Fungal Genomics

at Utrecht University

General Properties

Protein IDOphauB2|7321
Gene name
LocationContig_77:77273..77965
Strand+
Gene length (bp)692
Transcript length (bp)567
Coding sequence length (bp)567
Protein length (aa) 189

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00581 Rhodanese Rhodanese-like domain 6.5E-13 67 173

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q08742|RDL2_YEAST Thiosulfate sulfurtransferase RDL2, mitochondrial OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=RDL2 PE=1 SV=1 63 176 2.0E-22
sp|Q12305|RDL1_YEAST Thiosulfate sulfurtransferase RDL1, mitochondrial OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=RDL1 PE=1 SV=1 64 176 3.0E-15
sp|P22978|HS6B_DROME Heat shock protein 67B2 OS=Drosophila melanogaster GN=Hsp67Bb PE=2 SV=1 65 176 2.0E-14
sp|Q10215|RDL_SCHPO Putative thiosulfate sulfurtransferase, mitochondrial OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC4H3.07c PE=3 SV=2 50 171 5.0E-14
sp|Q9D0B5|TSTD3_MOUSE Thiosulfate sulfurtransferase/rhodanese-like domain-containing protein 3 OS=Mus musculus GN=Tstd3 PE=1 SV=1 80 180 2.0E-08
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q08742|RDL2_YEAST Thiosulfate sulfurtransferase RDL2, mitochondrial OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=RDL2 PE=1 SV=1 63 176 2.0E-22
sp|Q12305|RDL1_YEAST Thiosulfate sulfurtransferase RDL1, mitochondrial OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=RDL1 PE=1 SV=1 64 176 3.0E-15
sp|P22978|HS6B_DROME Heat shock protein 67B2 OS=Drosophila melanogaster GN=Hsp67Bb PE=2 SV=1 65 176 2.0E-14
sp|Q10215|RDL_SCHPO Putative thiosulfate sulfurtransferase, mitochondrial OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC4H3.07c PE=3 SV=2 50 171 5.0E-14
sp|Q9D0B5|TSTD3_MOUSE Thiosulfate sulfurtransferase/rhodanese-like domain-containing protein 3 OS=Mus musculus GN=Tstd3 PE=1 SV=1 80 180 2.0E-08
sp|Q50036|THTR_MYCLE Putative thiosulfate sulfurtransferase OS=Mycobacterium leprae (strain TN) GN=cysA PE=3 SV=1 81 179 8.0E-07
sp|P16385|THTR_SACER Putative thiosulfate sulfurtransferase OS=Saccharopolyspora erythraea GN=cysA PE=1 SV=1 81 186 1.0E-06
[Show less]

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 22 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >OphauB2|7321
MAARTRCTRLLYPSLPHLVSPRLVAAPLPAAAIPVLRRQPLHSPGQGHLRRWYSVSDADSTPIWSFERVQQHLDQ
PGAHVHLVDVREPDEVDSTGKIPRALVIPMSLALRTDCFGMSDDDFVETLGFARPPRNQTLVFYCAAGIRAAHAC
RLARLAGWENVAAYKGSMNEWLARRGPVERLPGKGAAA*
Coding >OphauB2|7321
ATGGCAGCTCGCACGCGCTGCACCCGCCTCCTCTACCCATCATTGCCGCATCTCGTCTCACCTAGACTAGTCGCC
GCACCGCTTCCCGCCGCAGCTATACCAGTTTTGCGACGCCAGCCGCTTCATAGCCCCGGCCAAGGGCATCTACGT
CGCTGGTACTCTGTTTCCGACGCTGATTCTACGCCTATATGGAGCTTTGAGCGGGTACAGCAGCATCTTGACCAG
CCTGGTGCTCATGTCCATCTCGTTGACGTTCGCGAGCCAGACGAAGTAGATTCAACGGGCAAGATTCCCCGCGCC
CTTGTTATTCCCATGTCGCTCGCCCTGCGCACCGACTGTTTCGGCATGTCAGACGACGACTTTGTCGAGACGCTT
GGCTTTGCGCGTCCGCCGCGCAACCAGACTCTGGTGTTTTACTGCGCTGCGGGTATTCGTGCCGCGCATGCCTGT
CGGCTTGCTAGGCTGGCGGGATGGGAAAACGTGGCGGCGTACAAGGGCAGCATGAATGAGTGGCTGGCTAGGCGG
GGGCCTGTGGAGCGGCTGCCTGGCAAGGGGGCGGCTGCGTAG
Transcript >OphauB2|7321
ATGGCAGCTCGCACGCGCTGCACCCGCCTCCTCTACCCATCATTGCCGCATCTCGTCTCACCTAGACTAGTCGCC
GCACCGCTTCCCGCCGCAGCTATACCAGTTTTGCGACGCCAGCCGCTTCATAGCCCCGGCCAAGGGCATCTACGT
CGCTGGTACTCTGTTTCCGACGCTGATTCTACGCCTATATGGAGCTTTGAGCGGGTACAGCAGCATCTTGACCAG
CCTGGTGCTCATGTCCATCTCGTTGACGTTCGCGAGCCAGACGAAGTAGATTCAACGGGCAAGATTCCCCGCGCC
CTTGTTATTCCCATGTCGCTCGCCCTGCGCACCGACTGTTTCGGCATGTCAGACGACGACTTTGTCGAGACGCTT
GGCTTTGCGCGTCCGCCGCGCAACCAGACTCTGGTGTTTTACTGCGCTGCGGGTATTCGTGCCGCGCATGCCTGT
CGGCTTGCTAGGCTGGCGGGATGGGAAAACGTGGCGGCGTACAAGGGCAGCATGAATGAGTGGCTGGCTAGGCGG
GGGCCTGTGGAGCGGCTGCCTGGCAAGGGGGCGGCTGCGTAG
Gene >OphauB2|7321
ATGGCAGCTCGCACGCGCTGCACCCGCCTCCTCTACCCATCATTGCCGCATCTCGTCTCACCTAGACTAGTCGCC
GCACCGCTTCCCGCCGCAGCTATACCAGTTTTGCGACGCCAGCCGCTTCATAGCCCCGGCCAAGGGCATCTACGT
CGCTGGTACTCTGTTTCCGACGCTGATTCTACGCCTATATGGAGCTTTGAGCGGGTACAGCAGCATCTTGACCAG
CCTGGTGCTCATGTCCATCTCGTTGGTACGTTAAAGGCGTCGCTTGATTTTGAAATTTATATTTTCTTTCTTCTT
CTTCTTCTTGTTGAATCTATATTTTTTTCTTGAATTACTCTGCGTCTCGGTATCGACTAAACATTTTTTTATTAG
ACGTTCGCGAGCCAGACGAAGTAGATTCAACGGGCAAGATTCCCCGCGCCCTTGTTATTCCCATGTCGCTCGCCC
TGCGCACCGACTGTTTCGGCATGTCAGACGACGACTTTGTCGAGACGCTTGGCTTTGCGCGTCCGCCGCGCAACC
AGACTCTGGTGTTTTACTGCGCTGCGGGTATTCGTGCCGCGCATGCCTGTCGGCTTGCTAGGCTGGCGGGATGGG
AAAACGTGGCGGCGTACAAGGGCAGCATGAATGAGTGGCTGGCTAGGCGGGGGCCTGTGGAGCGGCTGCCTGGCA
AGGGGGCGGCTGCGTAG

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail