Fungal Genomics

at Utrecht University

General Properties

Protein IDOphauB2|7324
Gene name
LocationContig_77:80828..82634
Strand-
Gene length (bp)1806
Transcript length (bp)1578
Coding sequence length (bp)1578
Protein length (aa) 526

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF11781 zf-RRN7 Zinc-finger of RNA-polymerase I-specific TFIIB, Rrn7 1.1E-07 11 41

Swissprot hits

Swissprot ID Swissprot Description Start End E-value
sp|Q9UST5|RRN7_SCHPO RNA polymerase I-specific transcription initiation factor rrn7 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=rrn7 PE=1 SV=1 6 416 1.0E-15
sp|P40992|RRN7_YEAST RNA polymerase I-specific transcription initiation factor RRN7 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=RRN7 PE=1 SV=1 19 237 5.0E-09

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 11 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >OphauB2|7324
MAQTGVEGRMPPGERCYECGSQRWYLQDGERFCSRGHQIEGFTQYGATQEDLSSRVGRVARRKVDKLSREPDRLN
PSQGKALYLEALQLLLRRELWWLVQEQNFPSQIETVVRHLWDLRIRGSDCDNHRGQMETESGGEPQYFSSQDLPQ
VEDQRVSKTGSRIQSWNSERGEHWPLPSPLDTLALCYLGSVLLRTPFLIGELLCWTNDGSLPYQTAFQDLPQEMQ
SSLPLRHANVLKQLLRRQVKGEQIHRTIINQVLSFNFNYGLRFPGIMEIPCIVKYAALLALPIETVIVTKRLSTL
LDCLWEYPIDKPRLQPLDSPEIQLIALVIVATKLCFPFKLGDQLIKGLPLLDWDCWKASLDESKQHKEAGGRQGR
FDHVTPSQVVNMCDSDLDAYFQHIESMASMHTESGLTSLFPSQRTSTEFSTERHHDASEAATEARASDILGLALT
LPSEDDARHSEADFTDTHDIYPSFRKVEDLTGKALELYTAVAEVSGLSIEMVIKAVYMQEKKLLAWQNAKPAVVT
*
Coding >OphauB2|7324
ATGGCACAGACAGGCGTTGAGGGGAGGATGCCTCCGGGCGAAAGGTGCTATGAGTGTGGCAGCCAGAGATGGTAC
TTGCAAGACGGCGAACGGTTTTGCTCCAGAGGGCATCAGATTGAAGGTTTCACACAGTATGGTGCCACACAAGAG
GACTTGTCGAGTCGGGTCGGGCGGGTGGCGCGGCGAAAGGTAGACAAGCTATCCAGAGAGCCAGATCGACTTAAT
CCATCACAGGGCAAGGCGCTGTATCTCGAGGCTCTTCAGCTGCTCCTACGGAGGGAGCTCTGGTGGCTGGTCCAA
GAGCAAAACTTTCCATCGCAAATTGAAACAGTTGTCCGCCACTTGTGGGACCTTCGCATTCGAGGATCCGACTGT
GACAATCACCGAGGCCAAATGGAAACTGAATCTGGGGGTGAGCCACAGTACTTCAGCTCCCAGGACCTGCCTCAA
GTAGAGGATCAAAGAGTTTCCAAGACTGGATCAAGAATCCAGAGTTGGAATTCAGAGCGTGGCGAGCACTGGCCG
CTGCCTAGTCCTTTGGATACTTTGGCACTCTGCTACCTTGGCTCGGTGCTCCTCAGGACGCCTTTTCTCATTGGC
GAACTACTTTGTTGGACTAATGACGGCTCTTTGCCTTATCAAACGGCTTTTCAAGACTTGCCACAGGAAATGCAG
TCTTCTTTGCCACTGCGGCACGCCAATGTACTCAAGCAGCTCTTACGACGTCAAGTCAAGGGGGAGCAGATCCAT
AGGACTATTATAAACCAGGTCCTTTCTTTCAATTTCAATTATGGTCTTAGATTTCCCGGCATCATGGAGATTCCA
TGTATCGTCAAGTACGCAGCCCTACTTGCCTTGCCAATCGAGACAGTCATAGTGACGAAGCGGTTATCGACCTTG
TTGGATTGCCTCTGGGAATATCCGATTGATAAACCGAGGTTACAGCCTTTGGACAGCCCTGAAATACAGTTGATC
GCACTTGTCATTGTCGCAACAAAACTGTGCTTCCCATTCAAACTCGGCGATCAACTAATCAAAGGCTTGCCGCTG
TTGGATTGGGACTGCTGGAAGGCTTCTCTGGACGAGTCAAAACAGCACAAAGAAGCGGGTGGACGCCAAGGTCGC
TTTGACCATGTCACGCCAAGCCAGGTAGTCAATATGTGCGACAGCGATTTGGATGCCTACTTTCAGCATATTGAA
AGCATGGCGTCAATGCATACCGAGAGCGGGTTGACGAGCCTATTTCCAAGCCAAAGAACCAGCACAGAGTTTAGC
ACAGAGCGTCATCATGATGCGTCAGAGGCCGCGACTGAAGCTCGAGCCAGTGATATACTGGGCCTGGCTTTGACG
TTGCCGTCGGAAGATGATGCTCGTCACTCCGAGGCGGACTTTACAGACACTCATGATATATATCCCTCATTTCGA
AAGGTCGAAGACTTGACAGGAAAGGCCCTCGAGCTGTATACAGCAGTCGCTGAGGTTTCAGGGCTGTCCATTGAG
ATGGTTATCAAGGCTGTTTATATGCAAGAGAAGAAGCTGCTAGCATGGCAAAACGCCAAGCCAGCTGTAGTGACT
TGA
Transcript >OphauB2|7324
ATGGCACAGACAGGCGTTGAGGGGAGGATGCCTCCGGGCGAAAGGTGCTATGAGTGTGGCAGCCAGAGATGGTAC
TTGCAAGACGGCGAACGGTTTTGCTCCAGAGGGCATCAGATTGAAGGTTTCACACAGTATGGTGCCACACAAGAG
GACTTGTCGAGTCGGGTCGGGCGGGTGGCGCGGCGAAAGGTAGACAAGCTATCCAGAGAGCCAGATCGACTTAAT
CCATCACAGGGCAAGGCGCTGTATCTCGAGGCTCTTCAGCTGCTCCTACGGAGGGAGCTCTGGTGGCTGGTCCAA
GAGCAAAACTTTCCATCGCAAATTGAAACAGTTGTCCGCCACTTGTGGGACCTTCGCATTCGAGGATCCGACTGT
GACAATCACCGAGGCCAAATGGAAACTGAATCTGGGGGTGAGCCACAGTACTTCAGCTCCCAGGACCTGCCTCAA
GTAGAGGATCAAAGAGTTTCCAAGACTGGATCAAGAATCCAGAGTTGGAATTCAGAGCGTGGCGAGCACTGGCCG
CTGCCTAGTCCTTTGGATACTTTGGCACTCTGCTACCTTGGCTCGGTGCTCCTCAGGACGCCTTTTCTCATTGGC
GAACTACTTTGTTGGACTAATGACGGCTCTTTGCCTTATCAAACGGCTTTTCAAGACTTGCCACAGGAAATGCAG
TCTTCTTTGCCACTGCGGCACGCCAATGTACTCAAGCAGCTCTTACGACGTCAAGTCAAGGGGGAGCAGATCCAT
AGGACTATTATAAACCAGGTCCTTTCTTTCAATTTCAATTATGGTCTTAGATTTCCCGGCATCATGGAGATTCCA
TGTATCGTCAAGTACGCAGCCCTACTTGCCTTGCCAATCGAGACAGTCATAGTGACGAAGCGGTTATCGACCTTG
TTGGATTGCCTCTGGGAATATCCGATTGATAAACCGAGGTTACAGCCTTTGGACAGCCCTGAAATACAGTTGATC
GCACTTGTCATTGTCGCAACAAAACTGTGCTTCCCATTCAAACTCGGCGATCAACTAATCAAAGGCTTGCCGCTG
TTGGATTGGGACTGCTGGAAGGCTTCTCTGGACGAGTCAAAACAGCACAAAGAAGCGGGTGGACGCCAAGGTCGC
TTTGACCATGTCACGCCAAGCCAGGTAGTCAATATGTGCGACAGCGATTTGGATGCCTACTTTCAGCATATTGAA
AGCATGGCGTCAATGCATACCGAGAGCGGGTTGACGAGCCTATTTCCAAGCCAAAGAACCAGCACAGAGTTTAGC
ACAGAGCGTCATCATGATGCGTCAGAGGCCGCGACTGAAGCTCGAGCCAGTGATATACTGGGCCTGGCTTTGACG
TTGCCGTCGGAAGATGATGCTCGTCACTCCGAGGCGGACTTTACAGACACTCATGATATATATCCCTCATTTCGA
AAGGTCGAAGACTTGACAGGAAAGGCCCTCGAGCTGTATACAGCAGTCGCTGAGGTTTCAGGGCTGTCCATTGAG
ATGGTTATCAAGGCTGTTTATATGCAAGAGAAGAAGCTGCTAGCATGGCAAAACGCCAAGCCAGCTGTAGTGACT
TGA
Gene >OphauB2|7324
ATGGCACAGACAGGCGTTGAGGGGAGGATGCCTCCGGGCGAAAGGTGCTATGAGTGTGGCAGCCAGAGATGGTAC
TTGCAAGACGGCGAACGGTTTTGCTCCAGAGGGCATCAGATTGAAGTGGGCATATTGAGGCACACGGACATGGAA
ATCTATCGCTAACTATAATCACAGGGTTTCACACAGTATGGTGCCACACAAGAGGACTTGTCGAGTCGGGTCGGG
CGGGTGGCGCGGCGAAAGGTAGACAAGCTATCCAGAGAGCCAGATCGACTTAATCCATCACAGGGCAAGGCGCTG
TATCTCGAGGCTCTTCAGCTGCTCCTACGGAGGGAGCTCTGGTGGCTGGTCCAAGAGCAAAACTTTCCATCGCAA
ATTGAAACAGTTGTCCGCCACTTGTGGGACCTTCGCATTCGAGGATCCGACTGTGACAATCACCGAGGCCAAATG
GAAACTGAATCTGGGGGTGAGCCACAGTACTTCAGCTCCCAGGACCTGCCTCAAGTAGAGGATCAAAGAGTTTCC
AAGACTGGATCAAGAATCCAGAGTTGGAATTCAGAGCGTGGCGAGCACTGGCCGCTGCCTAGTCCTTTGGATACT
TTGGCACTCTGCTACCTTGGCTCGGTGCTCCTCAGGACGCCTTTTCTCATTGGCGAACTACTTTGTTGGACTAAT
GACGGCTCTTTGCCTTATCAAACGGCTGTGAGTTGGAAAAAACTATCTTGAGCCTGGCACAGGCTAATTGCTCTT
CTTATGAAATCTCATGCCCGCAGTTTCAAGACTTGCCACAGGAAATGCAGTCTTCTTTGCCACTGCGGCACGCCA
ATGTACTCAAGCAGCTCTTACGACGTCAAGTCAAGGGGGAGCAGATCCATAGGACTATTATAAACCAGGTCCTTT
CTTTCAATTTCAATTATGGTCTTAGATTTCCCGGCATCATGGAGATTCCATGTATCGTCAAGTACGCAGCCCTAC
TTGCCTTGCCAAGTAAGTTTCTTTCAACGTTGAAACTGCCCGGGGCGTGACTGACTAGACCACAGTCGAGACAGT
CATAGTGACGAAGCGGTTATCGACCTTGTTGGATTGCCTCTGGGAATATCCGATTGATAAACCGAGGTTACAGCC
TTTGGACAGCCCTGAAATACAGTTGATCGCACTTGTCATTGTCGCAACAAAACTGTGCTTCCCATTCAAACTCGG
CGATCAACTAATCAAAGGCTTGCCGCTGTTGGATTGGGACTGCTGGAAGGCTTCTCTGGACGAGTCAAAACAGCA
CAAAGAAGCGGGTGGACGCCAAGGTCGCTTTGACCATGTCACGCCAAGCCAGGTAGTCAATATGTGCGACAGCGA
TTTGGATGCCTACTTTCAGCATATTGAAAGCATGGCGTCAATGCATAGTAAGCCGTGTGACTTGGTCGGTTGAGG
AGAGTTGCTAACAGAAGAAAAGCCGAGAGCGGGTTGACGAGCCTATTTCCAAGCCAAAGAACCAGCACAGAGTTT
AGCACAGAGCGTCATCATGATGCGTCAGAGGCCGCGACTGAAGCTCGAGCCAGTGATATACTGGGCCTGGCTTTG
ACGTTGCCGTCGGAAGATGATGCTCGTCACTCCGAGGCGGACTTTACAGACACTCATGATATATATCCCTCATTT
CGAAAGGTCGAAGACTTGACAGGAAAGGCCCTCGAGCTGTATACAGCAGTCGCTGAGGTTTCAGGGCTGTCCATT
GAGATGGTTATCAAGGCTGTTTATATGCAAGAGAAGAAGCTGCTAGCATGGCAAAACGCCAAGCCAGCTGTAGTG
ACTTGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail