:0042823 | pyridoxal phosphate biosynthetic process | Yes |
GO:0000105 | histidine biosynthetic process | Yes |
GO:0004359 | glutaminase activity | Yes |
GO:0042819 | vitamin B6 biosynthetic process | Yes |
GO:0019637 | organophosphate metabolic process | No |
GO:0019438 | aromatic compound biosynthetic process | No |
GO:0006807 | nitrogen compound metabolic process | No |
GO:0018130 | heterocycle biosynthetic process | No |
GO:0016811 | hydrolase activity, acting on carbon-nitrogen (but not peptide) bonds, in linear amides | No |
GO:0006081 | cellular aldehyde metabolic process | No |
GO:0006796 | phosphate-containing compound metabolic process | No |
GO:0043436 | oxoacid metabolic process | No |
GO:0008652 | cellular amino acid biosynthetic process | No |
GO:1901576 | organic substance biosynthetic process | No |
GO:0006520 | cellular amino acid metabolic process | No |
GO:0072525 | pyridine-containing compound biosynthetic process | No |
GO:0046394 | carboxylic acid biosynthetic process | No |
GO:0034641 | cellular nitrogen compound metabolic process | No |
GO:0006793 | phosphorus metabolic process | No |
GO:0042364 | water-soluble vitamin biosynthetic process | No |
GO:0003674 | molecular_function | No |
GO:0016787 | hydrolase activity | No |
GO:0008150 | biological_process | No |
GO:0090407 | organophosphate biosynthetic process | No |
GO:0006082 | organic acid metabolic process | No |
GO:0019752 | carboxylic acid metabolic process | No |
GO:0006766 | vitamin metabolic process | No |
GO:0006725 | cellular aromatic compound metabolic process | No |
GO:0042816 | vitamin B6 metabolic process | No |
GO:0008152 | metabolic process | No |
GO:1901617 | organic hydroxy compound biosynthetic process | No |
GO:0046184 | aldehyde biosynthetic process | No |
GO:0006767 | water-soluble vitamin metabolic process | No |
GO:0009110 | vitamin biosynthetic process | No |
GO:0046483 | heterocycle metabolic process | No |
GO:1901615 | organic hydroxy compound metabolic process | No |
GO:1901564 | organonitrogen compound metabolic process | No |
GO:0009058 | biosynthetic process | No |
GO:0044238 | primary metabolic process | No |
GO:0042822 | pyridoxal phosphate metabolic process | No |
GO:0009987 | cellular process | No |
GO:1901362 | organic cyclic compound biosynthetic process | No |
GO:1901360 | organic cyclic compound metabolic process | No |
GO:0016053 | organic acid biosynthetic process | No |
GO:1901566 | organonitrogen compound biosynthetic process | No |
GO:0044237 | cellular metabolic process | No |
GO:0044281 | small molecule metabolic process | No |
GO:0071704 | organic substance metabolic process | No |
GO:0044283 | small molecule biosynthetic process | No |
GO:0044249 | cellular biosynthetic process | No |
GO:0016810 | hydrolase activity, acting on carbon-nitrogen (but not peptide) bonds | No |
GO:0003824 | catalytic activity | No |
GO:0044271 | cellular nitrogen compound biosynthetic process | No |
GO:0006547 | histidine metabolic process | No |
GO:0072524 | pyridine-containing compound metabolic process | No |
SignalP signal predicted | Location (based on Ymax) |
D score (significance: > 0.45) |
---|---|---|
No | 1 - 21 | 0.45 |
Type of sequence | Sequence |
---|---|
Locus | Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded. |
Protein | >OphauB2|7336 MPTVHLLDYVAGNIHSLVNAIEKLGYSVEWIKSPQDVSKAQKLILPGVGHFGHCLSQLDRAGFLPAIKAHIDSGK PFMGICVGLQALFEGSLEDSAVPGLGIIAGCLGRFDDAQKSVPHIGWNSASSSMYQLSPASKYYYVHTYRFPYVE GQLEAQGWSVATATYGSETFVGAVAKGNVYATQFHPEKSGVAGLRTIGAFLTGEGAASLGNASANGSANKTLSSG LTRRVIACLDVRANDQGDLVVTKGDQYDVRLKSSDRSVRNLGKPVELARRYYNDGADEVTFLNITSFRDCPAADL PMLEVLRQTSATVFVPLTIGGGIRDTVDPDGSTLSALDIASLYFRSGADKVSIGSDAVAAAEQYYASGRRLTGST AIEQISRAYGNQAVVVSIDPRRVYLDSPDSCPRHRQHVIETCFPGPAGERFCWYVCTVRGGRETRDLDVVELAQA VQAMGAGELLLNSIDRDGSNSGFDLELIAQVKACVKIPVIASSGAGNPSHFEQVFTQTSTDAALGAGIFHRGEYS VRQVKDYLSSKGLLVRQFEGDLDTHAVAIQS* |
Coding | >OphauB2|7336 ATGCCTACGGTCCATTTGCTAGACTACGTCGCCGGCAACATCCACAGCCTCGTCAATGCCATTGAGAAGCTAGGC TACAGCGTCGAGTGGATAAAGTCGCCCCAAGATGTTTCCAAGGCTCAAAAACTCATCCTCCCCGGCGTCGGCCAC TTTGGCCATTGTCTCTCGCAGCTAGACCGCGCCGGCTTCCTCCCTGCAATCAAGGCTCACATTGACAGCGGGAAG CCCTTTATGGGCATCTGCGTCGGCCTGCAGGCTCTCTTTGAAGGCTCGCTGGAAGACTCAGCCGTGCCTGGGCTG GGCATCATTGCCGGCTGTCTGGGTCGCTTTGATGACGCTCAAAAGTCGGTTCCTCATATTGGCTGGAACAGCGCC TCCAGCTCCATGTATCAGCTCAGCCCGGCTTCCAAATACTACTATGTCCATACCTATCGCTTCCCCTACGTCGAG GGCCAGCTCGAGGCCCAGGGCTGGTCCGTCGCCACGGCCACGTATGGCTCAGAGACGTTTGTCGGCGCCGTCGCA AAGGGCAATGTCTACGCCACCCAGTTCCACCCTGAAAAGTCTGGCGTCGCCGGCCTGCGCACCATTGGCGCCTTT TTGACGGGCGAGGGCGCCGCTTCCCTGGGCAATGCGTCTGCCAATGGCTCGGCCAACAAGACGCTCTCCTCGGGC CTGACACGCCGCGTCATTGCCTGTCTCGACGTCCGCGCCAATGACCAAGGCGACCTCGTCGTCACAAAGGGCGAC CAGTACGACGTGCGCCTCAAATCCTCTGACCGCTCCGTCCGCAACCTCGGCAAGCCCGTCGAGCTTGCCCGCCGC TACTACAATGACGGCGCCGACGAAGTCACCTTTCTCAACATCACCTCGTTTCGCGACTGTCCCGCTGCCGACTTG CCCATGCTCGAGGTTCTCCGTCAAACATCTGCCACCGTCTTTGTGCCCCTGACGATTGGCGGCGGCATTCGCGAT ACTGTCGACCCCGACGGCTCAACCCTCTCCGCCCTCGACATTGCCTCGCTCTACTTCCGCTCCGGCGCCGACAAG GTGTCGATTGGCTCCGACGCCGTGGCCGCCGCAGAGCAATACTACGCCTCTGGCCGTCGTCTCACCGGCTCCACC GCCATTGAGCAAATCTCGCGCGCCTACGGCAACCAAGCCGTCGTTGTCAGCATCGATCCCCGCCGCGTCTACCTC GATAGCCCCGACTCTTGTCCCCGTCACCGGCAGCACGTCATCGAGACTTGTTTTCCCGGCCCGGCTGGCGAGCGC TTTTGCTGGTACGTCTGCACCGTCCGCGGCGGTCGCGAGACGCGTGATCTGGACGTGGTTGAGCTCGCCCAGGCT GTCCAAGCCATGGGTGCCGGCGAGCTCCTCCTCAACTCGATTGACCGTGACGGCTCAAACTCGGGCTTTGATCTC GAGCTCATTGCCCAGGTCAAGGCTTGTGTCAAAATCCCCGTCATTGCCTCGAGTGGTGCTGGCAACCCATCCCAC TTTGAACAAGTCTTTACACAAACTTCAACCGACGCTGCCCTCGGTGCCGGCATCTTCCACCGTGGAGAGTACAGC GTCAGACAGGTCAAGGATTATCTCAGCTCCAAGGGGCTTCTTGTGCGTCAGTTTGAGGGCGATTTGGATACTCAT GCTGTTGCAATACAATCATAG |
Transcript | >OphauB2|7336 ATGCCTACGGTCCATTTGCTAGACTACGTCGCCGGCAACATCCACAGCCTCGTCAATGCCATTGAGAAGCTAGGC TACAGCGTCGAGTGGATAAAGTCGCCCCAAGATGTTTCCAAGGCTCAAAAACTCATCCTCCCCGGCGTCGGCCAC TTTGGCCATTGTCTCTCGCAGCTAGACCGCGCCGGCTTCCTCCCTGCAATCAAGGCTCACATTGACAGCGGGAAG CCCTTTATGGGCATCTGCGTCGGCCTGCAGGCTCTCTTTGAAGGCTCGCTGGAAGACTCAGCCGTGCCTGGGCTG GGCATCATTGCCGGCTGTCTGGGTCGCTTTGATGACGCTCAAAAGTCGGTTCCTCATATTGGCTGGAACAGCGCC TCCAGCTCCATGTATCAGCTCAGCCCGGCTTCCAAATACTACTATGTCCATACCTATCGCTTCCCCTACGTCGAG GGCCAGCTCGAGGCCCAGGGCTGGTCCGTCGCCACGGCCACGTATGGCTCAGAGACGTTTGTCGGCGCCGTCGCA AAGGGCAATGTCTACGCCACCCAGTTCCACCCTGAAAAGTCTGGCGTCGCCGGCCTGCGCACCATTGGCGCCTTT TTGACGGGCGAGGGCGCCGCTTCCCTGGGCAATGCGTCTGCCAATGGCTCGGCCAACAAGACGCTCTCCTCGGGC CTGACACGCCGCGTCATTGCCTGTCTCGACGTCCGCGCCAATGACCAAGGCGACCTCGTCGTCACAAAGGGCGAC CAGTACGACGTGCGCCTCAAATCCTCTGACCGCTCCGTCCGCAACCTCGGCAAGCCCGTCGAGCTTGCCCGCCGC TACTACAATGACGGCGCCGACGAAGTCACCTTTCTCAACATCACCTCGTTTCGCGACTGTCCCGCTGCCGACTTG CCCATGCTCGAGGTTCTCCGTCAAACATCTGCCACCGTCTTTGTGCCCCTGACGATTGGCGGCGGCATTCGCGAT ACTGTCGACCCCGACGGCTCAACCCTCTCCGCCCTCGACATTGCCTCGCTCTACTTCCGCTCCGGCGCCGACAAG GTGTCGATTGGCTCCGACGCCGTGGCCGCCGCAGAGCAATACTACGCCTCTGGCCGTCGTCTCACCGGCTCCACC GCCATTGAGCAAATCTCGCGCGCCTACGGCAACCAAGCCGTCGTTGTCAGCATCGATCCCCGCCGCGTCTACCTC GATAGCCCCGACTCTTGTCCCCGTCACCGGCAGCACGTCATCGAGACTTGTTTTCCCGGCCCGGCTGGCGAGCGC TTTTGCTGGTACGTCTGCACCGTCCGCGGCGGTCGCGAGACGCGTGATCTGGACGTGGTTGAGCTCGCCCAGGCT GTCCAAGCCATGGGTGCCGGCGAGCTCCTCCTCAACTCGATTGACCGTGACGGCTCAAACTCGGGCTTTGATCTC GAGCTCATTGCCCAGGTCAAGGCTTGTGTCAAAATCCCCGTCATTGCCTCGAGTGGTGCTGGCAACCCATCCCAC TTTGAACAAGTCTTTACACAAACTTCAACCGACGCTGCCCTCGGTGCCGGCATCTTCCACCGTGGAGAGTACAGC GTCAGACAGGTCAAGGATTATCTCAGCTCCAAGGGGCTTCTTGTGCGTCAGTTTGAGGGCGATTTGGATACTCAT GCTGTTGCAATACAATCATAG |
Gene | >OphauB2|7336 ATGCCTACGGTCCATTTGCTAGACTACGTCGCCGGCAACATCCACAGCCTCGTCAATGCCATTGAGAAGCTAGGC TACAGCGTCGAGTGGATAAAGTCGCCCCAAGATGTTTCCAAGGCTCAAGTCGGCCACCCCTTGTTTGCTCCTTGT CCGTCAATATCCAGTCTTTGCCTTCTGACTTTGGTCTGCAGAAACTCATCCTCCCCGGCGTCGGCCACTTTGGCC ATTGTCTCTCGCAGCTAGACCGCGCCGGCTTCCTCCCTGCAATCAAGGCTCACATTGACAGCGGGAAGCCCTTTA TGGGCATCTGCGTCGGCCTGCAGGCTCTCTTTGAAGGCTCGCTGGAAGACTCAGCCGTGCCTGGGCTGGGCATCA TTGCCGGCTGTCTGGGTCGCTTTGATGACGCTCAAAAGTCGGTTCCTCATATTGGCTGGAACAGCGCCTCCAGCT CCATGTATCAGCTCAGCCCGGCTTCCAAATACTACTATGTCCATACCTATCGCTTCCCCTACGTCGAGGGCCAGC TCGAGGCCCAGGGCTGGTCCGTCGCCACGGCCACGTATGGCTCAGAGACGTTTGTCGGCGCCGTCGCAAAGGGCA ATGTCTACGCCACCCAGTTCCACCCTGAAAAGTCTGGCGTCGCCGGCCTGCGCACCATTGGCGCCTTTTTGACGG GCGAGGGCGCCGCTTCCCTGGGCAATGCGTCTGCCAATGGCTCGGCCAACAAGACGCTCTCCTCGGGCCTGACAC GCCGCGTCATTGCCTGTCTCGACGTCCGCGCCAATGACCAAGGCGACCTCGTCGTCACAAAGGGCGACCAGTACG ACGTGCGCCTCAAATCCTCTGACCGCTCCGTCCGCAACCTCGGCAAGCCCGTCGAGCTTGCCCGCCGCTACTACA ATGACGGCGCCGACGAAGTCACCTTTCTCAACATCACCTCGTTTCGCGACTGTCCCGCTGCCGACTTGCCCATGC TCGAGGTTCTCCGTCAAACATCTGCCACCGTCTTTGTGCCCCTGACGATTGGCGGCGGCATTCGCGATACTGTCG ACCCCGACGGCTCAACCCTCTCCGCCCTCGACATTGCCTCGCTCTACTTCCGCTCCGGCGCCGACAAGGTGTCGA TTGGCTCCGACGCCGTGGCCGCCGCAGAGCAATACTACGCCTCTGGCCGTCGTCTCACCGGCTCCACCGCCATTG AGCAAATCTCGCGCGCCTACGGCAACCAAGCCGTCGTTGTCAGCATCGATCCCCGCCGCGTCTACCTCGATAGCC CCGACTCTTGTCCCCGTCACCGGCAGCACGTCATCGAGACTTGTTTTCCCGGCCCGGCTGGCGAGCGCTTTTGCT GGTACGTCTGCACCGTCCGCGGCGGTCGCGAGACGCGTGATCTGGACGTGGTTGAGCTCGCCCAGGCTGTCCAAG CCATGGGTGCCGGCGAGCTCCTCCTCAACTCGATTGACCGTGACGGCTCAAACTCGGGCTTTGATCTCGAGCTCA TTGCCCAGGTCAAGGCTTGTGTCAAAATCCCCGTCATTGCCTCGAGTGGTGCTGGCAACCCATCCCACTTTGAAC AAGTCTTTACACAAACTTCAACCGACGCTGCCCTCGGTGCCGGCATCTTCCACCGTGGAGAGTACAGCGTCAGAC AGGTCAAGGATTATCTCAGCTCCAAGGGGCTTCTTGTGCGTCAGTTTGAGGGCGATTTGGATACTCATGCTGTTG CAATACAATCATAG |