Fungal Genomics

at Utrecht University

General Properties

Protein IDOphauB2|7331
Gene name
LocationContig_78:3424..4404
Strand-
Gene length (bp)980
Transcript length (bp)861
Coding sequence length (bp)861
Protein length (aa) 287

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00378 ECH_1 Enoyl-CoA hydratase/isomerase 6.0E-37 23 281
PF16113 ECH_2 Enoyl-CoA hydratase/isomerase 8.4E-29 25 207

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|O35459|ECH1_MOUSE Delta(3,5)-Delta(2,4)-dienoyl-CoA isomerase, mitochondrial OS=Mus musculus GN=Ech1 PE=1 SV=1 3 286 2.0E-71
sp|Q62651|ECH1_RAT Delta(3,5)-Delta(2,4)-dienoyl-CoA isomerase, mitochondrial OS=Rattus norvegicus GN=Ech1 PE=1 SV=2 4 286 4.0E-71
sp|Q13011|ECH1_HUMAN Delta(3,5)-Delta(2,4)-dienoyl-CoA isomerase, mitochondrial OS=Homo sapiens GN=ECH1 PE=1 SV=2 10 286 6.0E-65
sp|Q5RFG0|ECH1_PONAB Delta(3,5)-Delta(2,4)-dienoyl-CoA isomerase, mitochondrial OS=Pongo abelii GN=ECH1 PE=2 SV=1 10 277 4.0E-64
sp|Q54SS0|ECH1_DICDI Delta(3,5)-Delta(2,4)-dienoyl-CoA isomerase, mitochondrial OS=Dictyostelium discoideum GN=ech1 PE=3 SV=1 11 284 2.0E-48
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|O35459|ECH1_MOUSE Delta(3,5)-Delta(2,4)-dienoyl-CoA isomerase, mitochondrial OS=Mus musculus GN=Ech1 PE=1 SV=1 3 286 2.0E-71
sp|Q62651|ECH1_RAT Delta(3,5)-Delta(2,4)-dienoyl-CoA isomerase, mitochondrial OS=Rattus norvegicus GN=Ech1 PE=1 SV=2 4 286 4.0E-71
sp|Q13011|ECH1_HUMAN Delta(3,5)-Delta(2,4)-dienoyl-CoA isomerase, mitochondrial OS=Homo sapiens GN=ECH1 PE=1 SV=2 10 286 6.0E-65
sp|Q5RFG0|ECH1_PONAB Delta(3,5)-Delta(2,4)-dienoyl-CoA isomerase, mitochondrial OS=Pongo abelii GN=ECH1 PE=2 SV=1 10 277 4.0E-64
sp|Q54SS0|ECH1_DICDI Delta(3,5)-Delta(2,4)-dienoyl-CoA isomerase, mitochondrial OS=Dictyostelium discoideum GN=ech1 PE=3 SV=1 11 284 2.0E-48
sp|P52046|CRT_CLOAB Short-chain-enoyl-CoA hydratase OS=Clostridium acetobutylicum (strain ATCC 824 / DSM 792 / JCM 1419 / LMG 5710 / VKM B-1787) GN=crt PE=1 SV=1 17 254 7.0E-29
sp|P31551|CAID_ECOLI Carnitinyl-CoA dehydratase OS=Escherichia coli (strain K12) GN=caiD PE=1 SV=4 24 254 3.0E-27
sp|B1IRE0|CAID_ECOLC Carnitinyl-CoA dehydratase OS=Escherichia coli (strain ATCC 8739 / DSM 1576 / Crooks) GN=caiD PE=3 SV=1 24 254 3.0E-27
sp|P59395|CAID_SHIFL Carnitinyl-CoA dehydratase OS=Shigella flexneri GN=caiD PE=3 SV=2 24 254 3.0E-27
sp|B1LFW9|CAID_ECOSM Carnitinyl-CoA dehydratase OS=Escherichia coli (strain SMS-3-5 / SECEC) GN=caiD PE=3 SV=1 24 254 3.0E-27
sp|Q8FLA6|CAID_ECOL6 Carnitinyl-CoA dehydratase OS=Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC) GN=caiD PE=3 SV=3 24 254 4.0E-27
sp|Q0TLV3|CAID_ECOL5 Carnitinyl-CoA dehydratase OS=Escherichia coli O6:K15:H31 (strain 536 / UPEC) GN=caiD PE=3 SV=1 24 254 4.0E-27
sp|Q8XA35|CAID_ECO57 Carnitinyl-CoA dehydratase OS=Escherichia coli O157:H7 GN=caiD PE=3 SV=3 24 254 9.0E-27
sp|A4YI89|HPCD_METS5 3-hydroxypropionyl-coenzyme A dehydratase OS=Metallosphaera sedula (strain ATCC 51363 / DSM 5348) GN=Msed_2001 PE=1 SV=1 13 284 1.0E-26
sp|Q8GB17|CAID_PROSL Carnitinyl-CoA dehydratase OS=Proteus sp. (strain LE138) GN=caiD PE=1 SV=3 24 239 6.0E-25
sp|B4EY26|CAID_PROMH Carnitinyl-CoA dehydratase OS=Proteus mirabilis (strain HI4320) GN=caiD PE=3 SV=1 24 239 6.0E-25
sp|A8ALR7|CAID_CITK8 Carnitinyl-CoA dehydratase OS=Citrobacter koseri (strain ATCC BAA-895 / CDC 4225-83 / SGSC4696) GN=caiD PE=3 SV=1 24 254 3.0E-24
sp|A9MR28|CAID_SALAR Carnitinyl-CoA dehydratase OS=Salmonella arizonae (strain ATCC BAA-731 / CDC346-86 / RSK2980) GN=caiD PE=3 SV=1 24 254 1.0E-23
sp|Q8Z9L5|CAID_SALTI Carnitinyl-CoA dehydratase OS=Salmonella typhi GN=caiD PE=3 SV=3 24 254 1.0E-23
sp|B5BL54|CAID_SALPK Carnitinyl-CoA dehydratase OS=Salmonella paratyphi A (strain AKU_12601) GN=caiD PE=3 SV=1 24 254 2.0E-23
sp|C0Q4L2|CAID_SALPC Carnitinyl-CoA dehydratase OS=Salmonella paratyphi C (strain RKS4594) GN=caiD PE=3 SV=1 24 254 2.0E-23
sp|Q5PIL1|CAID_SALPA Carnitinyl-CoA dehydratase OS=Salmonella paratyphi A (strain ATCC 9150 / SARB42) GN=caiD PE=3 SV=1 24 254 2.0E-23
sp|Q57TJ1|CAID_SALCH Carnitinyl-CoA dehydratase OS=Salmonella choleraesuis (strain SC-B67) GN=caiD PE=3 SV=1 24 254 2.0E-23
sp|B5F749|CAID_SALA4 Carnitinyl-CoA dehydratase OS=Salmonella agona (strain SL483) GN=caiD PE=3 SV=1 24 254 2.0E-23
sp|B4T6J5|CAID_SALNS Carnitinyl-CoA dehydratase OS=Salmonella newport (strain SL254) GN=caiD PE=3 SV=1 24 254 2.0E-23
sp|B5RGA4|CAID_SALG2 Carnitinyl-CoA dehydratase OS=Salmonella gallinarum (strain 287/91 / NCTC 13346) GN=caiD PE=3 SV=1 24 254 2.0E-23
sp|B5R1Q9|CAID_SALEP Carnitinyl-CoA dehydratase OS=Salmonella enteritidis PT4 (strain P125109) GN=caiD PE=3 SV=1 24 254 2.0E-23
sp|Q8ZRX5|CAID_SALTY Carnitinyl-CoA dehydratase OS=Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) GN=caiD PE=3 SV=3 24 254 2.0E-23
sp|B4TWR3|CAID_SALSV Carnitinyl-CoA dehydratase OS=Salmonella schwarzengrund (strain CVM19633) GN=caiD PE=3 SV=1 24 254 2.0E-23
sp|B4TIG9|CAID_SALHS Carnitinyl-CoA dehydratase OS=Salmonella heidelberg (strain SL476) GN=caiD PE=3 SV=1 24 254 2.0E-23
sp|A9MYJ5|CAID_SALPB Carnitinyl-CoA dehydratase OS=Salmonella paratyphi B (strain ATCC BAA-1250 / SPB7) GN=caiD PE=3 SV=1 24 254 2.0E-23
sp|B5FHG4|CAID_SALDC Carnitinyl-CoA dehydratase OS=Salmonella dublin (strain CT_02021853) GN=caiD PE=3 SV=1 24 254 2.0E-23
sp|P34559|ECHM_CAEEL Probable enoyl-CoA hydratase, mitochondrial OS=Caenorhabditis elegans GN=ech-6 PE=3 SV=1 13 284 9.0E-22
sp|Q7U004|ECH12_MYCBO Probable enoyl-CoA hydratase echA12 OS=Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97) GN=echA12 PE=3 SV=1 5 245 3.0E-21
sp|P9WNN7|ECH12_MYCTU Probable enoyl-CoA hydratase echA12 OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=echA12 PE=1 SV=1 5 245 1.0E-20
sp|P9WNN6|ECH12_MYCTO Probable enoyl-CoA hydratase echA12 OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) GN=echA12 PE=3 SV=1 5 245 1.0E-20
sp|P53526|ECH12_MYCLE Probable enoyl-CoA hydratase echA12 OS=Mycobacterium leprae (strain TN) GN=echA12 PE=3 SV=1 24 205 3.0E-20
sp|O34893|YNGF_BACSU Putative enoyl-CoA hydratase/isomerase YngF OS=Bacillus subtilis (strain 168) GN=yngF PE=3 SV=1 14 252 6.0E-20
sp|P94549|FADB_BACSU Probable enoyl-CoA hydratase OS=Bacillus subtilis (strain 168) GN=fadB PE=2 SV=1 22 284 2.0E-19
sp|Q8BH95|ECHM_MOUSE Enoyl-CoA hydratase, mitochondrial OS=Mus musculus GN=Echs1 PE=1 SV=1 8 241 6.0E-17
sp|P14604|ECHM_RAT Enoyl-CoA hydratase, mitochondrial OS=Rattus norvegicus GN=Echs1 PE=1 SV=1 8 241 1.0E-16
sp|Q52995|ECHH_RHIME Probable enoyl-CoA hydratase OS=Rhizobium meliloti (strain 1021) GN=fadB1 PE=3 SV=2 11 254 1.0E-15
sp|P30084|ECHM_HUMAN Enoyl-CoA hydratase, mitochondrial OS=Homo sapiens GN=ECHS1 PE=1 SV=4 8 241 2.0E-15
sp|Q5R646|ECHM_PONAB Enoyl-CoA hydratase, mitochondrial OS=Pongo abelii GN=ECHS1 PE=2 SV=1 8 284 6.0E-15
sp|Q5ZJ60|HIBCH_CHICK 3-hydroxyisobutyryl-CoA hydrolase, mitochondrial OS=Gallus gallus GN=HIBCH PE=2 SV=1 27 183 6.0E-15
sp|A2VDC2|HIBCH_XENLA 3-hydroxyisobutyryl-CoA hydrolase, mitochondrial OS=Xenopus laevis GN=hibch PE=2 SV=1 27 283 3.0E-14
sp|Q6NVY1|HIBCH_HUMAN 3-hydroxyisobutyryl-CoA hydrolase, mitochondrial OS=Homo sapiens GN=HIBCH PE=1 SV=2 27 242 4.0E-14
sp|Q2HJ73|HIBCH_BOVIN 3-hydroxyisobutyryl-CoA hydrolase, mitochondrial OS=Bos taurus GN=HIBCH PE=2 SV=1 27 230 4.0E-14
sp|Q58EB4|HIBCH_DANRE 3-hydroxyisobutyryl-CoA hydrolase, mitochondrial OS=Danio rerio GN=hibch PE=2 SV=1 27 241 5.0E-14
sp|Q5XIE6|HIBCH_RAT 3-hydroxyisobutyryl-CoA hydrolase, mitochondrial OS=Rattus norvegicus GN=Hibch PE=1 SV=2 27 232 6.0E-14
sp|Q8QZS1|HIBCH_MOUSE 3-hydroxyisobutyryl-CoA hydrolase, mitochondrial OS=Mus musculus GN=Hibch PE=1 SV=1 27 232 7.0E-14
sp|P9WNP1|ECHA6_MYCTU Probable enoyl-CoA hydratase echA6 OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=echA6 PE=1 SV=1 22 284 2.0E-13
sp|P9WNP0|ECHA6_MYCTO Probable enoyl-CoA hydratase echA6 OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) GN=echA6 PE=3 SV=1 22 284 2.0E-13
sp|P64015|ECHA6_MYCBO Probable enoyl-CoA hydratase echA6 OS=Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97) GN=echA6 PE=3 SV=1 22 284 2.0E-13
sp|Q8GYN9|MENB_ARATH 1,4-dihydroxy-2-naphthoyl-CoA synthase, peroxisomal OS=Arabidopsis thaliana GN=MENB PE=1 SV=2 9 241 3.0E-13
sp|Q3TLP5|ECHD2_MOUSE Enoyl-CoA hydratase domain-containing protein 2, mitochondrial OS=Mus musculus GN=Echdc2 PE=1 SV=2 5 283 6.0E-13
sp|Q9LCU3|CBAD2_ARTSP 4-chlorobenzoyl coenzyme A dehalogenase-2 OS=Arthrobacter sp. GN=fcbB2 PE=1 SV=1 24 207 7.0E-13
sp|O69762|HCHL_PSEFL Hydroxycinnamoyl-CoA hydratase-lyase OS=Pseudomonas fluorescens PE=1 SV=1 24 237 7.0E-13
sp|O85078|CBAD1_ARTSP 4-chlorobenzoyl coenzyme A dehalogenase-1 OS=Arthrobacter sp. GN=fcbB1 PE=1 SV=2 24 207 7.0E-13
sp|P76082|PAAF_ECOLI 2,3-dehydroadipyl-CoA hydratase OS=Escherichia coli (strain K12) GN=paaF PE=1 SV=1 22 284 1.0E-12
sp|Q8DB47|FADJ_VIBVU Fatty acid oxidation complex subunit alpha OS=Vibrio vulnificus (strain CMCP6) GN=fadJ PE=3 SV=1 15 205 1.0E-12
sp|Q7MIS5|FADJ_VIBVY Fatty acid oxidation complex subunit alpha OS=Vibrio vulnificus (strain YJ016) GN=fadJ PE=3 SV=1 15 205 2.0E-12
sp|A0QRD3|MENB_MYCS2 1,4-dihydroxy-2-naphthoyl-CoA synthase OS=Mycobacterium smegmatis (strain ATCC 700084 / mc(2)155) GN=menB PE=1 SV=1 7 241 2.0E-12
sp|P52045|SCPB_ECOLI Methylmalonyl-CoA decarboxylase OS=Escherichia coli (strain K12) GN=scpB PE=1 SV=1 11 283 2.0E-12
sp|P9WNP5|MENB_MYCTU 1,4-dihydroxy-2-naphthoyl-CoA synthase OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=menB PE=1 SV=1 29 241 2.0E-12
sp|P9WNP4|MENB_MYCTO 1,4-dihydroxy-2-naphthoyl-CoA synthase OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) GN=menB PE=3 SV=1 29 241 2.0E-12
sp|P9WNN9|ECHA8_MYCTU Probable enoyl-CoA hydratase echA8 OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=echA8 PE=1 SV=1 11 283 5.0E-12
sp|P9WNN8|ECHA8_MYCTO Probable enoyl-CoA hydratase echA8 OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) GN=echA8 PE=3 SV=1 11 283 5.0E-12
sp|P64017|ECHA8_MYCBO Probable enoyl-CoA hydratase echA8 OS=Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97) GN=echA8 PE=3 SV=1 11 283 5.0E-12
sp|Q2TBT3|ECHD2_BOVIN Enoyl-CoA hydratase domain-containing protein 2, mitochondrial OS=Bos taurus GN=ECHDC2 PE=2 SV=1 22 283 5.0E-12
sp|P23966|MENB_BACSU 1,4-dihydroxy-2-naphthoyl-CoA synthase OS=Bacillus subtilis (strain 168) GN=menB PE=1 SV=2 12 283 5.0E-12
sp|B5XVW2|FADJ_KLEP3 Fatty acid oxidation complex subunit alpha OS=Klebsiella pneumoniae (strain 342) GN=fadJ PE=3 SV=1 15 222 6.0E-12
sp|Q9TM10|MENB_CYACA 1,4-dihydroxy-2-naphthoyl-CoA synthase OS=Cyanidium caldarium GN=menB PE=3 SV=1 22 241 6.0E-12
sp|Q869N6|CRTL_DICDI 3-hydroxybutyryl-CoA dehydratase-like protein, mitochondrial OS=Dictyostelium discoideum GN=DDB_G0271866 PE=3 SV=1 1 286 7.0E-12
sp|Q54HG7|AUHM_DICDI Methylglutaconyl-CoA hydratase, mitochondrial OS=Dictyostelium discoideum GN=auh PE=3 SV=1 17 284 7.0E-12
sp|Q5LLW6|DMDD_RUEPO Methylthioacryloyl-CoA hydratase OS=Ruegeria pomeroyi (strain ATCC 700808 / DSM 15171 / DSS-3) GN=dmdD PE=1 SV=1 12 231 1.0E-11
sp|P28817|HIBCH_YEAST 3-hydroxyisobutyryl-CoA hydrolase, mitochondrial OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=EHD3 PE=1 SV=2 27 217 1.0E-11
sp|Q5HQC3|MENB_STAEQ 1,4-dihydroxy-2-naphthoyl-CoA synthase OS=Staphylococcus epidermidis (strain ATCC 35984 / RP62A) GN=menB PE=3 SV=1 12 245 2.0E-11
sp|P77467|PAAG_ECOLI 1,2-epoxyphenylacetyl-CoA isomerase OS=Escherichia coli (strain K12) GN=paaG PE=1 SV=1 15 283 2.0E-11
sp|Q8CPQ4|MENB_STAES 1,4-dihydroxy-2-naphthoyl-CoA synthase OS=Staphylococcus epidermidis (strain ATCC 12228) GN=menB PE=3 SV=1 12 245 2.0E-11
sp|A6TC19|FADJ_KLEP7 Fatty acid oxidation complex subunit alpha OS=Klebsiella pneumoniae subsp. pneumoniae (strain ATCC 700721 / MGH 78578) GN=fadJ PE=3 SV=1 15 222 3.0E-11
sp|A7MS61|FADJ_VIBCB Fatty acid oxidation complex subunit alpha OS=Vibrio campbellii (strain ATCC BAA-1116 / BB120) GN=fadJ PE=3 SV=1 15 205 3.0E-11
sp|Q86YB7|ECHD2_HUMAN Enoyl-CoA hydratase domain-containing protein 2, mitochondrial OS=Homo sapiens GN=ECHDC2 PE=1 SV=2 22 283 3.0E-11
sp|Q29554|ECHA_PIG Trifunctional enzyme subunit alpha, mitochondrial OS=Sus scrofa GN=HADHA PE=1 SV=1 24 252 4.0E-11
sp|A5JTM5|CBADH_PSEUC 4-chlorobenzoyl coenzyme A dehalogenase OS=Pseudomonas sp. (strain CBS-3) PE=1 SV=1 24 243 5.0E-11
sp|Q87MM3|FADJ_VIBPA Fatty acid oxidation complex subunit alpha OS=Vibrio parahaemolyticus serotype O3:K6 (strain RIMD 2210633) GN=fadJ PE=3 SV=1 15 205 5.0E-11
sp|Q8BMS1|ECHA_MOUSE Trifunctional enzyme subunit alpha, mitochondrial OS=Mus musculus GN=Hadha PE=1 SV=1 24 223 5.0E-11
sp|P44960|MENB_HAEIN 1,4-dihydroxy-2-naphthoyl-CoA synthase OS=Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd) GN=menB PE=3 SV=1 12 241 6.0E-11
sp|Q64428|ECHA_RAT Trifunctional enzyme subunit alpha, mitochondrial OS=Rattus norvegicus GN=Hadha PE=1 SV=2 24 223 6.0E-11
sp|Q49WG8|MENB_STAS1 1,4-dihydroxy-2-naphthoyl-CoA synthase OS=Staphylococcus saprophyticus subsp. saprophyticus (strain ATCC 15305 / DSM 20229) GN=menB PE=3 SV=1 24 245 7.0E-11
sp|Q9CLV5|MENB_PASMU 1,4-dihydroxy-2-naphthoyl-CoA synthase OS=Pasteurella multocida (strain Pm70) GN=menB PE=3 SV=1 24 241 7.0E-11
sp|P40939|ECHA_HUMAN Trifunctional enzyme subunit alpha, mitochondrial OS=Homo sapiens GN=HADHA PE=1 SV=2 24 252 8.0E-11
sp|P0ABU0|MENB_ECOLI 1,4-dihydroxy-2-naphthoyl-CoA synthase OS=Escherichia coli (strain K12) GN=menB PE=1 SV=1 12 241 8.0E-11
sp|P0ABU1|MENB_ECOL6 1,4-dihydroxy-2-naphthoyl-CoA synthase OS=Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC) GN=menB PE=3 SV=1 12 241 8.0E-11
sp|Q13825|AUHM_HUMAN Methylglutaconyl-CoA hydratase, mitochondrial OS=Homo sapiens GN=AUH PE=1 SV=1 4 284 1.0E-10
sp|Q9JLZ3|AUHM_MOUSE Methylglutaconyl-CoA hydratase, mitochondrial OS=Mus musculus GN=Auh PE=1 SV=1 6 284 1.0E-10
sp|Q7N288|FADJ_PHOLL Fatty acid oxidation complex subunit alpha OS=Photorhabdus luminescens subsp. laumondii (strain TT01) GN=fadJ PE=3 SV=2 8 205 2.0E-10
sp|Q4L549|MENB_STAHJ 1,4-dihydroxy-2-naphthoyl-CoA synthase OS=Staphylococcus haemolyticus (strain JCSC1435) GN=menB PE=3 SV=1 12 207 2.0E-10
sp|C6DAL7|FADJ_PECCP Fatty acid oxidation complex subunit alpha OS=Pectobacterium carotovorum subsp. carotovorum (strain PC1) GN=fadJ PE=3 SV=1 34 229 3.0E-10
sp|O74802|HIBCH_SCHPO 3-hydroxyisobutyryl-CoA hydrolase, mitochondrial OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=ehd3 PE=3 SV=1 27 187 4.0E-10
sp|Q9XB60|CARB_PECCC Carboxymethylproline synthase OS=Pectobacterium carotovorum subsp. carotovorum GN=carB PE=1 SV=1 18 267 4.0E-10
sp|Q0HWN3|FADJ_SHESR Fatty acid oxidation complex subunit alpha OS=Shewanella sp. (strain MR-7) GN=fadJ PE=3 SV=1 15 207 5.0E-10
sp|Q0HKD1|FADJ_SHESM Fatty acid oxidation complex subunit alpha OS=Shewanella sp. (strain MR-4) GN=fadJ PE=3 SV=1 15 207 6.0E-10
sp|Q5QXM1|FADJ_IDILO Fatty acid oxidation complex subunit alpha OS=Idiomarina loihiensis (strain ATCC BAA-735 / DSM 15497 / L2-TR) GN=fadJ PE=3 SV=1 15 207 6.0E-10
sp|Q6NYL3|ECHP_DANRE Peroxisomal bifunctional enzyme OS=Danio rerio GN=ehhadh PE=2 SV=1 24 207 6.0E-10
sp|Q8ECP7|FADJ_SHEON Fatty acid oxidation complex subunit alpha OS=Shewanella oneidensis (strain MR-1) GN=fadJ PE=3 SV=2 15 207 7.0E-10
sp|A0KV76|FADJ_SHESA Fatty acid oxidation complex subunit alpha OS=Shewanella sp. (strain ANA-3) GN=fadJ PE=3 SV=1 15 207 7.0E-10
sp|Q6NMB0|HIBC3_ARATH Probable 3-hydroxyisobutyryl-CoA hydrolase 3 OS=Arabidopsis thaliana GN=At2g30660 PE=2 SV=1 27 178 7.0E-10
sp|Q28FR6|HIBCH_XENTR 3-hydroxyisobutyryl-CoA hydrolase, mitochondrial OS=Xenopus tropicalis GN=hibch PE=2 SV=1 27 181 9.0E-10
sp|Q8NXA0|MENB_STAAW 1,4-dihydroxy-2-naphthoyl-CoA synthase OS=Staphylococcus aureus (strain MW2) GN=menB PE=3 SV=1 12 207 1.0E-09
sp|Q6GAG7|MENB_STAAS 1,4-dihydroxy-2-naphthoyl-CoA synthase OS=Staphylococcus aureus (strain MSSA476) GN=menB PE=3 SV=1 12 207 1.0E-09
sp|A1RI92|FADJ_SHESW Fatty acid oxidation complex subunit alpha OS=Shewanella sp. (strain W3-18-1) GN=fadJ PE=3 SV=1 15 207 1.0E-09
sp|Q7A6A9|MENB_STAAN 1,4-dihydroxy-2-naphthoyl-CoA synthase OS=Staphylococcus aureus (strain N315) GN=menB PE=1 SV=1 12 207 1.0E-09
sp|Q99V48|MENB_STAAM 1,4-dihydroxy-2-naphthoyl-CoA synthase OS=Staphylococcus aureus (strain Mu50 / ATCC 700699) GN=menB PE=3 SV=1 12 207 1.0E-09
sp|A6WQ25|FADJ_SHEB8 Fatty acid oxidation complex subunit alpha OS=Shewanella baltica (strain OS185) GN=fadJ PE=3 SV=1 15 207 1.0E-09
sp|Q6GI37|MENB_STAAR 1,4-dihydroxy-2-naphthoyl-CoA synthase OS=Staphylococcus aureus (strain MRSA252) GN=menB PE=3 SV=1 12 207 1.0E-09
sp|Q5HH38|MENB_STAAC 1,4-dihydroxy-2-naphthoyl-CoA synthase OS=Staphylococcus aureus (strain COL) GN=menB PE=1 SV=1 12 207 1.0E-09
sp|A4Y897|FADJ_SHEPC Fatty acid oxidation complex subunit alpha OS=Shewanella putrefaciens (strain CN-32 / ATCC BAA-453) GN=fadJ PE=3 SV=1 15 207 2.0E-09
sp|A3D684|FADJ_SHEB5 Fatty acid oxidation complex subunit alpha OS=Shewanella baltica (strain OS155 / ATCC BAA-1091) GN=fadJ PE=3 SV=1 15 207 2.0E-09
sp|O07137|ECHA8_MYCLE Probable enoyl-CoA hydratase echA8 OS=Mycobacterium leprae (strain TN) GN=echA8 PE=3 SV=1 22 283 2.0E-09
sp|Q7CQ56|MENB_SALTY 1,4-dihydroxy-2-naphthoyl-CoA synthase OS=Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) GN=menB PE=1 SV=1 12 241 2.0E-09
sp|Q50130|ECHA6_MYCLE Probable enoyl-CoA hydratase echA6 OS=Mycobacterium leprae (strain TN) GN=echA6 PE=3 SV=1 14 284 3.0E-09
sp|A5F2P2|FADJ_VIBC3 Fatty acid oxidation complex subunit alpha OS=Vibrio cholerae serotype O1 (strain ATCC 39541 / Classical Ogawa 395 / O395) GN=fadJ PE=3 SV=1 18 205 5.0E-09
sp|Q9KT58|FADJ_VIBCH Fatty acid oxidation complex subunit alpha OS=Vibrio cholerae serotype O1 (strain ATCC 39315 / El Tor Inaba N16961) GN=fadJ PE=3 SV=2 18 205 5.0E-09
sp|P45361|CRT_PEPDI Short-chain-enoyl-CoA hydratase (Fragment) OS=Peptoclostridium difficile GN=crt PE=3 SV=1 121 243 7.0E-09
sp|Q1PEY5|HIBC2_ARATH Probable 3-hydroxyisobutyryl-CoA hydrolase 2 OS=Arabidopsis thaliana GN=At2g30650 PE=2 SV=1 27 214 8.0E-09
sp|Q8DSN0|FABM_STRMU Trans-2-decenoyl-[acyl-carrier-protein] isomerase OS=Streptococcus mutans serotype c (strain ATCC 700610 / UA159) GN=fabM PE=3 SV=1 14 207 1.0E-08
sp|Q8FFG4|FADJ_ECOL6 Fatty acid oxidation complex subunit alpha OS=Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC) GN=fadJ PE=3 SV=1 24 207 1.0E-08
sp|B7N5V2|FADJ_ECOLU Fatty acid oxidation complex subunit alpha OS=Escherichia coli O17:K52:H18 (strain UMN026 / ExPEC) GN=fadJ PE=3 SV=1 24 207 1.0E-08
sp|B7M6M2|FADJ_ECO8A Fatty acid oxidation complex subunit alpha OS=Escherichia coli O8 (strain IAI1) GN=fadJ PE=3 SV=1 24 207 2.0E-08
sp|Q8XCP2|FADJ_ECO57 Fatty acid oxidation complex subunit alpha OS=Escherichia coli O157:H7 GN=fadJ PE=3 SV=1 24 207 2.0E-08
sp|B5YXY4|FADJ_ECO5E Fatty acid oxidation complex subunit alpha OS=Escherichia coli O157:H7 (strain EC4115 / EHEC) GN=fadJ PE=3 SV=1 24 207 2.0E-08
sp|A8A2L0|FADJ_ECOHS Fatty acid oxidation complex subunit alpha OS=Escherichia coli O9:H4 (strain HS) GN=fadJ PE=3 SV=1 24 207 2.0E-08
sp|B1IXA5|FADJ_ECOLC Fatty acid oxidation complex subunit alpha OS=Escherichia coli (strain ATCC 8739 / DSM 1576 / Crooks) GN=fadJ PE=3 SV=1 24 207 2.0E-08
sp|B6I6Q4|FADJ_ECOSE Fatty acid oxidation complex subunit alpha OS=Escherichia coli (strain SE11) GN=fadJ PE=3 SV=1 24 207 2.0E-08
sp|B7LBJ5|FADJ_ECO55 Fatty acid oxidation complex subunit alpha OS=Escherichia coli (strain 55989 / EAEC) GN=fadJ PE=3 SV=1 24 207 2.0E-08
sp|A7ZPF8|FADJ_ECO24 Fatty acid oxidation complex subunit alpha OS=Escherichia coli O139:H28 (strain E24377A / ETEC) GN=fadJ PE=3 SV=1 24 207 2.0E-08
sp|Q3YZM2|FADJ_SHISS Fatty acid oxidation complex subunit alpha OS=Shigella sonnei (strain Ss046) GN=fadJ PE=3 SV=1 24 207 2.0E-08
sp|Q83QQ0|FADJ_SHIFL Fatty acid oxidation complex subunit alpha OS=Shigella flexneri GN=fadJ PE=3 SV=1 24 207 2.0E-08
sp|P41942|YKB4_CAEEL Uncharacterized protein B0272.4 OS=Caenorhabditis elegans GN=B0272.4 PE=3 SV=1 23 252 2.0E-08
sp|B2TWV4|FADJ_SHIB3 Fatty acid oxidation complex subunit alpha OS=Shigella boydii serotype 18 (strain CDC 3083-94 / BS512) GN=fadJ PE=3 SV=1 24 207 2.0E-08
sp|Q0T2E6|FADJ_SHIF8 Fatty acid oxidation complex subunit alpha OS=Shigella flexneri serotype 5b (strain 8401) GN=fadJ PE=3 SV=1 24 207 2.0E-08
sp|Q9LKJ1|HIBC1_ARATH 3-hydroxyisobutyryl-CoA hydrolase 1 OS=Arabidopsis thaliana GN=CHY1 PE=1 SV=1 27 219 2.0E-08
sp|Q9T0K7|HIBC6_ARATH 3-hydroxyisobutyryl-CoA hydrolase-like protein 3, mitochondrial OS=Arabidopsis thaliana GN=At4g13360 PE=1 SV=2 24 168 2.0E-08
sp|A4WCW6|FADJ_ENT38 Fatty acid oxidation complex subunit alpha OS=Enterobacter sp. (strain 638) GN=fadJ PE=3 SV=1 24 207 3.0E-08
sp|Q8RXN4|HIBC5_ARATH 3-hydroxyisobutyryl-CoA hydrolase-like protein 2, mitochondrial OS=Arabidopsis thaliana GN=At4g31810 PE=2 SV=1 29 206 4.0E-08
sp|Q9LK08|HIBC7_ARATH 3-hydroxyisobutyryl-CoA hydrolase-like protein 4, mitochondrial OS=Arabidopsis thaliana GN=At3g24360 PE=2 SV=1 24 168 5.0E-08
sp|B1LME7|FADJ_ECOSM Fatty acid oxidation complex subunit alpha OS=Escherichia coli (strain SMS-3-5 / SECEC) GN=fadJ PE=3 SV=1 24 207 6.0E-08
sp|O75521|ECI2_HUMAN Enoyl-CoA delta isomerase 2, mitochondrial OS=Homo sapiens GN=ECI2 PE=1 SV=4 24 240 7.0E-08
sp|B7NP24|FADJ_ECO7I Fatty acid oxidation complex subunit alpha OS=Escherichia coli O7:K1 (strain IAI39 / ExPEC) GN=fadJ PE=3 SV=1 24 207 7.0E-08
sp|Q5E3U1|FADJ_VIBF1 Fatty acid oxidation complex subunit alpha OS=Vibrio fischeri (strain ATCC 700601 / ES114) GN=fadJ PE=3 SV=2 22 205 8.0E-08
sp|Q4ZRA0|FADB_PSEU2 Fatty acid oxidation complex subunit alpha OS=Pseudomonas syringae pv. syringae (strain B728a) GN=fadB PE=3 SV=1 35 207 9.0E-08
sp|Q5R5M8|ECHP_PONAB Peroxisomal bifunctional enzyme OS=Pongo abelii GN=EHHADH PE=2 SV=1 31 207 1.0E-07
sp|Q32DJ4|FADJ_SHIDS Fatty acid oxidation complex subunit alpha OS=Shigella dysenteriae serotype 1 (strain Sd197) GN=fadJ PE=3 SV=1 24 207 1.0E-07
sp|A8ADP2|FADJ_CITK8 Fatty acid oxidation complex subunit alpha OS=Citrobacter koseri (strain ATCC BAA-895 / CDC 4225-83 / SGSC4696) GN=fadJ PE=3 SV=1 24 207 1.0E-07
sp|Q6LTK3|FADJ_PHOPR Fatty acid oxidation complex subunit alpha OS=Photobacterium profundum GN=fadJ PE=3 SV=1 15 204 2.0E-07
sp|Q39TV7|BAMA_GEOMG 6-oxocyclohex-1-ene-1-carbonyl-CoA hydrolase OS=Geobacter metallireducens (strain GS-15 / ATCC 53774 / DSM 7210) GN=bamA PE=1 SV=1 21 244 3.0E-07
sp|A8GH86|FADJ_SERP5 Fatty acid oxidation complex subunit alpha OS=Serratia proteamaculans (strain 568) GN=fadJ PE=3 SV=2 61 204 3.0E-07
sp|Q48GW3|FADB_PSE14 Fatty acid oxidation complex subunit alpha OS=Pseudomonas savastanoi pv. phaseolicola (strain 1448A / Race 6) GN=fadB PE=3 SV=1 35 207 3.0E-07
sp|Q39659|MFPA_CUCSA Glyoxysomal fatty acid beta-oxidation multifunctional protein MFP-a OS=Cucumis sativus PE=1 SV=1 29 207 3.0E-07
sp|P77399|FADJ_ECOLI Fatty acid oxidation complex subunit alpha OS=Escherichia coli (strain K12) GN=fadJ PE=1 SV=1 24 207 3.0E-07
sp|B1X9L4|FADJ_ECODH Fatty acid oxidation complex subunit alpha OS=Escherichia coli (strain K12 / DH10B) GN=fadJ PE=3 SV=1 24 207 3.0E-07
sp|C4ZVN2|FADJ_ECOBW Fatty acid oxidation complex subunit alpha OS=Escherichia coli (strain K12 / MC4100 / BW2952) GN=fadJ PE=3 SV=1 24 207 3.0E-07
sp|A1S7L6|FADJ_SHEAM Fatty acid oxidation complex subunit alpha OS=Shewanella amazonensis (strain ATCC BAA-1098 / SB2B) GN=fadJ PE=3 SV=1 15 207 3.0E-07
sp|A6WHA0|FADB_SHEB8 Fatty acid oxidation complex subunit alpha OS=Shewanella baltica (strain OS185) GN=fadB PE=3 SV=1 10 228 4.0E-07
sp|A3CYJ4|FADB_SHEB5 Fatty acid oxidation complex subunit alpha OS=Shewanella baltica (strain OS155 / ATCC BAA-1091) GN=fadB PE=3 SV=1 10 228 4.0E-07
sp|B8E3R3|FADB_SHEB2 Fatty acid oxidation complex subunit alpha OS=Shewanella baltica (strain OS223) GN=fadB PE=3 SV=1 10 228 5.0E-07
sp|A9KU91|FADB_SHEB9 Fatty acid oxidation complex subunit alpha OS=Shewanella baltica (strain OS195) GN=fadB PE=3 SV=1 10 228 7.0E-07
sp|Q87ZB2|FADB_PSESM Fatty acid oxidation complex subunit alpha OS=Pseudomonas syringae pv. tomato (strain DC3000) GN=fadB PE=3 SV=1 35 207 7.0E-07
sp|Q07ZP8|FADJ_SHEFN Fatty acid oxidation complex subunit alpha OS=Shewanella frigidimarina (strain NCIMB 400) GN=fadJ PE=3 SV=1 15 207 8.0E-07
sp|O87872|BAMA_THAAR 6-oxocyclohex-1-ene-1-carbonyl-CoA hydrolase OS=Thauera aromatica GN=oah PE=1 SV=1 21 178 8.0E-07
sp|Q1CHK2|FADJ_YERPN Fatty acid oxidation complex subunit alpha OS=Yersinia pestis bv. Antiqua (strain Nepal516) GN=fadJ PE=3 SV=2 34 207 8.0E-07
sp|Q8ZD45|FADJ_YERPE Fatty acid oxidation complex subunit alpha OS=Yersinia pestis GN=fadJ PE=3 SV=2 34 207 8.0E-07
sp|Q1C660|FADJ_YERPA Fatty acid oxidation complex subunit alpha OS=Yersinia pestis bv. Antiqua (strain Antiqua) GN=fadJ PE=3 SV=2 34 207 8.0E-07
sp|A7FGK1|FADJ_YERP3 Fatty acid oxidation complex subunit alpha OS=Yersinia pseudotuberculosis serotype O:1b (strain IP 31758) GN=fadJ PE=3 SV=1 34 207 8.0E-07
sp|Q668V1|FADJ_YERPS Fatty acid oxidation complex subunit alpha OS=Yersinia pseudotuberculosis serotype I (strain IP32953) GN=fadJ PE=3 SV=2 34 207 8.0E-07
sp|Q7MZ92|FADB_PHOLL Fatty acid oxidation complex subunit alpha OS=Photorhabdus luminescens subsp. laumondii (strain TT01) GN=fadB PE=3 SV=1 10 207 9.0E-07
sp|A1JK30|FADJ_YERE8 Fatty acid oxidation complex subunit alpha OS=Yersinia enterocolitica serotype O:8 / biotype 1B (strain NCTC 13174 / 8081) GN=fadJ PE=3 SV=2 61 207 1.0E-06
sp|A4TM82|FADJ_YERPP Fatty acid oxidation complex subunit alpha OS=Yersinia pestis (strain Pestoides F) GN=fadJ PE=3 SV=1 34 207 1.0E-06
sp|Q08426|ECHP_HUMAN Peroxisomal bifunctional enzyme OS=Homo sapiens GN=EHHADH PE=1 SV=3 35 207 1.0E-06
sp|Q6D2L7|FADJ_PECAS Fatty acid oxidation complex subunit alpha OS=Pectobacterium atrosepticum (strain SCRI 1043 / ATCC BAA-672) GN=fadJ PE=3 SV=1 34 204 1.0E-06
sp|B7LLD0|FADJ_ESCF3 Fatty acid oxidation complex subunit alpha OS=Escherichia fergusonii (strain ATCC 35469 / DSM 13698 / CDC 0568-73) GN=fadJ PE=3 SV=1 22 207 1.0E-06
sp|A0KR50|FADB_SHESA Fatty acid oxidation complex subunit alpha OS=Shewanella sp. (strain ANA-3) GN=fadB PE=3 SV=1 10 228 2.0E-06
sp|A0PJR5|ECHD3_DANRE Enoyl-CoA hydratase domain-containing protein 3, mitochondrial OS=Danio rerio GN=echdc3 PE=2 SV=2 7 241 2.0E-06
sp|B8CH91|FADB_SHEPW Fatty acid oxidation complex subunit alpha OS=Shewanella piezotolerans (strain WP3 / JCM 13877) GN=fadB PE=3 SV=1 10 183 2.0E-06
sp|A8GYG0|FADB_SHEPA Fatty acid oxidation complex subunit alpha OS=Shewanella pealeana (strain ATCC 700345 / ANG-SQ1) GN=fadB PE=3 SV=1 10 183 2.0E-06
sp|A4STF2|FADB_AERS4 Fatty acid oxidation complex subunit alpha OS=Aeromonas salmonicida (strain A449) GN=fadB PE=3 SV=1 10 228 2.0E-06
sp|A0KEL1|FADB_AERHH Fatty acid oxidation complex subunit alpha OS=Aeromonas hydrophila subsp. hydrophila (strain ATCC 7966 / DSM 30187 / JCM 1027 / KCTC 2358 / NCIMB 9240) GN=fadB PE=3 SV=1 10 207 2.0E-06
sp|Q78JN3|ECI3_MOUSE Enoyl-CoA delta isomerase 3, peroxisomal OS=Mus musculus GN=Eci3 PE=1 SV=1 24 246 3.0E-06
sp|A7MQP0|FADB_CROS8 Fatty acid oxidation complex subunit alpha OS=Cronobacter sakazakii (strain ATCC BAA-894) GN=fadB PE=3 SV=1 24 218 3.0E-06
sp|Q0I0T3|FADB_SHESR Fatty acid oxidation complex subunit alpha OS=Shewanella sp. (strain MR-7) GN=fadB PE=3 SV=1 10 228 3.0E-06
sp|Q8EKR9|FADB_SHEON Fatty acid oxidation complex subunit alpha OS=Shewanella oneidensis (strain MR-1) GN=fadB PE=3 SV=1 10 228 3.0E-06
sp|Q8ZNA7|FADJ_SALTY Fatty acid oxidation complex subunit alpha OS=Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) GN=fadJ PE=3 SV=1 24 207 4.0E-06
sp|Q0HPB7|FADB_SHESM Fatty acid oxidation complex subunit alpha OS=Shewanella sp. (strain MR-4) GN=fadB PE=3 SV=1 10 228 4.0E-06
sp|A9N453|FADJ_SALPB Fatty acid oxidation complex subunit alpha OS=Salmonella paratyphi B (strain ATCC BAA-1250 / SPB7) GN=fadJ PE=3 SV=1 24 207 4.0E-06
sp|B4TCA8|FADJ_SALHS Fatty acid oxidation complex subunit alpha OS=Salmonella heidelberg (strain SL476) GN=fadJ PE=3 SV=1 24 207 4.0E-06
sp|B5RCL3|FADJ_SALG2 Fatty acid oxidation complex subunit alpha OS=Salmonella gallinarum (strain 287/91 / NCTC 13346) GN=fadJ PE=3 SV=1 24 207 4.0E-06
sp|Q57LW6|FADJ_SALCH Fatty acid oxidation complex subunit alpha OS=Salmonella choleraesuis (strain SC-B67) GN=fadJ PE=3 SV=1 24 207 4.0E-06
sp|B5EZR9|FADJ_SALA4 Fatty acid oxidation complex subunit alpha OS=Salmonella agona (strain SL483) GN=fadJ PE=3 SV=1 24 207 4.0E-06
sp|B4SZR0|FADJ_SALNS Fatty acid oxidation complex subunit alpha OS=Salmonella newport (strain SL254) GN=fadJ PE=3 SV=1 24 207 4.0E-06
sp|B5FPN1|FADJ_SALDC Fatty acid oxidation complex subunit alpha OS=Salmonella dublin (strain CT_02021853) GN=fadJ PE=3 SV=1 24 207 5.0E-06
sp|A1RDW6|FADB_SHESW Fatty acid oxidation complex subunit alpha OS=Shewanella sp. (strain W3-18-1) GN=fadB PE=3 SV=1 10 228 5.0E-06
sp|A4Y1B6|FADB_SHEPC Fatty acid oxidation complex subunit alpha OS=Shewanella putrefaciens (strain CN-32 / ATCC BAA-453) GN=fadB PE=3 SV=1 10 228 5.0E-06
sp|B5R3R9|FADJ_SALEP Fatty acid oxidation complex subunit alpha OS=Salmonella enteritidis PT4 (strain P125109) GN=fadJ PE=3 SV=1 24 207 5.0E-06
sp|Q8Z4Z0|FADJ_SALTI Fatty acid oxidation complex subunit alpha OS=Salmonella typhi GN=fadJ PE=3 SV=1 24 207 5.0E-06
sp|B0TLB9|FADB_SHEHH Fatty acid oxidation complex subunit alpha OS=Shewanella halifaxensis (strain HAW-EB4) GN=fadB PE=3 SV=1 10 183 5.0E-06
sp|B4TQC2|FADJ_SALSV Fatty acid oxidation complex subunit alpha OS=Salmonella schwarzengrund (strain CVM19633) GN=fadJ PE=3 SV=1 24 207 6.0E-06
sp|B0TL21|FADJ_SHEHH Fatty acid oxidation complex subunit alpha OS=Shewanella halifaxensis (strain HAW-EB4) GN=fadJ PE=3 SV=1 15 205 6.0E-06
sp|Q9Y232|CDYL1_HUMAN Chromodomain Y-like protein OS=Homo sapiens GN=CDYL PE=1 SV=2 60 240 7.0E-06
sp|Q9D7J9|ECHD3_MOUSE Enoyl-CoA hydratase domain-containing protein 3, mitochondrial OS=Mus musculus GN=Echdc3 PE=1 SV=1 24 283 8.0E-06
sp|Q08A39|FADB_SHEFN Fatty acid oxidation complex subunit alpha OS=Shewanella frigidimarina (strain NCIMB 400) GN=fadB PE=3 SV=1 10 207 9.0E-06
[Show less]

GO

GO Term Description Terminal node
GO:0003824 catalytic activity Yes
GO:0003674 molecular_function No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 39 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >OphauB2|7331
MSSPQPLTGYNYEFFNVEQAGEWVAHLEINRPRKLNAFSQPVWQEFGRVFEQLSKDSRVRVVVLSGAGERAFTSG
LDVQAAAQSGPLTSNGEGLDAARKAKSTRAHIEEFQSCVSAMERCEKPVICVLHGVSIGLAIDIACCADVRLCSS
DTRFAVKEVDIGLAADIGTLARLPKVVGTMGWVKEVCMTARDFGASEAASVGFVSRVHGTKAEALAAGIKLAEVL
ASKSPVAVQSTKELLNYGRDHGVADSLRYTAVWNSVALQASDVPMALMSSMQRSKPTFEKL*
Coding >OphauB2|7331
ATGTCTTCACCACAGCCTCTTACGGGATACAACTACGAGTTCTTCAATGTGGAGCAAGCAGGCGAGTGGGTAGCG
CATCTCGAGATTAACCGACCGCGCAAGCTCAACGCCTTTTCGCAGCCCGTGTGGCAGGAATTCGGAAGGGTATTT
GAGCAGCTGAGCAAGGACTCTAGAGTACGAGTCGTGGTGTTGAGCGGCGCGGGAGAGCGGGCCTTTACATCGGGC
CTAGACGTGCAGGCAGCGGCCCAGAGCGGGCCATTGACGAGTAACGGCGAGGGACTAGATGCTGCGAGAAAGGCA
AAGTCGACACGGGCGCACATTGAAGAGTTTCAAAGCTGCGTGAGTGCAATGGAGCGATGTGAGAAGCCCGTCATT
TGTGTATTGCATGGAGTTTCGATTGGTCTGGCCATTGACATTGCCTGCTGTGCCGACGTGCGGCTATGTTCGTCC
GACACACGCTTCGCCGTCAAGGAAGTCGACATTGGGCTGGCAGCTGACATTGGCACGCTGGCACGTCTGCCCAAG
GTGGTTGGGACCATGGGCTGGGTCAAGGAGGTGTGCATGACGGCGCGCGACTTTGGCGCCAGCGAGGCGGCAAGC
GTGGGCTTTGTGAGCCGGGTACACGGGACAAAGGCCGAGGCGCTGGCCGCGGGCATCAAGCTGGCCGAGGTGCTG
GCGAGCAAGAGCCCCGTGGCGGTGCAGAGTACCAAGGAGCTGCTAAACTATGGGCGAGACCACGGCGTGGCGGAT
AGCTTGCGGTATACGGCTGTGTGGAACTCGGTGGCGCTGCAGGCTAGTGATGTGCCCATGGCGCTCATGAGCAGC
ATGCAGCGCAGCAAGCCAACGTTTGAGAAGCTGTAG
Transcript >OphauB2|7331
ATGTCTTCACCACAGCCTCTTACGGGATACAACTACGAGTTCTTCAATGTGGAGCAAGCAGGCGAGTGGGTAGCG
CATCTCGAGATTAACCGACCGCGCAAGCTCAACGCCTTTTCGCAGCCCGTGTGGCAGGAATTCGGAAGGGTATTT
GAGCAGCTGAGCAAGGACTCTAGAGTACGAGTCGTGGTGTTGAGCGGCGCGGGAGAGCGGGCCTTTACATCGGGC
CTAGACGTGCAGGCAGCGGCCCAGAGCGGGCCATTGACGAGTAACGGCGAGGGACTAGATGCTGCGAGAAAGGCA
AAGTCGACACGGGCGCACATTGAAGAGTTTCAAAGCTGCGTGAGTGCAATGGAGCGATGTGAGAAGCCCGTCATT
TGTGTATTGCATGGAGTTTCGATTGGTCTGGCCATTGACATTGCCTGCTGTGCCGACGTGCGGCTATGTTCGTCC
GACACACGCTTCGCCGTCAAGGAAGTCGACATTGGGCTGGCAGCTGACATTGGCACGCTGGCACGTCTGCCCAAG
GTGGTTGGGACCATGGGCTGGGTCAAGGAGGTGTGCATGACGGCGCGCGACTTTGGCGCCAGCGAGGCGGCAAGC
GTGGGCTTTGTGAGCCGGGTACACGGGACAAAGGCCGAGGCGCTGGCCGCGGGCATCAAGCTGGCCGAGGTGCTG
GCGAGCAAGAGCCCCGTGGCGGTGCAGAGTACCAAGGAGCTGCTAAACTATGGGCGAGACCACGGCGTGGCGGAT
AGCTTGCGGTATACGGCTGTGTGGAACTCGGTGGCGCTGCAGGCTAGTGATGTGCCCATGGCGCTCATGAGCAGC
ATGCAGCGCAGCAAGCCAACGTTTGAGAAGCTGTAG
Gene >OphauB2|7331
ATGTCTTCACCACAGCCTCTTACGGGATACAACTACGAGTTCTTCAATGTGGAGCAAGCAGGCGAGTGGGTAGCG
CATCTCGAGATTAACCGACCGCGCAAGCTCAACGCCTTTTCGCAGCCCGTGTGGCAGGAATTCGGAAGGGTATTT
GAGCAGCTGAGCAAGGACTCTAGAGTACGAGTCGTGGTGTTGAGCGGCGCGGGAGAGCGGGCCTTTACATCGGGC
CTAGACGTGCAGGCAGCGGCCCAGAGCGGGCCATTGACGAGTAACGGCGAGGGACTAGATGCTGCGAGAAAGGCA
AAGTCGACACGGGCGCACATTGAAGAGTTTCAAAGCTGCGTGAGTGCAATGGAGCGATGTGAGAAGCGTGAGTAT
TAATACTTTTTTTTTGGAAGTGGGGGGGGGGGGGGNNNNNNNNNNNNNNNNNNNNNNNNNNTGTTGGGAGTCTCT
TTGATTGATTTGAGTCAAAGCTAATGGAAGAGAAAGCCGTCATTTGTGTATTGCATGGAGTTTCGATTGGTCTGG
CCATTGACATTGCCTGCTGTGCCGACGTGCGGCTATGTTCGTCCGACACACGCTTCGCCGTCAAGGAAGTCGACA
TTGGGCTGGCAGCTGACATTGGCACGCTGGCACGTCTGCCCAAGGTGGTTGGGACCATGGGCTGGGTCAAGGAGG
TGTGCATGACGGCGCGCGACTTTGGCGCCAGCGAGGCGGCAAGCGTGGGCTTTGTGAGCCGGGTACACGGGACAA
AGGCCGAGGCGCTGGCCGCGGGCATCAAGCTGGCCGAGGTGCTGGCGAGCAAGAGCCCCGTGGCGGTGCAGAGTA
CCAAGGAGCTGCTAAACTATGGGCGAGACCACGGCGTGGCGGATAGCTTGCGGTATACGGCTGTGTGGAACTCGG
TGGCGCTGCAGGCTAGTGATGTGCCCATGGCGCTCATGAGCAGCATGCAGCGCAGCAAGCCAACGTTTGAGAAGC
TGTAG

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail