Fungal Genomics

at Utrecht University

General Properties

Protein IDOphauB2|7328
Gene name
LocationContig_78:53..417
Strand+
Gene length (bp)364
Transcript length (bp)306
Coding sequence length (bp)306
Protein length (aa) 102

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF01257 2Fe-2S_thioredx Thioredoxin-like [2Fe-2S] ferredoxin 3.4E-15 10 52

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|P40915|NDUV2_NEUCR NADH-ubiquinone oxidoreductase 24 kDa subunit, mitochondrial OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=nuo-24 PE=2 SV=1 11 101 2.0E-34
sp|P19234|NDUV2_RAT NADH dehydrogenase [ubiquinone] flavoprotein 2, mitochondrial OS=Rattus norvegicus GN=Ndufv2 PE=1 SV=2 12 93 2.0E-24
sp|P04394|NDUV2_BOVIN NADH dehydrogenase [ubiquinone] flavoprotein 2, mitochondrial OS=Bos taurus GN=NDUFV2 PE=1 SV=3 12 93 1.0E-23
sp|Q9D6J6|NDUV2_MOUSE NADH dehydrogenase [ubiquinone] flavoprotein 2, mitochondrial OS=Mus musculus GN=Ndufv2 PE=1 SV=2 4 93 2.0E-23
sp|Q0MQI7|NDUV2_PONPY NADH dehydrogenase [ubiquinone] flavoprotein 2, mitochondrial OS=Pongo pygmaeus GN=NDUFV2 PE=2 SV=1 12 93 2.0E-22
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|P40915|NDUV2_NEUCR NADH-ubiquinone oxidoreductase 24 kDa subunit, mitochondrial OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=nuo-24 PE=2 SV=1 11 101 2.0E-34
sp|P19234|NDUV2_RAT NADH dehydrogenase [ubiquinone] flavoprotein 2, mitochondrial OS=Rattus norvegicus GN=Ndufv2 PE=1 SV=2 12 93 2.0E-24
sp|P04394|NDUV2_BOVIN NADH dehydrogenase [ubiquinone] flavoprotein 2, mitochondrial OS=Bos taurus GN=NDUFV2 PE=1 SV=3 12 93 1.0E-23
sp|Q9D6J6|NDUV2_MOUSE NADH dehydrogenase [ubiquinone] flavoprotein 2, mitochondrial OS=Mus musculus GN=Ndufv2 PE=1 SV=2 4 93 2.0E-23
sp|Q0MQI7|NDUV2_PONPY NADH dehydrogenase [ubiquinone] flavoprotein 2, mitochondrial OS=Pongo pygmaeus GN=NDUFV2 PE=2 SV=1 12 93 2.0E-22
sp|Q0MQI9|NDUV2_PANTR NADH dehydrogenase [ubiquinone] flavoprotein 2, mitochondrial OS=Pan troglodytes GN=NDUFV2 PE=2 SV=1 12 93 2.0E-22
sp|Q0MQI8|NDUV2_GORGO NADH dehydrogenase [ubiquinone] flavoprotein 2, mitochondrial OS=Gorilla gorilla gorilla GN=NDUFV2 PE=2 SV=1 12 93 2.0E-22
sp|P19404|NDUV2_HUMAN NADH dehydrogenase [ubiquinone] flavoprotein 2, mitochondrial OS=Homo sapiens GN=NDUFV2 PE=1 SV=2 12 93 2.0E-22
sp|Q20719|NDUV2_CAEEL Probable NADH dehydrogenase [ubiquinone] flavoprotein 2, mitochondrial OS=Caenorhabditis elegans GN=F53F4.10 PE=3 SV=1 9 93 1.0E-19
sp|Q54F10|NDUV2_DICDI NADH dehydrogenase [ubiquinone] flavoprotein 2, mitochondrial OS=Dictyostelium discoideum GN=ndufv2 PE=3 SV=1 13 93 2.0E-16
sp|Q1RJJ1|NUOE_RICBR NADH-quinone oxidoreductase subunit E OS=Rickettsia bellii (strain RML369-C) GN=nuoE PE=3 SV=1 13 53 2.0E-14
sp|P29914|NQO2_PARDE NADH-quinone oxidoreductase chain 2 OS=Paracoccus denitrificans GN=nqo2 PE=1 SV=1 11 89 1.0E-13
sp|Q4UM09|NUOE_RICFE NADH-quinone oxidoreductase subunit E OS=Rickettsia felis (strain ATCC VR-1525 / URRWXCal2) GN=nuoE PE=3 SV=1 13 49 2.0E-11
sp|Q92ID9|NUOE_RICCN NADH-quinone oxidoreductase subunit E OS=Rickettsia conorii (strain ATCC VR-613 / Malish 7) GN=nuoE PE=3 SV=1 13 53 3.0E-11
sp|Q9ZDH5|NUOE_RICPR NADH-quinone oxidoreductase subunit E OS=Rickettsia prowazekii (strain Madrid E) GN=nuoE PE=3 SV=1 4 49 3.0E-10
sp|Q68X20|NUOE_RICTY NADH-quinone oxidoreductase subunit E OS=Rickettsia typhi (strain ATCC VR-144 / Wilmington) GN=nuoE PE=3 SV=1 4 49 3.0E-10
sp|O22769|NDUV2_ARATH NADH dehydrogenase [ubiquinone] flavoprotein 2, mitochondrial OS=Arabidopsis thaliana GN=At4g02580 PE=2 SV=3 9 91 4.0E-10
sp|P56909|NUOE1_RHIME NADH-quinone oxidoreductase subunit E 1 OS=Rhizobium meliloti (strain 1021) GN=nuoE1 PE=3 SV=1 11 69 6.0E-09
sp|P56910|NUOE2_RHIME NADH-quinone oxidoreductase subunit E 2 OS=Rhizobium meliloti (strain 1021) GN=nuoE2 PE=3 SV=2 11 70 7.0E-07
sp|Q56221|NQO2_THET8 NADH-quinone oxidoreductase subunit 2 OS=Thermus thermophilus (strain HB8 / ATCC 27634 / DSM 579) GN=nqo2 PE=1 SV=3 11 68 5.0E-06
[Show less]

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
Yes 1 - 23 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >OphauB2|7328
MPARRLRLRHGLFSFIEVECLGACVNAPMIQINDDYYEDLTPESVVELLKALRASTEASSPAEAKVPGPGPLSGR
QTCENSKGQTNLLEEPWGIEKTRSDL*
Coding >OphauB2|7328
ATGCCAGCTCGGCGGCTGCGGCTCAGACACGGCCTCTTTAGCTTCATCGAGGTGGAGTGTCTGGGCGCATGCGTC
AATGCCCCCATGATTCAAATAAATGACGACTACTACGAGGACCTGACGCCCGAGTCGGTTGTCGAGCTGCTCAAG
GCTCTGCGCGCTAGTACAGAGGCCAGCTCTCCGGCAGAGGCCAAGGTTCCCGGCCCGGGACCCCTAAGCGGTCGC
CAGACATGCGAGAATAGCAAGGGCCAAACAAATTTGCTCGAGGAGCCGTGGGGCATAGAAAAGACCAGGTCGGAT
TTGTAG
Transcript >OphauB2|7328
ATGCCAGCTCGGCGGCTGCGGCTCAGACACGGCCTCTTTAGCTTCATCGAGGTGGAGTGTCTGGGCGCATGCGTC
AATGCCCCCATGATTCAAATAAATGACGACTACTACGAGGACCTGACGCCCGAGTCGGTTGTCGAGCTGCTCAAG
GCTCTGCGCGCTAGTACAGAGGCCAGCTCTCCGGCAGAGGCCAAGGTTCCCGGCCCGGGACCCCTAAGCGGTCGC
CAGACATGCGAGAATAGCAAGGGCCAAACAAATTTGCTCGAGGAGCCGTGGGGCATAGAAAAGACCAGGTCGGAT
TTGTAG
Gene >OphauB2|7328
ATGCCAGCTCGGCGGCTGCGGCTCAGACGTCATCGTCAAGGCCATCAAGGCCCATCTCGGCATCGAGCAGGGCCA
GACTACGCCAGACGGCCTCTTTAGCTTCATCGAGGTGGAGTGTCTGGGCGCATGCGTCAATGCCCCCATGATTCA
AATAAATGACGACTACTACGAGGACCTGACGCCCGAGTCGGTTGTCGAGCTGCTCAAGGCTCTGCGCGCTAGTAC
AGAGGCCAGCTCTCCGGCAGAGGCCAAGGTTCCCGGCCCGGGACCCCTAAGCGGTCGCCAGACATGCGAGAATAG
CAAGGGCCAAACAAATTTGCTCGAGGAGCCGTGGGGCATAGAAAAGACCAGGTCGGATTTGTAG

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail