Fungal Genomics

at Utrecht University

General Properties

Protein IDOphauB2|7332
Gene name
LocationContig_78:4941..6429
Strand-
Gene length (bp)1488
Transcript length (bp)1350
Coding sequence length (bp)1350
Protein length (aa) 450

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF03198 Glyco_hydro_72 Glucanosyltransferase 7.0E-125 31 332

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|P0C7S9|GEL1_ASPFU 1,3-beta-glucanosyltransferase gel1 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=gel1 PE=3 SV=1 1 449 4.0E-160
sp|B0XT72|GEL1_ASPFC 1,3-beta-glucanosyltransferase gel1 OS=Neosartorya fumigata (strain CEA10 / CBS 144.89 / FGSC A1163) GN=gel1 PE=1 SV=1 1 449 6.0E-160
sp|Q5AJY5|PGA4_CANAL 1,3-beta-glucanosyltransferase PGA4 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=PGA4 PE=1 SV=1 34 377 3.0E-124
sp|Q08193|GAS5_YEAST 1,3-beta-glucanosyltransferase GAS5 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=GAS5 PE=1 SV=1 37 385 4.0E-113
sp|Q9Y7Y7|GAS4_SCHPO 1,3-beta-glucanosyltransferase gas4 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=gas4 PE=1 SV=1 28 388 5.0E-110
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|P0C7S9|GEL1_ASPFU 1,3-beta-glucanosyltransferase gel1 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=gel1 PE=3 SV=1 1 449 4.0E-160
sp|B0XT72|GEL1_ASPFC 1,3-beta-glucanosyltransferase gel1 OS=Neosartorya fumigata (strain CEA10 / CBS 144.89 / FGSC A1163) GN=gel1 PE=1 SV=1 1 449 6.0E-160
sp|Q5AJY5|PGA4_CANAL 1,3-beta-glucanosyltransferase PGA4 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=PGA4 PE=1 SV=1 34 377 3.0E-124
sp|Q08193|GAS5_YEAST 1,3-beta-glucanosyltransferase GAS5 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=GAS5 PE=1 SV=1 37 385 4.0E-113
sp|Q9Y7Y7|GAS4_SCHPO 1,3-beta-glucanosyltransferase gas4 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=gas4 PE=1 SV=1 28 388 5.0E-110
sp|O13692|GAS5_SCHPO 1,3-beta-glucanosyltransferase gas5 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=gas5 PE=1 SV=1 37 393 1.0E-99
sp|P0C954|GEL2_ASPFU 1,3-beta-glucanosyltransferase gel2 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=gel2 PE=3 SV=1 29 315 3.0E-85
sp|B0Y8H9|GEL2_ASPFC 1,3-beta-glucanosyltransferase gel2 OS=Neosartorya fumigata (strain CEA10 / CBS 144.89 / FGSC A1163) GN=gel2 PE=1 SV=1 29 315 3.0E-85
sp|O13318|PHR2_CANAL pH-responsive protein 2 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=PHR2 PE=2 SV=2 33 366 9.0E-83
sp|Q03655|GAS3_YEAST Probable 1,3-beta-glucanosyltransferase GAS3 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=GAS3 PE=1 SV=1 51 380 6.0E-82
sp|P22146|GAS1_YEAST 1,3-beta-glucanosyltransferase GAS1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=GAS1 PE=1 SV=2 33 366 7.0E-82
sp|P56092|EPD1_CANMA Protein EPD1 OS=Candida maltosa GN=EPD1 PE=3 SV=1 33 366 3.0E-80
sp|Q08271|GAS4_YEAST 1,3-beta-glucanosyltransferase GAS4 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=GAS4 PE=1 SV=1 46 337 4.0E-80
sp|P43076|PHR1_CANAL pH-responsive protein 1 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=PHR1 PE=2 SV=3 31 366 3.0E-76
sp|O74137|EPD2_CANMA Protein EPD2 OS=Candida maltosa GN=EPD2 PE=3 SV=1 35 366 4.0E-75
sp|Q9USU5|GAS2_SCHPO 1,3-beta-glucanosyltransferase gas2 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=gas2 PE=2 SV=1 32 384 1.0E-73
sp|P0C956|GEL4_ASPFU 1,3-beta-glucanosyltransferase gel4 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=gel4 PE=3 SV=1 41 371 3.0E-73
sp|B0XVI5|GEL4_ASPFC 1,3-beta-glucanosyltransferase gel4 OS=Neosartorya fumigata (strain CEA10 / CBS 144.89 / FGSC A1163) GN=gel4 PE=1 SV=1 41 371 3.0E-73
sp|Q06135|GAS2_YEAST 1,3-beta-glucanosyltransferase GAS2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=GAS2 PE=1 SV=1 35 373 3.0E-71
sp|Q9P378|GAS1_SCHPO 1,3-beta-glucanosyltransferase gas1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=gas1 PE=1 SV=1 31 372 2.0E-69
sp|D4ATC3|GAS1_ARTBC 1,3-beta-glucanosyltransferase ARB_07487 OS=Arthroderma benhamiae (strain ATCC MYA-4681 / CBS 112371) GN=ARB_07487 PE=1 SV=1 11 366 5.0E-69
sp|P0C955|GEL3_ASPFU 1,3-beta-glucanosyltransferase gel3 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=gel3 PE=3 SV=1 37 369 2.0E-64
sp|B0XT09|GEL3_ASPFC 1,3-beta-glucanosyltransferase gel3 OS=Neosartorya fumigata (strain CEA10 / CBS 144.89 / FGSC A1163) GN=gel3 PE=1 SV=1 37 369 2.0E-64
sp|Q59VW6|PGA5_CANAL 1,3-beta-glucanosyltransferase PGA5 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=PGA5 PE=1 SV=1 34 310 2.0E-56
[Show less]

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
Yes 1 - 19 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >OphauB2|7332
MKGFALLSAFAAVGLVSATPTRTEKEPLTKRANLPPVTVSGNAFWTGKDRFYIRGIDYQPGGSSANLDPLADPVT
CERDIKAFERLGVNTIRVYAVDNSKDHDKCMQLLNDAQIYLVLDVNNPKYSINRSKPGPSYNAKYLQSVFATVEM
FAKYPNTLAFFSGNEVINDQKDTDKSAPFVKAVTRDMKNFINSRGLRKIPVGYSAADVSQNRMQTAMYMNCGSDD
MRSDFFAFNDYSWCNTDLMTSQWDQKVKNFTDYGLPIFLSEWGCIKSRPRKFEEIAALMSKQMTSVYSGGLMYEY
SLEDNDFGIVKLQGNNVDETDEFNLFKSALKENPMPTGSGGAASTTHAVSCPTSDASWNVNPSLVPEMPSQAEKF
MKQGAGNGPGLKGDGSQDAGDSGMSTASTTGGKPSATQSGEDNAGVSMHGPMDKSPFVVSALALSFTLFGALLL*
Coding >OphauB2|7332
ATGAAGGGATTCGCATTGCTCTCGGCCTTTGCTGCCGTTGGCCTGGTTTCGGCCACGCCTACAAGGACTGAAAAG
GAGCCTCTGACCAAGCGCGCCAATTTGCCTCCTGTTACCGTCTCTGGCAATGCCTTTTGGACTGGCAAGGACCGC
TTCTATATTCGCGGCATCGACTACCAGCCTGGCGGTTCTTCGGCCAATCTGGATCCTCTTGCCGACCCCGTCACG
TGTGAGCGTGATATCAAGGCGTTCGAGAGGCTCGGTGTAAATACTATTCGTGTCTACGCCGTTGACAACTCCAAG
GACCACGATAAGTGCATGCAGCTTCTCAATGATGCACAAATTTATCTGGTTCTCGATGTCAACAACCCCAAATAC
TCGATTAATCGCTCCAAGCCCGGTCCTTCGTACAATGCCAAGTATCTACAGAGTGTCTTTGCCACTGTCGAGATG
TTTGCCAAGTACCCCAACACTCTGGCCTTTTTCTCTGGCAACGAGGTCATTAATGACCAAAAGGACACGGACAAG
TCGGCCCCGTTTGTCAAGGCTGTCACGCGCGACATGAAGAACTTTATCAATTCTCGCGGTCTCCGCAAGATTCCT
GTCGGCTACTCTGCCGCTGATGTCTCTCAGAATCGCATGCAGACGGCCATGTACATGAACTGCGGTTCCGATGAT
ATGCGCTCCGACTTTTTCGCCTTCAACGACTATTCTTGGTGCAACACCGATTTGATGACATCCCAGTGGGACCAG
AAGGTCAAGAATTTTACCGATTACGGTCTCCCCATTTTCCTGTCTGAGTGGGGATGCATCAAGTCTCGCCCTCGC
AAGTTTGAAGAGATAGCTGCCCTGATGAGCAAGCAGATGACTTCTGTTTACTCTGGCGGTCTCATGTACGAGTAC
TCTCTTGAGGACAACGACTTTGGCATTGTCAAGCTCCAGGGCAATAATGTGGATGAGACGGACGAGTTTAACTTG
TTCAAGAGTGCGCTCAAGGAAAACCCCATGCCAACTGGTAGCGGTGGTGCTGCATCGACGACACATGCCGTTAGC
TGCCCCACCTCTGACGCTTCGTGGAATGTGAACCCCAGCCTGGTTCCCGAGATGCCTTCGCAAGCTGAAAAGTTT
ATGAAGCAGGGTGCGGGCAACGGCCCTGGCCTTAAGGGAGACGGCTCACAGGATGCCGGCGACAGTGGTATGTCT
ACTGCTAGCACCACTGGCGGCAAACCTTCGGCGACGCAGTCTGGAGAGGATAACGCTGGTGTATCGATGCACGGA
CCTATGGACAAGTCTCCATTTGTCGTGTCTGCCTTGGCCCTGTCTTTTACACTGTTTGGCGCCCTGCTCTTGTAA
Transcript >OphauB2|7332
ATGAAGGGATTCGCATTGCTCTCGGCCTTTGCTGCCGTTGGCCTGGTTTCGGCCACGCCTACAAGGACTGAAAAG
GAGCCTCTGACCAAGCGCGCCAATTTGCCTCCTGTTACCGTCTCTGGCAATGCCTTTTGGACTGGCAAGGACCGC
TTCTATATTCGCGGCATCGACTACCAGCCTGGCGGTTCTTCGGCCAATCTGGATCCTCTTGCCGACCCCGTCACG
TGTGAGCGTGATATCAAGGCGTTCGAGAGGCTCGGTGTAAATACTATTCGTGTCTACGCCGTTGACAACTCCAAG
GACCACGATAAGTGCATGCAGCTTCTCAATGATGCACAAATTTATCTGGTTCTCGATGTCAACAACCCCAAATAC
TCGATTAATCGCTCCAAGCCCGGTCCTTCGTACAATGCCAAGTATCTACAGAGTGTCTTTGCCACTGTCGAGATG
TTTGCCAAGTACCCCAACACTCTGGCCTTTTTCTCTGGCAACGAGGTCATTAATGACCAAAAGGACACGGACAAG
TCGGCCCCGTTTGTCAAGGCTGTCACGCGCGACATGAAGAACTTTATCAATTCTCGCGGTCTCCGCAAGATTCCT
GTCGGCTACTCTGCCGCTGATGTCTCTCAGAATCGCATGCAGACGGCCATGTACATGAACTGCGGTTCCGATGAT
ATGCGCTCCGACTTTTTCGCCTTCAACGACTATTCTTGGTGCAACACCGATTTGATGACATCCCAGTGGGACCAG
AAGGTCAAGAATTTTACCGATTACGGTCTCCCCATTTTCCTGTCTGAGTGGGGATGCATCAAGTCTCGCCCTCGC
AAGTTTGAAGAGATAGCTGCCCTGATGAGCAAGCAGATGACTTCTGTTTACTCTGGCGGTCTCATGTACGAGTAC
TCTCTTGAGGACAACGACTTTGGCATTGTCAAGCTCCAGGGCAATAATGTGGATGAGACGGACGAGTTTAACTTG
TTCAAGAGTGCGCTCAAGGAAAACCCCATGCCAACTGGTAGCGGTGGTGCTGCATCGACGACACATGCCGTTAGC
TGCCCCACCTCTGACGCTTCGTGGAATGTGAACCCCAGCCTGGTTCCCGAGATGCCTTCGCAAGCTGAAAAGTTT
ATGAAGCAGGGTGCGGGCAACGGCCCTGGCCTTAAGGGAGACGGCTCACAGGATGCCGGCGACAGTGGTATGTCT
ACTGCTAGCACCACTGGCGGCAAACCTTCGGCGACGCAGTCTGGAGAGGATAACGCTGGTGTATCGATGCACGGA
CCTATGGACAAGTCTCCATTTGTCGTGTCTGCCTTGGCCCTGTCTTTTACACTGTTTGGCGCCCTGCTCTTGTAA
Gene >OphauB2|7332
ATGAAGGGATTCGCATTGCTCTCGGCCTTTGCTGCCGTTGGCCTGGTTTCGGCCACGCCTACAAGGACTGAAAAG
GAGCCTCTGACCAAGCGCGCCAATTTGCCTCCTGTTACCGTCTCTGGCAATGGTTAGTCTCCCTCTTATACAGGC
GTCGCCGCTTAAACGGTTTGCTGACTGGGGTTCAAAAAAGCCTTTTGGACTGGCAAGGACCGCTTCTATATTCGC
GGCATCGACTACCAGCCTGGCGGTTCTTCGGCCAATCTGGATCCTCTTGCCGACCCCGTCACGTGTGAGCGTGAT
ATCAAGGCGTTCGAGAGGCTCGGTGTAAATACTATTCGTGTCTACGCCGTTGACAACTCCAAGGACCACGATAAG
TGCATGCAGCTTCTCAATGATGCACAAATTTATCTGGTTCTCGATGTCAACAACCCCAAATACTCGATTAATCGC
TCCAAGCCCGGTCCTTCGTACAATGCCAAGTATCTACAGAGTGTCTTTGCCACTGTCGAGATGTTTGCCAAGTAC
CCCAACACTCTGGCCTTTTTCTCTGGCAACGAGGTCATTAATGACCAAAAGGACACGGACAAGTCGGCCCCGTTT
GTCAAGGCTGTCACGCGCGACATGAAGAACTTTATCAATTCTCGCGGTCTCCGCAAGATTCCTGTCGGCTACTCT
GCCGCTGATGTCTCTCAGAATCGCATGCAGACGGCCATGTACATGAACTGCGGTTCCGATGATATGCGCTCCGAC
TTTTTCGCCTTCAACGACTATTCTTGGTGCAACACCGATTTGATGACATCCCAGTGGGACCAGAAGGTCAAGAAT
TTTACCGATTACGGTCTCCCCATTTTGTGAGTGTTTTTTTTTCTTTGTTGGGTTTTATCTTTTGAAGTTGTCGCT
CGGACTGCTGACTGCTATTGCTATAGCCTGTCTGAGTGGGGATGCATCAAGTCTCGCCCTCGCAAGTTTGAAGAG
ATAGCTGCCCTGATGAGCAAGCAGATGACTTCTGTTTACTCTGGCGGTCTCATGTACGAGTACTCTCTTGAGGAC
AACGACTTTGGCATTGTCAAGCTCCAGGGCAATAATGTGGATGAGACGGACGAGTTTAACTTGTTCAAGAGTGCG
CTCAAGGAAAACCCCATGCCAACTGGTAGCGGTGGTGCTGCATCGACGACACATGCCGTTAGCTGCCCCACCTCT
GACGCTTCGTGGAATGTGAACCCCAGCCTGGTTCCCGAGATGCCTTCGCAAGCTGAAAAGTTTATGAAGCAGGGT
GCGGGCAACGGCCCTGGCCTTAAGGGAGACGGCTCACAGGATGCCGGCGACAGTGGTATGTCTACTGCTAGCACC
ACTGGCGGCAAACCTTCGGCGACGCAGTCTGGAGAGGATAACGCTGGTGTATCGATGCACGGACCTATGGACAAG
TCTCCATTTGTCGTGTCTGCCTTGGCCCTGTCTTTTACACTGTTTGGCGCCCTGCTCTTGTAA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail