Fungal Genomics

at Utrecht University

General Properties

Protein IDOphauB2|7320
Gene name
LocationContig_77:74690..76590
Strand+
Gene length (bp)1900
Transcript length (bp)1629
Coding sequence length (bp)1629
Protein length (aa) 543

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00067 p450 Cytochrome P450 4.8E-51 79 518

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|P54781|ERG5_YEAST Cytochrome P450 61 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=ERG5 PE=1 SV=1 38 542 0.0E+00
sp|O13820|ERG5_SCHPO Cytochrome P450 61 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=erg5 PE=1 SV=3 37 537 0.0E+00
sp|Q55EK2|C524A_DICDI Probable cytochrome P450 524A1 OS=Dictyostelium discoideum GN=cyp524A1 PE=3 SV=1 6 541 2.0E-77
sp|O64697|C7101_ARATH Cytochrome P450 710A1 OS=Arabidopsis thaliana GN=CYP710A1 PE=1 SV=1 51 540 5.0E-71
sp|Q9ZV28|C7104_ARATH Cytochrome P450 710A1 OS=Arabidopsis thaliana GN=CYP710A4 PE=2 SV=1 66 540 7.0E-66
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|P54781|ERG5_YEAST Cytochrome P450 61 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=ERG5 PE=1 SV=1 38 542 0.0E+00
sp|O13820|ERG5_SCHPO Cytochrome P450 61 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=erg5 PE=1 SV=3 37 537 0.0E+00
sp|Q55EK2|C524A_DICDI Probable cytochrome P450 524A1 OS=Dictyostelium discoideum GN=cyp524A1 PE=3 SV=1 6 541 2.0E-77
sp|O64697|C7101_ARATH Cytochrome P450 710A1 OS=Arabidopsis thaliana GN=CYP710A1 PE=1 SV=1 51 540 5.0E-71
sp|Q9ZV28|C7104_ARATH Cytochrome P450 710A1 OS=Arabidopsis thaliana GN=CYP710A4 PE=2 SV=1 66 540 7.0E-66
sp|O64698|C7102_ARATH Cytochrome P450 710A2 OS=Arabidopsis thaliana GN=CYP710A2 PE=2 SV=1 51 540 4.0E-63
sp|P79739|CP26A_DANRE Cytochrome P450 26A1 OS=Danio rerio GN=cyp26a1 PE=2 SV=1 80 537 4.0E-26
sp|O43174|CP26A_HUMAN Cytochrome P450 26A1 OS=Homo sapiens GN=CYP26A1 PE=2 SV=2 142 537 1.0E-23
sp|Q6A152|CP4X1_MOUSE Cytochrome P450 4X1 OS=Mus musculus GN=Cyp4x1 PE=1 SV=1 330 499 2.0E-23
sp|Q8K4D6|CP4X1_RAT Cytochrome P450 4X1 OS=Rattus norvegicus GN=Cyp4x1 PE=2 SV=1 318 499 6.0E-23
sp|O55127|CP26A_MOUSE Cytochrome P450 26A1 OS=Mus musculus GN=Cyp26a1 PE=2 SV=1 142 537 9.0E-23
sp|Q9PUB4|CP26A_CHICK Cytochrome P450 26A1 OS=Gallus gallus GN=CYP26A1 PE=2 SV=1 142 537 2.0E-21
sp|Q6V0L0|CP26C_HUMAN Cytochrome P450 26C1 OS=Homo sapiens GN=CYP26C1 PE=2 SV=2 141 542 1.0E-20
sp|Q0J185|ABAH3_ORYSJ Abscisic acid 8'-hydroxylase 3 OS=Oryza sativa subsp. japonica GN=CYP707A7 PE=2 SV=1 81 510 1.0E-20
sp|A2Z212|ABAH3_ORYSI Abscisic acid 8'-hydroxylase 3 OS=Oryza sativa subsp. indica GN=CYP707A7 PE=3 SV=1 81 510 2.0E-20
sp|Q59990|CP120_SYNY3 Putative cytochrome P450 120 OS=Synechocystis sp. (strain PCC 6803 / Kazusa) GN=cyp120 PE=1 SV=1 68 511 4.0E-20
sp|P51871|CP4F6_RAT Cytochrome P450 4F6 OS=Rattus norvegicus GN=Cyp4f6 PE=2 SV=1 332 507 4.0E-20
sp|P51870|CP4F5_RAT Cytochrome P450 4F5 OS=Rattus norvegicus GN=Cyp4f5 PE=2 SV=1 332 493 1.0E-19
sp|Q9CA60|C98A9_ARATH Cytochrome P450 98A9 OS=Arabidopsis thaliana GN=CYP98A9 PE=1 SV=1 50 516 5.0E-19
sp|Q6WG30|T5H_TAXCU Taxadiene 5-alpha hydroxylase OS=Taxus cuspidata PE=1 SV=2 145 501 5.0E-19
sp|Q6NT55|CP4FN_HUMAN Cytochrome P450 4F22 OS=Homo sapiens GN=CYP4F22 PE=2 SV=1 332 497 7.0E-19
sp|Q9LJK2|ABAH4_ARATH Abscisic acid 8'-hydroxylase 4 OS=Arabidopsis thaliana GN=CYP707A4 PE=2 SV=2 48 541 9.0E-19
sp|P51869|CP4F4_RAT Cytochrome P450 4F4 OS=Rattus norvegicus GN=Cyp4f4 PE=2 SV=1 332 507 1.0E-18
sp|Q9W011|C4D20_DROME Probable cytochrome P450 4d20 OS=Drosophila melanogaster GN=Cyp4d20 PE=3 SV=1 332 522 1.0E-18
sp|Q9VXY0|CP4S3_DROME Probable cytochrome P450 4s3 OS=Drosophila melanogaster GN=Cyp4s3 PE=3 SV=1 332 532 1.0E-18
sp|P78329|CP4F2_HUMAN Phylloquinone omega-hydroxylase CYP4F2 OS=Homo sapiens GN=CYP4F2 PE=1 SV=1 330 502 3.0E-18
sp|Q9V4U7|C6A14_DROME Probable cytochrome P450 6a14 OS=Drosophila melanogaster GN=Cyp6a14 PE=3 SV=2 298 541 3.0E-18
sp|Q949P1|ABAH1_ARATH Abscisic acid 8'-hydroxylase 1 OS=Arabidopsis thaliana GN=CYP707A1 PE=2 SV=1 86 540 4.0E-18
sp|Q8SPK0|CP4AP_PIG Cytochrome P450 4A25 OS=Sus scrofa GN=CYP4A25 PE=2 SV=1 332 493 4.0E-18
sp|Q08477|CP4F3_HUMAN Docosahexaenoic acid omega-hydroxylase CYP4F3 OS=Homo sapiens GN=CYP4F3 PE=1 SV=2 330 502 4.0E-18
sp|Q9EP75|CP4FE_MOUSE Leukotriene-B4 omega-hydroxylase 3 OS=Mus musculus GN=Cyp4f14 PE=1 SV=1 332 501 5.0E-18
sp|Q9VS79|CP4D8_DROME Cytochrome P450 4d8 OS=Drosophila melanogaster GN=Cyp4d8 PE=2 SV=2 330 503 6.0E-18
sp|Q99N16|CP4F3_MOUSE Leukotriene-B(4) omega-hydroxylase 2 OS=Mus musculus GN=Cyp4f3 PE=1 SV=2 330 507 7.0E-18
sp|Q8N118|CP4X1_HUMAN Cytochrome P450 4X1 OS=Homo sapiens GN=CYP4X1 PE=2 SV=1 332 499 9.0E-18
sp|Q9FH76|ABAH3_ARATH Abscisic acid 8'-hydroxylase 3 OS=Arabidopsis thaliana GN=CYP707A3 PE=1 SV=1 117 540 1.0E-17
sp|Q05JG2|ABAH1_ORYSJ Abscisic acid 8'-hydroxylase 1 OS=Oryza sativa subsp. japonica GN=CYP707A5 PE=2 SV=1 81 541 1.0E-17
sp|Q09J79|ABAH1_ORYSI Abscisic acid 8'-hydroxylase 1 OS=Oryza sativa subsp. indica GN=CYP707A5 PE=2 SV=1 81 541 1.0E-17
sp|Q27756|CP6B3_PAPPO Cytochrome P450 6B3 OS=Papilio polyxenes GN=CYP6B3 PE=2 SV=1 156 499 1.0E-17
sp|P98187|CP4F8_HUMAN Cytochrome P450 4F8 OS=Homo sapiens GN=CYP4F8 PE=1 SV=1 332 502 1.0E-17
sp|Q8SPK1|CP4AO_PIG Cytochrome P450 4A24 OS=Sus scrofa GN=CYP4A24 PE=2 SV=1 332 493 1.0E-17
sp|Q9GJX5|CP4AL_PIG Taurochenodeoxycholic 6 alpha-hydroxylase OS=Sus scrofa GN=CYP4A21 PE=1 SV=1 332 493 2.0E-17
sp|O93323|CP26A_XENLA Cytochrome P450 26A1 OS=Xenopus laevis GN=cyp26a1 PE=2 SV=1 142 538 2.0E-17
sp|O88833|CP4AA_MOUSE Cytochrome P450 4A10 OS=Mus musculus GN=Cyp4a10 PE=2 SV=2 333 502 2.0E-17
sp|Q02928|CP4AB_HUMAN Cytochrome P450 4A11 OS=Homo sapiens GN=CYP4A11 PE=1 SV=1 331 493 2.0E-17
sp|Q04552|CP6B1_PAPPO Cytochrome P450 6B1 OS=Papilio polyxenes GN=CYP6B1 PE=1 SV=1 70 494 3.0E-17
sp|P14579|CP4A5_RABIT Cytochrome P450 4A5 OS=Oryctolagus cuniculus GN=CYP4A5 PE=2 SV=1 332 493 3.0E-17
sp|P08516|CP4AA_RAT Cytochrome P450 4A10 OS=Rattus norvegicus GN=Cyp4a10 PE=1 SV=2 332 493 4.0E-17
sp|P14581|CP4A7_RABIT Cytochrome P450 4A7 OS=Oryctolagus cuniculus GN=CYP4A7 PE=1 SV=1 332 499 4.0E-17
sp|Q3MID2|CP4F3_RAT Leukotriene-B(4) omega-hydroxylase 2 OS=Rattus norvegicus GN=Cyp4f3 PE=2 SV=1 332 507 4.0E-17
sp|F4JW83|C84A4_ARATH Cytochrome P450 84A4 OS=Arabidopsis thaliana GN=CYP84A4 PE=1 SV=1 80 500 5.0E-17
sp|P14580|CP4A6_RABIT Cytochrome P450 4A6 OS=Oryctolagus cuniculus GN=CYP4A6 PE=1 SV=1 332 493 6.0E-17
sp|Q6ZDE3|ABAH2_ORYSJ Abscisic acid 8'-hydroxylase 2 OS=Oryza sativa subsp. japonica GN=CYP707A6 PE=2 SV=1 81 510 9.0E-17
sp|P49602|CP51_USTMA Lanosterol 14-alpha demethylase OS=Ustilago maydis (strain 521 / FGSC 9021) GN=ERG11 PE=3 SV=1 129 510 1.0E-16
sp|A2RRT9|CP4V2_RAT Cytochrome P450 4V2 OS=Rattus norvegicus GN=Cyp4v2 PE=2 SV=1 312 493 1.0E-16
sp|Q9VYY4|C4G15_DROME Cytochrome P450 4g15 OS=Drosophila melanogaster GN=Cyp4g15 PE=2 SV=1 331 532 1.0E-16
sp|Q08D50|CP26B_XENTR Cytochrome P450 26B1 OS=Xenopus tropicalis GN=cyp26b1 PE=2 SV=1 146 500 1.0E-16
sp|Q5TCH4|CP4AM_HUMAN Cytochrome P450 4A22 OS=Homo sapiens GN=CYP4A22 PE=1 SV=1 331 510 1.0E-16
sp|Q09J78|ABAH2_ORYSI Abscisic acid 8'-hydroxylase 2 OS=Oryza sativa subsp. indica GN=CYP707A6 PE=2 SV=1 81 510 1.0E-16
sp|Q9V3S0|CP4G1_DROME Cytochrome P450 4g1 OS=Drosophila melanogaster GN=Cyp4g1 PE=2 SV=1 332 530 1.0E-16
sp|Q9HCS2|CP4FC_HUMAN Cytochrome P450 4F12 OS=Homo sapiens GN=CYP4F12 PE=1 SV=2 330 502 2.0E-16
sp|I7CT85|C7A53_PANGI Protopanaxadiol 6-hydroxylase OS=Panax ginseng PE=1 SV=1 330 535 2.0E-16
sp|P50859|CP51_CANGA Lanosterol 14-alpha demethylase OS=Candida glabrata (strain ATCC 2001 / CBS 138 / JCM 3761 / NBRC 0622 / NRRL Y-65) GN=ERG11 PE=3 SV=1 86 512 3.0E-16
sp|Q91WL5|CP4CA_MOUSE Cytochrome P450 4A12A OS=Mus musculus GN=Cyp4a12a PE=1 SV=2 330 499 3.0E-16
sp|Q27589|CP4D2_DROME Cytochrome P450 4d2 OS=Drosophila melanogaster GN=Cyp4d2 PE=2 SV=2 332 497 3.0E-16
sp|Q9HBI6|CP4FB_HUMAN Phylloquinone omega-hydroxylase CYP4F11 OS=Homo sapiens GN=CYP4F11 PE=1 SV=3 330 502 3.0E-16
sp|P33274|CP4F1_RAT Cytochrome P450 4F1 OS=Rattus norvegicus GN=Cyp4f1 PE=2 SV=1 332 501 4.0E-16
sp|Q9DBW0|CP4V2_MOUSE Cytochrome P450 4V2 OS=Mus musculus GN=Cyp4v2 PE=1 SV=1 312 493 5.0E-16
sp|Q9VA27|CP4C3_DROME Cytochrome P450 4c3 OS=Drosophila melanogaster GN=Cyp4c3 PE=2 SV=1 331 531 5.0E-16
sp|Q50EK1|C16B1_PICSI Cytochrome P450 716B1 OS=Picea sitchensis GN=CYP716B1 PE=2 SV=1 250 511 5.0E-16
sp|Q9V4U9|C6A13_DROME Probable cytochrome P450 6a13 OS=Drosophila melanogaster GN=Cyp6a13 PE=2 SV=1 336 501 6.0E-16
sp|P15128|CP4B1_RABIT Cytochrome P450 4B1 OS=Oryctolagus cuniculus GN=CYP4B1 PE=1 SV=1 332 523 6.0E-16
sp|Q6WKZ0|C7D94_MENGR Cytochrome P450 71D94 OS=Mentha gracilis GN=CYP71D94 PE=2 SV=1 104 510 6.0E-16
sp|Q9SAA9|CP511_ARATH Sterol 14-demethylase OS=Arabidopsis thaliana GN=CYP51G1 PE=1 SV=1 330 497 8.0E-16
sp|Q964T2|CP9E2_BLAGE Cytochrome P450 9e2 OS=Blattella germanica GN=CYP9E2 PE=2 SV=1 334 493 8.0E-16
sp|P20815|CP3A5_HUMAN Cytochrome P450 3A5 OS=Homo sapiens GN=CYP3A5 PE=1 SV=1 330 501 8.0E-16
sp|P20817|CP4AE_RAT Cytochrome P450 4A14 OS=Rattus norvegicus GN=Cyp4a14 PE=1 SV=2 330 499 9.0E-16
sp|Q6JTJ0|T7H_TAXCU Taxoid 7-beta-hydroxylase OS=Taxus cuspidata PE=1 SV=1 80 501 1.0E-15
sp|O35728|CP4AE_MOUSE Cytochrome P450 4A14 OS=Mus musculus GN=Cyp4a14 PE=1 SV=1 332 499 1.0E-15
sp|P10611|CP4A4_RABIT Cytochrome P450 4A4 OS=Oryctolagus cuniculus GN=CYP4A4 PE=1 SV=3 332 499 1.0E-15
sp|Q50EK0|C16B2_PICSI Cytochrome P450 716B2 OS=Picea sitchensis GN=CYP716B2 PE=2 SV=1 250 511 1.0E-15
sp|P29981|CP4C1_BLADI Cytochrome P450 4C1 OS=Blaberus discoidalis GN=CYP4C1 PE=2 SV=1 333 496 1.0E-15
sp|Q6ZWL3|CP4V2_HUMAN Cytochrome P450 4V2 OS=Homo sapiens GN=CYP4V2 PE=1 SV=2 164 493 1.0E-15
sp|G3GBK0|C7BL3_CICIN Costunolide synthase OS=Cichorium intybus GN=CYP71BL3 PE=1 SV=1 170 493 1.0E-15
sp|Q964T1|CP4CU_BLAGE Cytochrome P450 4c21 OS=Blattella germanica GN=CYP4C21 PE=2 SV=1 296 502 1.0E-15
sp|O23051|KAO1_ARATH Ent-kaurenoic acid oxidase 1 OS=Arabidopsis thaliana GN=KAO1 PE=2 SV=1 117 533 1.0E-15
sp|P00191|CP21A_BOVIN Steroid 21-hydroxylase OS=Bos taurus GN=CYP21 PE=1 SV=2 158 533 2.0E-15
sp|P93846|CP51_SORBI Obtusifoliol 14-alpha demethylase OS=Sorghum bicolor GN=CYP51 PE=1 SV=1 330 532 2.0E-15
sp|Q64459|CP3AB_MOUSE Cytochrome P450 3A11 OS=Mus musculus GN=Cyp3a11 PE=1 SV=1 330 503 2.0E-15
sp|A6YIH8|C7D55_HYOMU Premnaspirodiene oxygenase OS=Hyoscyamus muticus GN=CYP71D55 PE=1 SV=1 75 510 2.0E-15
sp|Q9V773|C6A20_DROME Probable cytochrome P450 6a20 OS=Drosophila melanogaster GN=Cyp6a20 PE=2 SV=2 322 515 3.0E-15
sp|P93596|CP51_WHEAT Obtusifoliol 14-alpha demethylase (Fragment) OS=Triticum aestivum GN=CYP51 PE=2 SV=1 330 532 3.0E-15
sp|Q9C5Y2|KAO2_ARATH Ent-kaurenoic acid oxidase 2 OS=Arabidopsis thaliana GN=KAO2 PE=2 SV=2 73 533 3.0E-15
sp|Q1ZXF5|C5084_DICDI Probable cytochrome P450 508A4 OS=Dictyostelium discoideum GN=cyp508A4 PE=3 SV=1 334 540 3.0E-15
sp|Q29496|CP3AO_SHEEP Cytochrome P450 3A24 OS=Ovis aries GN=CYP3A24 PE=2 SV=1 232 499 4.0E-15
sp|P05183|CP3A2_RAT Cytochrome P450 3A2 OS=Rattus norvegicus GN=Cyp3a2 PE=1 SV=2 330 504 4.0E-15
sp|P20816|CP4A2_RAT Cytochrome P450 4A2 OS=Rattus norvegicus GN=Cyp4a2 PE=1 SV=2 330 499 5.0E-15
sp|Q86W10|CP4Z1_HUMAN Cytochrome P450 4Z1 OS=Homo sapiens GN=CYP4Z1 PE=2 SV=1 332 493 6.0E-15
sp|O46051|C4D14_DROME Probable cytochrome P450 4d14 OS=Drosophila melanogaster GN=Cyp4d14 PE=3 SV=1 332 522 6.0E-15
sp|H1A988|C7254_GLYUR 11-oxo-beta-amyrin 30-oxidase OS=Glycyrrhiza uralensis GN=CYP72A154 PE=1 SV=1 156 539 6.0E-15
sp|P10613|CP51_CANAL Lanosterol 14-alpha demethylase OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=ERG11 PE=3 SV=2 86 540 7.0E-15
sp|Q09736|CP51_SCHPO Lanosterol 14-alpha demethylase erg11 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=erg11 PE=1 SV=1 330 511 7.0E-15
sp|Q92113|CP17A_SQUAC Steroid 17-alpha-hydroxylase/17,20 lyase OS=Squalus acanthias GN=CYP17A1 PE=2 SV=1 332 500 7.0E-15
sp|Q5RCN6|CP4V2_PONAB Cytochrome P450 4V2 OS=Pongo abelii GN=CYP4V2 PE=2 SV=1 336 493 7.0E-15
sp|Q9XHE7|C71DD_MENPI Cytochrome P450 71D13 OS=Mentha piperita GN=CYP71D13 PE=1 SV=1 104 510 7.0E-15
sp|P51538|CP3A9_RAT Cytochrome P450 3A9 OS=Rattus norvegicus GN=Cyp3a9 PE=2 SV=2 330 501 7.0E-15
sp|O55071|CP2BJ_MOUSE Cytochrome P450 2B19 OS=Mus musculus GN=Cyp2b19 PE=2 SV=1 312 520 8.0E-15
sp|I7C6E8|C7A52_PANGI Beta-amyrin 28-oxidase OS=Panax ginseng PE=2 SV=1 161 510 9.0E-15
sp|P24460|CP2BB_CANLF Cytochrome P450 2B11 OS=Canis lupus familiaris GN=CYP2B11 PE=2 SV=1 297 520 1.0E-14
sp|Q6EIG3|CP26B_DANRE Cytochrome P450 26B1 OS=Danio rerio GN=cyp26b1 PE=1 SV=1 146 500 1.0E-14
sp|O54750|CP2J6_MOUSE Cytochrome P450 2J6 OS=Mus musculus GN=Cyp2j6 PE=2 SV=2 43 521 1.0E-14
sp|P11707|CP3A6_RABIT Cytochrome P450 3A6 OS=Oryctolagus cuniculus GN=CYP3A6 PE=2 SV=2 334 501 1.0E-14
sp|B8NHY4|ORDA_ASPFN O-methylsterigmatocystin oxidoreductase OS=Aspergillus flavus (strain ATCC 200026 / FGSC A1120 / NRRL 3357 / JCM 12722 / SRRC 167) GN=ordA PE=2 SV=1 75 499 1.0E-14
sp|Q5VDD6|ORDA_ASPFL O-methylsterigmatocystin oxidoreductase OS=Aspergillus flavus GN=ordA PE=3 SV=2 75 499 1.0E-14
sp|B9G934|C14C3_ORYSJ Cytochrome P450 714C3 OS=Oryza sativa subsp. japonica GN=CYP714C3 PE=3 SV=2 343 535 2.0E-14
sp|P00176|CP2B1_RAT Cytochrome P450 2B1 OS=Rattus norvegicus GN=Cyp2b1 PE=1 SV=1 312 516 2.0E-14
sp|P15129|CP4B1_RAT Cytochrome P450 4B1 OS=Rattus norvegicus GN=Cyp4b1 PE=1 SV=3 332 523 2.0E-14
sp|Q2LCM1|CP21A_CANLU Steroid 21-hydroxylase OS=Canis lupus GN=CYP21 PE=3 SV=1 158 503 2.0E-14
sp|Q8WNW0|CP21A_CANLF Steroid 21-hydroxylase OS=Canis lupus familiaris GN=CYP21 PE=3 SV=1 158 503 2.0E-14
sp|Q95036|CP6B5_PAPGL Cytochrome P450 6B5 (Fragment) OS=Papilio glaucus GN=CYP6B5 PE=2 SV=1 332 519 2.0E-14
sp|P24464|CP4AC_RAT Cytochrome P450 4A12 OS=Rattus norvegicus GN=Cyp4a12 PE=2 SV=2 332 499 2.0E-14
sp|Q96SQ9|CP2S1_HUMAN Cytochrome P450 2S1 OS=Homo sapiens GN=CYP2S1 PE=1 SV=2 332 501 2.0E-14
sp|Q12664|CP51_PENIT Eburicol 14-alpha-demethylase OS=Penicillium italicum GN=CYP51 PE=3 SV=1 171 501 2.0E-14
sp|Q8VWZ7|C76B6_CATRO Geraniol 8-hydroxylase OS=Catharanthus roseus GN=CYP76B6 PE=1 SV=1 49 510 2.0E-14
sp|Q64581|CP3AI_RAT Cytochrome P450 3A18 OS=Rattus norvegicus GN=Cyp3a18 PE=2 SV=1 243 499 2.0E-14
sp|Q9XHE8|C71DI_MENSP Cytochrome P450 71D18 OS=Mentha spicata GN=CYP71D18 PE=1 SV=1 183 510 2.0E-14
sp|Q6WKZ1|C71DI_MENGR Cytochrome P450 71D18 OS=Mentha gracilis GN=CYP71D18 PE=1 SV=1 183 510 2.0E-14
sp|P33270|CP6A2_DROME Cytochrome P450 6a2 OS=Drosophila melanogaster GN=Cyp6a2 PE=2 SV=2 336 503 2.0E-14
sp|Q7Z449|CP2U1_HUMAN Cytochrome P450 2U1 OS=Homo sapiens GN=CYP2U1 PE=1 SV=1 332 501 2.0E-14
sp|Q27902|CP6B4_PAPGL Cytochrome P450 6B4 OS=Papilio glaucus GN=CYP6B4 PE=2 SV=1 332 519 2.0E-14
sp|Q9UVC3|CP51_CUNEL Lanosterol 14-alpha demethylase OS=Cunninghamella elegans GN=CYP51 PE=3 SV=1 139 497 3.0E-14
sp|F8S1I0|C7BL2_LACSA Costunolide synthase OS=Lactuca sativa GN=CYP71BL2 PE=1 SV=1 170 493 3.0E-14
sp|Q64481|CP3AG_MOUSE Cytochrome P450 3A16 OS=Mus musculus GN=Cyp3a16 PE=2 SV=2 305 504 3.0E-14
sp|Q811W2|CP26B_MOUSE Cytochrome P450 26B1 OS=Mus musculus GN=Cyp26b1 PE=1 SV=1 142 500 3.0E-14
sp|Q93ZB2|KO1_ARATH Ent-kaurene oxidase, chloroplastic OS=Arabidopsis thaliana GN=KO PE=1 SV=2 80 510 3.0E-14
sp|Q64464|CP3AD_MOUSE Cytochrome P450 3A13 OS=Mus musculus GN=Cyp3a13 PE=1 SV=1 330 501 4.0E-14
sp|H1A981|C7263_MEDTR 11-oxo-beta-amyrin 30-oxidase OS=Medicago truncatula GN=CYP72A63 PE=1 SV=1 156 495 4.0E-14
sp|Q9V6H1|CP9H1_DROME Probable cytochrome P450 9h1 OS=Drosophila melanogaster GN=Cyp9h1 PE=3 SV=1 313 497 4.0E-14
sp|Q54DT2|C516A_DICDI Probable cytochrome P450 516A1 OS=Dictyostelium discoideum GN=cyp516A1 PE=3 SV=2 330 520 4.0E-14
sp|Q759W0|CP51_ASHGO Lanosterol 14-alpha demethylase OS=Ashbya gossypii (strain ATCC 10895 / CBS 109.51 / FGSC 9923 / NRRL Y-1056) GN=ERG11 PE=3 SV=1 333 542 4.0E-14
sp|Q9LIP5|C71BW_ARATH Cytochrome P450 71B35 OS=Arabidopsis thaliana GN=CYP71B35 PE=2 SV=1 170 501 5.0E-14
sp|Q9FG65|C81D1_ARATH Cytochrome P450 81D1 OS=Arabidopsis thaliana GN=CYP81D1 PE=2 SV=1 311 510 5.0E-14
sp|P33272|CP2BC_RAT Cytochrome P450 2B12 OS=Rattus norvegicus GN=Cyp2b12 PE=2 SV=1 297 520 5.0E-14
sp|P79401|CP3AT_PIG Cytochrome P450 3A29 OS=Sus scrofa GN=CYP3A29 PE=2 SV=1 337 501 5.0E-14
sp|P04167|CP2B2_RAT Cytochrome P450 2B2 OS=Rattus norvegicus GN=Cyp2b2 PE=1 SV=2 312 516 5.0E-14
sp|P24462|CP3A7_HUMAN Cytochrome P450 3A7 OS=Homo sapiens GN=CYP3A7 PE=1 SV=2 330 501 5.0E-14
sp|Q92088|CP2M1_ONCMY Cytochrome P450 2M1 OS=Oncorhynchus mykiss GN=cyp2m1 PE=1 SV=1 213 523 6.0E-14
sp|Q9V675|CP6G2_DROME Probable cytochrome P450 6g2 OS=Drosophila melanogaster GN=Cyp6g2 PE=2 SV=1 105 496 6.0E-14
sp|Q7X7X4|C99A2_ORYSJ Cytochrome P450 99A2 OS=Oryza sativa subsp. japonica GN=CYP99A2 PE=2 SV=2 332 511 6.0E-14
sp|Q27519|C13A7_CAEEL Putative cytochrome P450 CYP13A7 OS=Caenorhabditis elegans GN=cyp-13A7 PE=3 SV=1 336 516 7.0E-14
sp|Q9HB55|CP343_HUMAN Cytochrome P450 3A43 OS=Homo sapiens GN=CYP3A43 PE=1 SV=1 292 504 7.0E-14
sp|Q64462|CP4B1_MOUSE Cytochrome P450 4B1 OS=Mus musculus GN=Cyp4b1 PE=1 SV=1 332 523 7.0E-14
sp|G3V7X8|CP26B_RAT Cytochrome P450 26B1 OS=Rattus norvegicus GN=Cyp26b1 PE=2 SV=1 142 500 8.0E-14
sp|P11715|CP17A_RAT Steroid 17-alpha-hydroxylase/17,20 lyase OS=Rattus norvegicus GN=Cyp17a1 PE=1 SV=2 264 500 9.0E-14
sp|P24463|CP3AC_CANLF Cytochrome P450 3A12 OS=Canis lupus familiaris GN=CYP3A12 PE=2 SV=1 330 501 9.0E-14
sp|Q9VCW1|CP6D4_DROME Probable cytochrome P450 6d4 OS=Drosophila melanogaster GN=Cyp6d4 PE=2 SV=1 314 503 1.0E-13
sp|P12394|CP17A_CHICK Steroid 17-alpha-hydroxylase/17,20 lyase OS=Gallus gallus GN=CYP17A1 PE=2 SV=1 312 511 1.0E-13
sp|Q9LIP4|C71BX_ARATH Cytochrome P450 71B36 OS=Arabidopsis thaliana GN=CYP71B36 PE=3 SV=1 164 501 1.0E-13
sp|O18596|C4D10_DROMT Cytochrome P450 4d10 OS=Drosophila mettleri GN=Cyp4d10 PE=1 SV=1 149 538 1.0E-13
sp|P12790|CP2B9_MOUSE Cytochrome P450 2B9 OS=Mus musculus GN=Cyp2b9 PE=1 SV=2 318 501 1.0E-13
sp|P13584|CP4B1_HUMAN Cytochrome P450 4B1 OS=Homo sapiens GN=CYP4B1 PE=1 SV=2 332 523 1.0E-13
sp|Q9SZ46|C82C4_ARATH Cytochrome P450 82C4 OS=Arabidopsis thaliana GN=CYP82C4 PE=2 SV=1 276 501 1.0E-13
sp|O70537|CP3AV_MESAU Cytochrome P450 3A31 OS=Mesocricetus auratus GN=CYP3A31 PE=2 SV=1 330 504 1.0E-13
sp|Q05047|C72A1_CATRO Secologanin synthase OS=Catharanthus roseus GN=CYP72A1 PE=2 SV=1 344 503 2.0E-13
sp|O09158|CP3AP_MOUSE Cytochrome P450 3A25 OS=Mus musculus GN=Cyp3a25 PE=1 SV=1 48 499 2.0E-13
sp|O81077|ABAH2_ARATH Abscisic acid 8'-hydroxylase 2 OS=Arabidopsis thaliana GN=CYP707A2 PE=2 SV=1 332 510 2.0E-13
sp|Q9XHE6|C71DF_MENPI Cytochrome P450 71D15 OS=Mentha piperita GN=CYP71D15 PE=1 SV=1 48 510 2.0E-13
sp|Q64148|CP3AA_MESAU Lithocholate 6-beta-hydroxylase OS=Mesocricetus auratus GN=CYP3A10 PE=1 SV=2 330 525 2.0E-13
sp|Q54ZM4|C518A_DICDI Probable cytochrome P450 518A1 OS=Dictyostelium discoideum GN=cyp518A1 PE=3 SV=1 345 541 2.0E-13
sp|P10614|CP51_YEAST Lanosterol 14-alpha demethylase OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=ERG11 PE=1 SV=1 113 510 2.0E-13
sp|Q0IIF9|CP2U1_BOVIN Cytochrome P450 2U1 OS=Bos taurus GN=CYP2U1 PE=2 SV=1 341 535 2.0E-13
sp|O46054|C4AE1_DROME Cytochrome P450 4ae1 OS=Drosophila melanogaster GN=Cyp4ae1 PE=2 SV=1 332 504 2.0E-13
sp|Q9V7G5|C4AA1_DROME Probable cytochrome P450 4aa1 OS=Drosophila melanogaster GN=Cyp4aa1 PE=2 SV=2 330 526 2.0E-13
sp|Q8GSQ1|C85A1_ORYSJ Cytochrome P450 85A1 OS=Oryza sativa subsp. japonica GN=CYP85A1 PE=1 SV=1 116 534 2.0E-13
sp|Q9LIP6|C71BV_ARATH Cytochrome P450 71B34 OS=Arabidopsis thaliana GN=CYP71B34 PE=2 SV=1 170 501 2.0E-13
sp|Q2LA59|CP21A_LYNLY Steroid 21-hydroxylase OS=Lynx lynx GN=CYP21 PE=3 SV=1 158 533 2.0E-13
sp|O18993|CP3AL_CALJA Cytochrome P450 3A21 OS=Callithrix jacchus GN=CYP3A21 PE=2 SV=1 330 501 2.0E-13
sp|Q9NR63|CP26B_HUMAN Cytochrome P450 26B1 OS=Homo sapiens GN=CYP26B1 PE=1 SV=1 157 500 2.0E-13
sp|P30437|CP17A_ONCMY Steroid 17-alpha-hydroxylase/17,20 lyase OS=Oncorhynchus mykiss GN=cyp17a1 PE=2 SV=1 332 501 3.0E-13
sp|P33268|CP3A8_MACFA Cytochrome P450 3A8 OS=Macaca fascicularis GN=CYP3A8 PE=1 SV=1 330 499 3.0E-13
sp|Q1ZXH9|CP51_DICDI Probable lanosterol 14-alpha demethylase OS=Dictyostelium discoideum GN=cyp51 PE=3 SV=1 334 497 3.0E-13
sp|Q4PJW3|CP51A_BOVIN Lanosterol 14-alpha demethylase OS=Bos taurus GN=CYP51A1 PE=2 SV=1 330 497 3.0E-13
sp|P9WPM7|CP136_MYCTU Putative cytochrome P450 136 OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=cyp136 PE=1 SV=1 149 497 3.0E-13
sp|P9WPM6|CP136_MYCTO Putative cytochrome P450 136 OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) GN=cyp136 PE=3 SV=1 149 497 3.0E-13
sp|P27786|CP17A_MOUSE Steroid 17-alpha-hydroxylase/17,20 lyase OS=Mus musculus GN=Cyp17a1 PE=1 SV=1 315 502 3.0E-13
sp|O13345|ORDA_ASPPA O-methylsterigmatocystin oxidoreductase OS=Aspergillus parasiticus GN=ordA PE=1 SV=1 75 499 3.0E-13
sp|Q43068|C82A1_PEA Cytochrome P450 82A1 (Fragment) OS=Pisum sativum GN=CYP82A1 PE=2 SV=2 275 489 4.0E-13
sp|Q9VL92|CP4E3_DROME Cytochrome P450 4e3 OS=Drosophila melanogaster GN=Cyp4e3 PE=2 SV=1 330 504 4.0E-13
sp|S4UX02|CYPH1_SALMI Ferruginol synthase OS=Salvia miltiorrhiza GN=CYP76AH1 PE=1 SV=1 48 489 4.0E-13
sp|Q4R8S6|CP51A_MACFA Lanosterol 14-alpha demethylase OS=Macaca fascicularis GN=CYP51A1 PE=2 SV=2 330 497 4.0E-13
sp|Q5RE72|CP51A_PONAB Lanosterol 14-alpha demethylase OS=Pongo abelii GN=CYP51A1 PE=2 SV=2 330 497 5.0E-13
sp|Q42798|C93A1_SOYBN 3,9-dihydroxypterocarpan 6A-monooxygenase OS=Glycine max GN=CYP93A1 PE=1 SV=1 48 501 6.0E-13
sp|Q91Z85|CP17A_PERLE Steroid 17-alpha-hydroxylase/17,20 lyase OS=Peromyscus leucopus GN=Cyp17a1 PE=3 SV=1 332 502 6.0E-13
sp|Q6NKZ8|C14A2_ARATH Cytochrome P450 714A2 OS=Arabidopsis thaliana GN=CYP714A2 PE=2 SV=1 343 516 6.0E-13
sp|Q8W4T9|T13H_TAXCU Taxane 13-alpha-hydroxylase OS=Taxus cuspidata GN=CYP725A2 PE=1 SV=1 332 501 6.0E-13
sp|P37123|C77A1_SOLME Cytochrome P450 77A1 (Fragment) OS=Solanum melongena GN=CYP77A1 PE=2 SV=1 333 510 6.0E-13
sp|P98183|C71DC_CATRO Tabersonine 16-hydroxylase (Fragment) OS=Catharanthus roseus GN=CYP71D12 PE=1 SV=1 319 542 7.0E-13
sp|Q9V979|CP6U1_DROME Probable cytochrome P450 6u1 OS=Drosophila melanogaster GN=Cyp6u1 PE=2 SV=3 332 539 7.0E-13
sp|Q64417|CP3AE_CAVPO Cytochrome P450 3A14 OS=Cavia porcellus GN=CYP3A14 PE=2 SV=2 330 501 8.0E-13
sp|P12789|CP2B5_RABIT Cytochrome P450 2B5 OS=Oryctolagus cuniculus GN=CYP2B5 PE=2 SV=1 332 520 8.0E-13
sp|E1BHJ4|CP26B_BOVIN Cytochrome P450 26B1 OS=Bos taurus GN=CYP26B1 PE=3 SV=1 157 500 8.0E-13
sp|Q9VVR9|C12C1_DROME Probable cytochrome P450 12c1, mitochondrial OS=Drosophila melanogaster GN=Cyp12c1 PE=2 SV=2 345 538 8.0E-13
sp|Q82IY3|PTLI_STRAW Pentalenene oxygenase OS=Streptomyces avermitilis (strain ATCC 31267 / DSM 46492 / JCM 5070 / NBRC 14893 / NCIMB 12804 / NRRL 8165 / MA-4680) GN=ptlI PE=1 SV=1 334 542 8.0E-13
sp|Q16850|CP51A_HUMAN Lanosterol 14-alpha demethylase OS=Homo sapiens GN=CYP51A1 PE=1 SV=3 330 497 9.0E-13
sp|Q9JMA7|CP341_MOUSE Cytochrome P450 3A41 OS=Mus musculus GN=Cyp3a41a PE=1 SV=2 330 504 9.0E-13
sp|P79152|CP3AJ_CAPHE Cytochrome P450 3A19 (Fragment) OS=Capra hircus aegagrus GN=CYP3A19 PE=2 SV=1 337 501 9.0E-13
sp|Q6WKY9|C7D95_MENGR Cytochrome P450 71D95 OS=Mentha gracilis GN=CYP71D95 PE=1 SV=1 104 510 1.0E-12
sp|Q2LA60|CP21A_FELCA Steroid 21-hydroxylase OS=Felis catus GN=CYP21 PE=3 SV=1 158 533 1.0E-12
sp|O48958|C71E1_SORBI 4-hydroxyphenylacetaldehyde oxime monooxygenase OS=Sorghum bicolor GN=CYP71E1 PE=2 SV=1 329 542 1.0E-12
sp|B5BSX1|BAMO_GLYUR Beta-amyrin 11-oxidase OS=Glycyrrhiza uralensis GN=CYP88D6 PE=1 SV=1 117 501 1.0E-12
sp|P37122|C76A2_SOLME Cytochrome P450 76A2 OS=Solanum melongena GN=CYP76A2 PE=2 SV=1 323 510 1.0E-12
sp|Q9VWR5|CP306_DROME Cytochrome P450 306a1 OS=Drosophila melanogaster GN=phm PE=1 SV=1 330 523 1.0E-12
sp|P04800|CP3A1_RAT Cytochrome P450 3A1 OS=Rattus norvegicus GN=Cyp3a1 PE=1 SV=1 332 504 1.0E-12
sp|Q9VLZ7|C4D21_DROME Probable cytochrome P450 4d21 OS=Drosophila melanogaster GN=Cyp4d21 PE=3 SV=1 332 504 1.0E-12
sp|Q7Z1V1|CP51_TRYCC Sterol 14-alpha demethylase OS=Trypanosoma cruzi (strain CL Brener) GN=CYP51 PE=1 SV=1 335 504 1.0E-12
sp|P08684|CP3A4_HUMAN Cytochrome P450 3A4 OS=Homo sapiens GN=CYP3A4 PE=1 SV=4 330 501 1.0E-12
sp|O73853|CP17A_ICTPU Steroid 17-alpha-hydroxylase/17,20 lyase OS=Ictalurus punctatus GN=cyp17a1 PE=2 SV=1 332 501 1.0E-12
sp|D5JBX0|GAO_HELAN Germacrene A oxidase OS=Helianthus annuus PE=1 SV=1 332 510 1.0E-12
sp|Q8K0C4|CP51A_MOUSE Lanosterol 14-alpha demethylase OS=Mus musculus GN=Cyp51a1 PE=1 SV=1 129 497 1.0E-12
sp|Q8AXY5|C356_FUNHE Cytochrome P450 3A56 OS=Fundulus heteroclitus GN=cyp3a56 PE=2 SV=1 48 523 1.0E-12
sp|Q64406|CP3AF_CAVPO Cytochrome P450 3A15 OS=Cavia porcellus GN=CYP3A15 PE=2 SV=1 330 501 1.0E-12
sp|P00178|CP2B4_RABIT Cytochrome P450 2B4 OS=Oryctolagus cuniculus GN=CYP2B4 PE=1 SV=1 332 520 2.0E-12
sp|P13527|CP6A1_MUSDO Cytochrome P450 6A1 OS=Musca domestica GN=CYP6A1 PE=2 SV=1 336 501 2.0E-12
sp|Q9V674|CP6G1_DROME Cytochrome P450 6g1 OS=Drosophila melanogaster GN=Cyp6g1 PE=2 SV=1 334 506 2.0E-12
sp|O48786|C734A_ARATH Cytochrome P450 734A1 OS=Arabidopsis thaliana GN=CYP734A1 PE=2 SV=1 85 541 2.0E-12
sp|O48921|C97B2_SOYBN Cytochrome P450 97B2, chloroplastic OS=Glycine max GN=CYP97B2 PE=2 SV=1 294 541 2.0E-12
sp|P24557|THAS_HUMAN Thromboxane-A synthase OS=Homo sapiens GN=TBXAS1 PE=1 SV=3 324 519 2.0E-12
sp|Q9LUC5|C7A15_ARATH Cytochrome P450 72A15 OS=Arabidopsis thaliana GN=CYP72A15 PE=2 SV=1 276 505 2.0E-12
sp|P49430|THAS_RAT Thromboxane-A synthase OS=Rattus norvegicus GN=Tbxas1 PE=2 SV=1 307 531 2.0E-12
sp|Q5IZM4|CP51_MYCVP Lanosterol 14-alpha demethylase OS=Mycobacterium vanbaalenii (strain DSM 7251 / PYR-1) GN=cyp51 PE=3 SV=1 332 509 2.0E-12
sp|P00181|CP2C2_RABIT Cytochrome P450 2C2 OS=Oryctolagus cuniculus GN=CYP2C2 PE=1 SV=2 135 511 2.0E-12
sp|P79102|CP3AS_BOVIN Cytochrome P450 3A28 OS=Bos taurus GN=CYP3A28 PE=2 SV=1 330 501 2.0E-12
sp|Q9LIP3|C71BY_ARATH Cytochrome P450 71B37 OS=Arabidopsis thaliana GN=CYP71B37 PE=3 SV=2 332 501 2.0E-12
sp|Q64562|CP21A_RAT Steroid 21-hydroxylase OS=Rattus norvegicus GN=Cyp21 PE=2 SV=1 79 503 2.0E-12
sp|Q6IV13|C7D95_MENSP Cytochrome P450 71D95 OS=Mentha spicata GN=CYP71D95 PE=1 SV=1 104 510 2.0E-12
sp|Q64654|CP51A_RAT Lanosterol 14-alpha demethylase OS=Rattus norvegicus GN=Cyp51a1 PE=2 SV=1 330 497 2.0E-12
sp|Q9SWR5|C93C1_SOYBN 2-hydroxyisoflavanone synthase OS=Glycine max GN=IFS2 PE=2 SV=1 332 502 2.0E-12
sp|P47195|C80A1_BERST Berbamunine synthase OS=Berberis stolonifera GN=CYP80A1 PE=1 SV=1 76 510 2.0E-12
sp|Q84KI1|T14H_TAXCU Taxoid 14-beta-hydroxylase OS=Taxus cuspidata PE=1 SV=1 70 531 3.0E-12
sp|Q9SHG5|C72C1_ARATH Cytochrome P450 72C1 OS=Arabidopsis thaliana GN=CYP72C1 PE=2 SV=2 344 539 3.0E-12
sp|P00180|CP2C1_RABIT Cytochrome P450 2C1 OS=Oryctolagus cuniculus GN=CYP2C1 PE=1 SV=2 75 511 3.0E-12
sp|Q64409|CP3AH_CAVPO Cytochrome P450 3A17 OS=Cavia porcellus GN=CYP3A17 PE=2 SV=1 330 501 3.0E-12
sp|O49396|C82C3_ARATH Cytochrome P450 82C3 OS=Arabidopsis thaliana GN=CYP82C3 PE=2 SV=3 337 501 3.0E-12
sp|P70687|CP17A_MESAU Steroid 17-alpha-hydroxylase/17,20 lyase OS=Mesocricetus auratus GN=CYP17A1 PE=2 SV=1 332 502 3.0E-12
sp|P70085|CP17A_ORYLA Steroid 17-alpha-hydroxylase/17,20 lyase OS=Oryzias latipes GN=cyp17a1 PE=2 SV=1 332 501 3.0E-12
sp|Q27517|C13A3_CAEEL Putative cytochrome P450 CYP13A3 OS=Caenorhabditis elegans GN=cyp-13A3 PE=3 SV=1 336 515 3.0E-12
sp|P24456|CP2DA_MOUSE Cytochrome P450 2D10 OS=Mus musculus GN=Cyp2d10 PE=1 SV=2 332 538 3.0E-12
sp|P20812|CP2A3_RAT Cytochrome P450 2A3 OS=Rattus norvegicus GN=Cyp2a3 PE=2 SV=1 340 529 3.0E-12
sp|Q43078|C97B1_PEA Cytochrome P450 97B1, chloroplastic OS=Pisum sativum GN=CYP97B1 PE=2 SV=1 294 493 4.0E-12
sp|O46420|CP51A_PIG Lanosterol 14-alpha demethylase OS=Sus scrofa GN=CYP51A1 PE=2 SV=1 330 497 4.0E-12
sp|Q9VB31|C6A18_DROME Probable cytochrome P450 6a18 OS=Drosophila melanogaster GN=Cyp6a18 PE=2 SV=1 336 501 4.0E-12
sp|P11711|CP2A1_RAT Cytochrome P450 2A1 OS=Rattus norvegicus GN=Cyp2a1 PE=1 SV=2 304 501 4.0E-12
sp|Q4V8D1|CP2U1_RAT Cytochrome P450 2U1 OS=Rattus norvegicus GN=Cyp2u1 PE=1 SV=1 341 501 4.0E-12
sp|H2DH16|C7A47_PANGI Dammarenediol 12-hydroxylase OS=Panax ginseng GN=PPDS PE=1 SV=2 170 510 4.0E-12
sp|Q27514|C13A5_CAEEL Putative cytochrome P450 CYP13A5 OS=Caenorhabditis elegans GN=cyp-13A5 PE=3 SV=1 336 519 4.0E-12
sp|P20852|CP2A5_MOUSE Cytochrome P450 2A5 OS=Mus musculus GN=Cyp2a5 PE=2 SV=1 340 529 4.0E-12
sp|P15540|CP21A_PIG Steroid 21-hydroxylase OS=Sus scrofa GN=CYP21 PE=1 SV=2 158 501 4.0E-12
sp|Q9CX98|CP2U1_MOUSE Cytochrome P450 2U1 OS=Mus musculus GN=Cyp2u1 PE=2 SV=2 344 501 5.0E-12
sp|P12791|CP2BA_MOUSE Cytochrome P450 2B10 OS=Mus musculus GN=Cyp2b10 PE=1 SV=1 332 516 5.0E-12
sp|O57525|CP17A_RANDY Steroid 17-alpha-hydroxylase/17,20 lyase OS=Rana dybowskii GN=CYP17A1 PE=2 SV=1 332 501 5.0E-12
sp|O64989|C90B1_ARATH Cytochrome P450 90B1 OS=Arabidopsis thaliana GN=CYP90B1 PE=1 SV=2 336 534 5.0E-12
sp|Q9FMA5|C85A1_ARATH Cytochrome P450 85A1 OS=Arabidopsis thaliana GN=CYP85A1 PE=2 SV=1 49 530 5.0E-12
sp|Q27594|CP6A9_DROME Cytochrome P450 6a9 OS=Drosophila melanogaster GN=Cyp6a9 PE=2 SV=3 318 503 5.0E-12
sp|Q9PVE8|C330_FUNHE Cytochrome P450 3A30 OS=Fundulus heteroclitus GN=cyp3a30 PE=2 SV=2 233 523 5.0E-12
sp|G4XV71|C93C2_GLYUR 2-hydroxyisoflavanone synthase OS=Glycyrrhiza uralensis GN=CYP93C2 PE=2 SV=2 332 507 5.0E-12
sp|Q95078|CP18A_DROME Cytochrome P450 18a1 OS=Drosophila melanogaster GN=Cyp18a1 PE=2 SV=2 336 502 6.0E-12
sp|O42563|CP3AR_ONCMY Cytochrome P450 3A27 OS=Oncorhynchus mykiss GN=cyp3a27 PE=2 SV=1 332 540 6.0E-12
sp|F8S1H3|C7BL1_HELAN Cytochrome P450 71BL1 OS=Helianthus annuus GN=CYP71BL1 PE=2 SV=1 170 493 6.0E-12
sp|P20813|CP2B6_HUMAN Cytochrome P450 2B6 OS=Homo sapiens GN=CYP2B6 PE=1 SV=1 332 520 6.0E-12
sp|Q92148|CP1A1_MICTO Cytochrome P450 1A1 OS=Microgadus tomcod GN=cyp1a1 PE=2 SV=1 332 516 6.0E-12
sp|P36423|THAS_MOUSE Thromboxane-A synthase OS=Mus musculus GN=Tbxas1 PE=1 SV=2 325 519 6.0E-12
sp|O81974|C71D8_SOYBN Cytochrome P450 71D8 OS=Glycine max GN=CYP71D8 PE=2 SV=1 46 501 6.0E-12
sp|Q6Z6D6|C7342_ORYSJ Cytochrome P450 734A2 OS=Oryza sativa subsp. japonica GN=CYP734A2 PE=2 SV=1 322 538 6.0E-12
sp|Q9DBX6|CP2S1_MOUSE Cytochrome P450 2S1 OS=Mus musculus GN=Cyp2s1 PE=1 SV=1 282 501 6.0E-12
sp|Q9K498|EIZFM_STRCO Epi-isozizaene 5-monooxygenase/(E)-beta-farnesene synthase OS=Streptomyces coelicolor (strain ATCC BAA-471 / A3(2) / M145) GN=SCO5223 PE=1 SV=1 129 531 6.0E-12
sp|P17666|CP2CE_RABIT Cytochrome P450 2C14 OS=Oryctolagus cuniculus GN=CYP2C14 PE=2 SV=1 332 511 6.0E-12
sp|P82711|C6A19_DROME Probable cytochrome P450 6a19 OS=Drosophila melanogaster GN=Cyp6a19 PE=3 SV=1 336 501 7.0E-12
sp|O48956|C98A1_SORBI Cytochrome P450 98A1 OS=Sorghum bicolor GN=CYP98A1 PE=2 SV=1 81 513 7.0E-12
sp|H2DH21|C7A29_PANGI Cytochrome P450 CYP72A219 OS=Panax ginseng PE=2 SV=1 336 516 7.0E-12
sp|Q2QYH7|C14C2_ORYSJ Cytochrome P450 714C2 OS=Oryza sativa subsp. japonica GN=CYP714C2 PE=2 SV=1 322 499 7.0E-12
sp|Q9M066|C90C1_ARATH 3-epi-6-deoxocathasterone 23-monooxygenase OS=Arabidopsis thaliana GN=ROT3 PE=2 SV=3 250 535 7.0E-12
sp|P03940|CP21A_MOUSE Steroid 21-hydroxylase OS=Mus musculus GN=Cyp21 PE=2 SV=3 128 503 7.0E-12
sp|Q05555|CP2AA_RABIT Cytochrome P450 2A10 OS=Oryctolagus cuniculus GN=CYP2A10 PE=1 SV=1 312 527 7.0E-12
sp|Q9V4T5|CP4E1_DROME Probable cytochrome P450 4e1 OS=Drosophila melanogaster GN=Cyp4e1 PE=2 SV=1 48 503 8.0E-12
sp|P56593|CP2AC_MOUSE Cytochrome P450 2A12 OS=Mus musculus GN=Cyp2a12 PE=1 SV=2 337 501 8.0E-12
sp|Q27513|C13A4_CAEEL Putative cytochrome P450 CYP13A4 OS=Caenorhabditis elegans GN=cyp-13A4 PE=3 SV=1 316 531 8.0E-12
sp|Q9VYQ7|CP311_DROME Probable cytochrome P450 311a1 OS=Drosophila melanogaster GN=Cyp311a1 PE=2 SV=1 336 503 9.0E-12
sp|O65012|C78A4_PINRA Cytochrome P450 78A4 OS=Pinus radiata GN=CYP78A4 PE=2 SV=1 47 523 9.0E-12
sp|Q9V770|C6A17_DROME Probable cytochrome P450 6a17 OS=Drosophila melanogaster GN=Cyp6a17 PE=2 SV=1 336 519 9.0E-12
sp|P58049|C71BB_ARATH Cytochrome P450 71B11 OS=Arabidopsis thaliana GN=CYP71B11 PE=2 SV=1 75 489 9.0E-12
sp|Q7XU38|C87A3_ORYSJ Cytochrome P450 87A3 OS=Oryza sativa subsp. japonica GN=CYP87A3 PE=2 SV=3 69 510 9.0E-12
sp|Q9SD85|F3PH_ARATH Flavonoid 3'-monooxygenase OS=Arabidopsis thaliana GN=CYP75B1 PE=1 SV=1 332 489 1.0E-11
sp|Q947B7|MFS_MENPI (+)-menthofuran synthase OS=Mentha piperita PE=1 SV=1 334 503 1.0E-11
sp|Q9V5L3|C49A1_DROME Probable cytochrome P450 49a1 OS=Drosophila melanogaster GN=Cyp49a1 PE=2 SV=3 350 503 1.0E-11
sp|P37117|C71A4_SOLME Cytochrome P450 71A4 OS=Solanum melongena GN=CYP71A4 PE=2 SV=1 79 503 1.0E-11
sp|P14263|CP51_CANTR Lanosterol 14-alpha demethylase OS=Candida tropicalis GN=ERG11 PE=3 SV=2 311 510 1.0E-11
sp|O54749|CP2J5_MOUSE Cytochrome P450 2J5 OS=Mus musculus GN=Cyp2j5 PE=1 SV=1 75 523 1.0E-11
sp|O81972|C82A2_SOYBN Cytochrome P450 82A2 OS=Glycine max GN=CYP82A2 PE=2 SV=1 297 507 1.0E-11
sp|C0SJS3|ANGS_PASSA Angelicin synthase (Fragment) OS=Pastinaca sativa GN=CYP71AJ4 PE=1 SV=1 337 493 1.0E-11
sp|Q9SAE3|C71BS_ARATH Cytochrome P450 71B28 OS=Arabidopsis thaliana GN=CYP71B28 PE=2 SV=1 332 526 1.0E-11
sp|Q43147|C85A1_SOLLC Cytochrome P450 85A1 OS=Solanum lycopersicum GN=CYP85A1 PE=2 SV=1 83 510 1.0E-11
sp|Q9LHA1|C8D11_ARATH Cytochrome P450 81D11 OS=Arabidopsis thaliana GN=CYP81D11 PE=2 SV=1 332 510 1.0E-11
sp|P37124|C77A2_SOLME Cytochrome P450 77A2 OS=Solanum melongena GN=CYP77A2 PE=2 SV=1 344 510 1.0E-11
sp|P24454|CP2A8_MESAU Cytochrome P450 2A8 OS=Mesocricetus auratus GN=CYP2A8 PE=1 SV=1 296 530 1.0E-11
sp|O22307|C71DB_LOTJA Cytochrome P450 71D11 (Fragment) OS=Lotus japonicus GN=CYP71D11 PE=2 SV=1 75 535 1.0E-11
sp|Q95328|CP17A_HORSE Steroid 17-alpha-hydroxylase/17,20 lyase OS=Equus caballus GN=CYP17A1 PE=2 SV=1 207 500 1.0E-11
sp|Q64583|CP2BF_RAT Cytochrome P450 2B15 OS=Rattus norvegicus GN=Cyp2b15 PE=3 SV=2 332 520 2.0E-11
sp|P08686|CP21A_HUMAN Steroid 21-hydroxylase OS=Homo sapiens GN=CYP21A2 PE=1 SV=1 184 503 2.0E-11
sp|P51590|CP2J3_RAT Cytochrome P450 2J3 OS=Rattus norvegicus GN=Cyp2j3 PE=2 SV=1 50 523 2.0E-11
sp|Q9FVS9|C96AF_ARATH Alkane hydroxylase MAH1 OS=Arabidopsis thaliana GN=CYP96A15 PE=2 SV=1 328 499 2.0E-11
sp|P11714|CP2D9_MOUSE Cytochrome P450 2D9 OS=Mus musculus GN=Cyp2d9 PE=1 SV=2 332 501 2.0E-11
sp|P15392|CP2A4_MOUSE Cytochrome P450 2A4 OS=Mus musculus GN=Cyp2a4 PE=2 SV=3 340 529 2.0E-11
sp|P56594|CP2CL_CANLF Cytochrome P450 2C21 (Fragment) OS=Canis lupus familiaris GN=CYP2C21 PE=2 SV=2 332 501 2.0E-11
sp|P37118|C71A2_SOLME Cytochrome P450 71A2 OS=Solanum melongena GN=CYP71A2 PE=2 SV=1 347 503 2.0E-11
sp|Q9LJY7|C75AK_ARATH Cytochrome P450 705A20 OS=Arabidopsis thaliana GN=CYP705A20 PE=2 SV=1 80 504 2.0E-11
sp|B9X287|C7346_ORYSJ Cytochrome P450 734A6 OS=Oryza sativa subsp. japonica GN=CYP734A6 PE=2 SV=1 332 541 2.0E-11
sp|Q9SXS3|C93C2_GLYEC 2-hydroxyisoflavanone synthase OS=Glycyrrhiza echinata GN=CYP93C2 PE=1 SV=1 332 507 2.0E-11
sp|O22203|C98A3_ARATH Cytochrome P450 98A3 OS=Arabidopsis thaliana GN=CYP98A3 PE=1 SV=1 328 521 2.0E-11
sp|Q94FM7|C71DK_TOBAC 5-epiaristolochene 1,3-dihydroxylase OS=Nicotiana tabacum GN=CYP71D20 PE=1 SV=2 75 510 2.0E-11
sp|Q98T91|C340_ORYLA Cytochrome P450 3A40 OS=Oryzias latipes GN=cyp3a40 PE=2 SV=1 233 499 2.0E-11
sp|C0SJS4|C71AJ_APIGR Psoralen synthase (Fragment) OS=Apium graveolens GN=CYP71AJ2 PE=1 SV=1 104 493 2.0E-11
sp|O81117|C94A1_VICSA Cytochrome P450 94A1 OS=Vicia sativa GN=CYP94A1 PE=2 SV=2 305 507 3.0E-11
sp|O14442|CP51_UNCNE Eburicol 14-alpha-demethylase OS=Uncinula necator GN=CYP51 PE=2 SV=2 334 502 3.0E-11
sp|Q69F95|C85A_PHAVU Cytochrome P450 85A OS=Phaseolus vulgaris GN=BA13 PE=3 SV=2 84 510 3.0E-11
sp|Q64458|CP2CT_MOUSE Cytochrome P450 2C29 OS=Mus musculus GN=Cyp2c29 PE=1 SV=2 49 501 3.0E-11
sp|P48421|C83A1_ARATH Cytochrome P450 83A1 OS=Arabidopsis thaliana GN=CYP83A1 PE=1 SV=2 75 489 3.0E-11
sp|Q05556|CP2AB_RABIT Cytochrome P450 2A11 OS=Oryctolagus cuniculus GN=CYP2A11 PE=1 SV=1 312 527 3.0E-11
sp|O44221|CP4E5_DROMT Cytochrome P450 4e5, mitochondrial OS=Drosophila mettleri GN=Cyp4e5 PE=2 SV=1 330 503 3.0E-11
sp|P93149|C93B1_GLYEC Licodione synthase OS=Glycyrrhiza echinata GN=CYP93B1 PE=1 SV=2 76 540 3.0E-11
sp|Q9N0U7|CP17A_CAPHI Steroid 17-alpha-hydroxylase/17,20 lyase OS=Capra hircus GN=CYP17A1 PE=2 SV=1 330 503 3.0E-11
sp|Q6UEG2|AFLN_ASPPA P450 monooxygenase AflN OS=Aspergillus parasiticus GN=aflN PE=3 SV=1 263 501 3.0E-11
sp|P12938|CP2D3_RAT Cytochrome P450 2D3 OS=Rattus norvegicus GN=Cyp2d3 PE=2 SV=2 332 501 3.0E-11
sp|Q9SBQ9|F3PH_PETHY Flavonoid 3'-monooxygenase OS=Petunia hybrida GN=CYP75B2 PE=2 SV=1 332 489 3.0E-11
sp|Q16696|CP2AD_HUMAN Cytochrome P450 2A13 OS=Homo sapiens GN=CYP2A13 PE=1 SV=3 312 501 3.0E-11
sp|Q9LTM0|C71BN_ARATH Cytochrome P450 71B23 OS=Arabidopsis thaliana GN=CYP71B23 PE=2 SV=1 329 489 4.0E-11
sp|Q29497|CP17A_SHEEP Steroid 17-alpha-hydroxylase/17,20 lyase OS=Ovis aries GN=CYP17A1 PE=2 SV=2 330 503 4.0E-11
sp|Q42600|C84A1_ARATH Cytochrome P450 84A1 OS=Arabidopsis thaliana GN=CYP84A1 PE=1 SV=1 170 507 4.0E-11
sp|Q8HYN1|CP17A_PANTR Steroid 17-alpha-hydroxylase/17,20 lyase OS=Pan troglodytes GN=CYP17A1 PE=2 SV=1 293 502 4.0E-11
sp|Q69XM6|C7344_ORYSJ Cytochrome P450 734A4 OS=Oryza sativa subsp. japonica GN=CYP734A4 PE=2 SV=1 336 540 4.0E-11
sp|Q27593|CP6A8_DROME Cytochrome P450 6a8 OS=Drosophila melanogaster GN=Cyp6a8 PE=2 SV=2 328 501 4.0E-11
sp|Q64678|CP1B1_RAT Cytochrome P450 1B1 OS=Rattus norvegicus GN=Cyp1b1 PE=1 SV=1 296 501 4.0E-11
sp|Q9VMS9|C4AC1_DROME Probable cytochrome P450 4ac1 OS=Drosophila melanogaster GN=Cyp4ac1 PE=2 SV=1 337 502 4.0E-11
sp|P56656|CP239_MOUSE Cytochrome P450 2C39 OS=Mus musculus GN=Cyp2c39 PE=1 SV=2 332 531 4.0E-11
sp|P82712|CCD1P_DROME Probable cytochrome P450 12d1 proximal, mitochondrial OS=Drosophila melanogaster GN=Cyp12d1-p PE=2 SV=3 345 503 5.0E-11
sp|O49394|C82C2_ARATH Cytochrome P450 82C2 OS=Arabidopsis thaliana GN=CYP82C2 PE=2 SV=2 337 501 5.0E-11
sp|O48922|C98A2_SOYBN Cytochrome P450 98A2 OS=Glycine max GN=CYP98A2 PE=2 SV=1 328 513 5.0E-11
sp|Q8CIM7|CP2DQ_MOUSE Cytochrome P450 2D26 OS=Mus musculus GN=Cyp2d26 PE=1 SV=1 332 501 5.0E-11
sp|P9WPN2|CP132_MYCTO Putative cytochrome P450 132 OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) GN=cyp132 PE=3 SV=1 342 500 5.0E-11
sp|P59954|CP132_MYCBO Putative cytochrome P450 132 OS=Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97) GN=cyp132 PE=3 SV=1 342 500 5.0E-11
sp|Q8HYM9|CP17A_MACMU Steroid 17-alpha-hydroxylase/17,20 lyase OS=Macaca mulatta GN=CYP17A1 PE=2 SV=1 293 502 5.0E-11
sp|Q2XVA1|CP17A_MACFA Steroid 17-alpha-hydroxylase/17,20 lyase OS=Macaca fascicularis GN=CYP17A1 PE=2 SV=1 293 502 5.0E-11
sp|P51581|CP2E1_MESAU Cytochrome P450 2E1 OS=Mesocricetus auratus GN=CYP2E1 PE=2 SV=1 292 501 5.0E-11
sp|Q8HYN0|CP17A_PAPCY Steroid 17-alpha-hydroxylase/17,20 lyase OS=Papio cynocephalus GN=CYP17A1 PE=2 SV=1 293 502 6.0E-11
sp|P9WPN3|CP132_MYCTU Putative cytochrome P450 132 OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=cyp132 PE=1 SV=1 342 500 6.0E-11
sp|Q42716|C71A8_MENPI Cytochrome P450 71A8 OS=Mentha piperita GN=CYP71A8 PE=3 SV=1 337 510 6.0E-11
sp|Q8L7D5|THAH_ARATH Cytochrome P450 708A2 OS=Arabidopsis thaliana GN=CYP708A2 PE=2 SV=3 331 501 6.0E-11
sp|P05093|CP17A_HUMAN Steroid 17-alpha-hydroxylase/17,20 lyase OS=Homo sapiens GN=CYP17A1 PE=1 SV=1 293 502 6.0E-11
sp|Q9FIB0|C78A7_ARATH Cytochrome P450 78A7 OS=Arabidopsis thaliana GN=CYP78A7 PE=2 SV=1 311 515 6.0E-11
sp|O49859|C82A4_SOYBN Cytochrome P450 82A4 OS=Glycine max GN=CYP82A4 PE=2 SV=1 297 507 6.0E-11
sp|Q5Z5R7|C701S_ORYSJ Ent-kaurene oxidase-like 3 OS=Oryza sativa subsp. japonica GN=CYP701A19 PE=2 SV=1 80 493 6.0E-11
sp|Q92045|CP11A_DASAM Cholesterol side-chain cleavage enzyme, mitochondrial (Fragment) OS=Dasyatis americana GN=CYP11A1 PE=2 SV=1 336 531 6.0E-11
sp|O23365|C97B3_ARATH Cytochrome P450 97B3, chloroplastic OS=Arabidopsis thaliana GN=CYP97B3 PE=2 SV=2 297 531 6.0E-11
sp|Q2PG45|THAS_MACFA Thromboxane-A synthase OS=Macaca fascicularis GN=TBXAS1 PE=2 SV=2 327 519 7.0E-11
sp|B1NF19|C719D_ARGME (S)-stylopine synthase OS=Argemone mexicana GN=CYP719A13 PE=1 SV=1 332 511 7.0E-11
sp|P58051|C71BE_ARATH Cytochrome P450 71B14 OS=Arabidopsis thaliana GN=CYP71B14 PE=2 SV=1 170 489 7.0E-11
sp|P51589|CP2J2_HUMAN Cytochrome P450 2J2 OS=Homo sapiens GN=CYP2J2 PE=1 SV=2 47 511 7.0E-11
sp|Q50LH4|C7193_ESCCA (S)-stylopine synthase 2 OS=Eschscholzia californica GN=CYP719A3 PE=1 SV=1 341 511 7.0E-11
sp|Q96514|C71B7_ARATH Cytochrome P450 71B7 OS=Arabidopsis thaliana GN=CYP71B7 PE=1 SV=1 323 522 7.0E-11
sp|P47787|THAS_PIG Thromboxane-A synthase OS=Sus scrofa GN=TBXAS1 PE=2 SV=1 325 519 8.0E-11
sp|P9WPM9|C135B_MYCTU Putative cytochrome P450 135B1 OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=cyp135B1 PE=1 SV=1 330 501 8.0E-11
sp|P9WPM8|C135B_MYCTO Putative cytochrome P450 135B1 OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) GN=cyp135B1 PE=3 SV=1 330 501 8.0E-11
sp|P63716|C135B_MYCBO Putative cytochrome P450 135B1 OS=Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97) GN=cyp135B1 PE=3 SV=1 330 501 8.0E-11
sp|O81970|C71A9_SOYBN Cytochrome P450 71A9 OS=Glycine max GN=CYP71A9 PE=2 SV=1 297 510 9.0E-11
sp|P15123|CP2CG_RABIT Cytochrome P450 2C16 OS=Oryctolagus cuniculus GN=CYP2C16 PE=2 SV=1 332 501 9.0E-11
sp|D5JBX1|GAO_BARSP Germacrene A oxidase OS=Barnadesia spinosa PE=1 SV=1 332 510 9.0E-11
sp|Q9LW27|C71BF_ARATH Bifunctional dihydrocamalexate synthase/camalexin synthase OS=Arabidopsis thaliana GN=CYP71B15 PE=1 SV=1 311 521 1.0E-10
sp|P24457|CP2DB_MOUSE Cytochrome P450 2D11 OS=Mus musculus GN=Cyp2d11 PE=2 SV=2 332 501 1.0E-10
sp|P52786|CP2J1_RABIT Cytochrome P450 2J1 OS=Oryctolagus cuniculus GN=CYP2J1 PE=1 SV=2 47 511 1.0E-10
sp|Q00714|STCS_EMENI Probable sterigmatocystin biosynthesis P450 monooxygenase stcS OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=stcS PE=1 SV=2 336 502 1.0E-10
sp|E1B2Z9|C7AV8_CICIN Cytochrome P450 71AV8 OS=Cichorium intybus GN=CYP71AV8 PE=2 SV=1 332 510 1.0E-10
sp|Q9LVD2|C71BA_ARATH Cytochrome P450 71B10 OS=Arabidopsis thaliana GN=CYP71B10 PE=3 SV=1 332 487 1.0E-10
sp|Q64429|CP1B1_MOUSE Cytochrome P450 1B1 OS=Mus musculus GN=Cyp1b1 PE=1 SV=3 248 501 1.0E-10
sp|B5UAQ8|C7195_ESCCA Cheilanthifoline synthase OS=Eschscholzia californica GN=CYP719A5 PE=1 SV=1 332 511 1.0E-10
sp|Q9MZY0|CP2E1_CANLF Cytochrome P450 2E1 OS=Canis lupus familiaris GN=CYP2E1 PE=2 SV=1 41 501 1.0E-10
sp|O18963|CP2E1_BOVIN Cytochrome P450 2E1 OS=Bos taurus GN=CYP2E1 PE=2 SV=1 331 502 1.0E-10
sp|Q7KR10|CCD1D_DROME Probable cytochrome P450 12d1 distal, mitochondrial OS=Drosophila melanogaster GN=Cyp12d1-d PE=2 SV=1 345 503 1.0E-10
sp|Q9QYG6|CP2DR_MESAU Cytochrome P450 2D27 OS=Mesocricetus auratus GN=CYP2D27 PE=1 SV=1 332 501 1.0E-10
sp|Q9VJ71|CP310_DROME Probable cytochrome P450 310a1 OS=Drosophila melanogaster GN=Cyp310a1 PE=2 SV=1 301 503 2.0E-10
sp|Q9GMC8|CP17A_FELCA Steroid 17-alpha-hydroxylase/17,20 lyase OS=Felis catus GN=CYP17A1 PE=2 SV=1 289 502 2.0E-10
sp|Q07217|CP11A_ONCMY Cholesterol side-chain cleavage enzyme, mitochondrial OS=Oncorhynchus mykiss GN=cyp11a1 PE=2 SV=1 312 501 2.0E-10
sp|P05182|CP2E1_RAT Cytochrome P450 2E1 OS=Rattus norvegicus GN=Cyp2e1 PE=1 SV=4 292 501 2.0E-10
sp|B9GBJ9|C14C1_ORYSJ Cytochrome P450 714C1 OS=Oryza sativa subsp. japonica GN=CYP714C1 PE=2 SV=1 343 535 2.0E-10
sp|P79383|CP2E1_PIG Cytochrome P450 2E1 OS=Sus scrofa GN=CYP2E1 PE=2 SV=1 331 502 2.0E-10
sp|Q9GLD2|CP17A_PAPHU Steroid 17-alpha-hydroxylase/17,20 lyase OS=Papio hamadryas ursinus GN=CYP17A1 PE=1 SV=1 293 501 2.0E-10
sp|Q9LUC8|C7A13_ARATH Cytochrome P450 72A13 OS=Arabidopsis thaliana GN=CYP72A13 PE=2 SV=1 281 508 2.0E-10
sp|P48420|C78A1_MAIZE Cytochrome P450 78A1 OS=Zea mays GN=CYP78A1 PE=2 SV=1 312 510 2.0E-10
sp|Q9LTL2|C71BP_ARATH Cytochrome P450 71B25 OS=Arabidopsis thaliana GN=CYP71B25 PE=2 SV=1 337 522 2.0E-10
sp|Q50EK5|C72B2_PINTA Cytochrome P450 720B2 OS=Pinus taeda GN=CYP720B2 PE=2 SV=1 332 510 2.0E-10
sp|P33269|CP4D1_DROME Cytochrome P450 4d1 OS=Drosophila melanogaster GN=Cyp4d1 PE=2 SV=2 330 540 2.0E-10
sp|O48957|C99A1_SORBI Cytochrome P450 CYP99A1 (Fragment) OS=Sorghum bicolor GN=CYP99A1 PE=2 SV=1 261 511 2.0E-10
sp|P24461|CP2G1_RABIT Cytochrome P450 2G1 OS=Oryctolagus cuniculus GN=CYP2G1 PE=1 SV=1 332 538 2.0E-10
sp|O16805|CP4D1_DROSI Cytochrome P450 4d1 OS=Drosophila simulans GN=Cyp4d1 PE=3 SV=1 330 540 2.0E-10
sp|Q2KIG5|THAS_BOVIN Thromboxane-A synthase OS=Bos taurus GN=TBXAS1 PE=2 SV=1 320 489 2.0E-10
sp|H2DH22|C7A10_PANGI Cytochrome P450 CYP73A100 OS=Panax ginseng PE=2 SV=1 282 519 2.0E-10
sp|Q9QYG5|CP2DK_MESAU Cytochrome P450 2D20 OS=Mesocricetus auratus GN=CYP2D20 PE=2 SV=1 332 501 2.0E-10
sp|P05185|CP17A_BOVIN Steroid 17-alpha-hydroxylase/17,20 lyase OS=Bos taurus GN=CYP17A1 PE=2 SV=1 330 503 2.0E-10
sp|Q9NGX9|CP302_DROME Cytochrome P450 302a1, mitochondrial OS=Drosophila melanogaster GN=dib PE=2 SV=2 336 497 2.0E-10
sp|Q9AXM6|T10H_TAXCU Taxane 10-beta-hydroxylase OS=Taxus cuspidata GN=CYP725A1 PE=1 SV=1 45 501 2.0E-10
sp|Q9SAE4|C71BT_ARATH Cytochrome P450 71B29 OS=Arabidopsis thaliana GN=CYP71B29 PE=3 SV=1 312 501 3.0E-10
sp|Q9VYT8|C28C1_DROME Probable cytochrome P450 28c1 OS=Drosophila melanogaster GN=Cyp28c1 PE=2 SV=1 298 489 3.0E-10
sp|Q556M5|C5081_DICDI Probable cytochrome P450 508A1 OS=Dictyostelium discoideum GN=cyp508A1-1 PE=3 SV=1 337 510 3.0E-10
sp|P10634|CP2DQ_RAT Cytochrome P450 2D26 OS=Rattus norvegicus GN=Cyp2d26 PE=1 SV=2 332 501 3.0E-10
sp|D1MI46|C76BA_SWEMU Geraniol 8-hydroxylase OS=Swertia mussotii GN=CYP76B10 PE=1 SV=1 337 540 3.0E-10
sp|O48923|C71DA_SOYBN Cytochrome P450 71D10 OS=Glycine max GN=CYP71D10 PE=2 SV=1 271 510 3.0E-10
sp|Q9FMV7|C94B1_ARATH Cytochrome P450 94B1 OS=Arabidopsis thaliana GN=CYP94B1 PE=2 SV=1 337 502 3.0E-10
sp|Q6GUQ4|CP2E1_MACMU Cytochrome P450 2E1 OS=Macaca mulatta GN=CYP2E1 PE=2 SV=1 75 501 3.0E-10
sp|H2KYS3|DAF9_CAEEL Cytochrome P450 daf-9 OS=Caenorhabditis elegans GN=daf-9 PE=1 SV=1 297 507 3.0E-10
sp|Q64410|CP17A_CAVPO Steroid 17-alpha-hydroxylase/17,20 lyase OS=Cavia porcellus GN=CYP17A1 PE=1 SV=1 331 510 3.0E-10
sp|O48928|C77A3_SOYBN Cytochrome P450 77A3 OS=Glycine max GN=CYP77A3 PE=2 SV=1 322 510 3.0E-10
sp|O18809|CP2F3_CAPHI Cytochrome P450 2F3 OS=Capra hircus GN=CYP2F3 PE=2 SV=1 70 501 3.0E-10
sp|Q64403|CP2DG_CAVPO Cytochrome P450 2D16 OS=Cavia porcellus GN=CYP2D16 PE=1 SV=1 332 501 3.0E-10
sp|Q27606|CP4E2_DROME Cytochrome P450 4e2 OS=Drosophila melanogaster GN=Cyp4e2 PE=2 SV=2 330 503 4.0E-10
sp|P05181|CP2E1_HUMAN Cytochrome P450 2E1 OS=Homo sapiens GN=CYP2E1 PE=1 SV=1 41 501 4.0E-10
sp|Q9T0K0|C71AJ_ARATH Cytochrome P450 71A19 OS=Arabidopsis thaliana GN=CYP71A19 PE=2 SV=1 78 516 4.0E-10
sp|Q9T0K2|C71AK_ARATH Cytochrome P450 71A20 OS=Arabidopsis thaliana GN=CYP71A20 PE=2 SV=2 78 516 4.0E-10
sp|Q964R0|CP6K1_BLAGE Cytochrome P450 6k1 OS=Blattella germanica GN=CYP6K1 PE=2 SV=1 323 489 4.0E-10
sp|P48418|C75A1_PETHY Flavonoid 3',5'-hydroxylase 1 OS=Petunia hybrida GN=CYP75A1 PE=2 SV=1 332 502 4.0E-10
sp|Q940V4|C85A2_ARATH Cytochrome P450 85A2 OS=Arabidopsis thaliana GN=CYP85A2 PE=2 SV=1 331 534 4.0E-10
sp|P13107|CP2B3_RAT Cytochrome P450 2B3 OS=Rattus norvegicus GN=Cyp2b3 PE=2 SV=1 332 501 5.0E-10
sp|Q50LE0|C85A3_SOLLC Cytochrome P450 85A3 OS=Solanum lycopersicum GN=CYP85A3 PE=2 SV=1 303 510 5.0E-10
sp|P48416|CP10_LYMST Cytochrome P450 10 OS=Lymnaea stagnalis GN=CYP10 PE=2 SV=1 336 503 5.0E-10
sp|P48419|C75A3_PETHY Flavonoid 3',5'-hydroxylase 2 OS=Petunia hybrida GN=CYP75A3 PE=2 SV=1 332 502 5.0E-10
sp|Q5KQT7|CP1A1_FELCA Cytochrome P450 1A1 OS=Felis catus GN=CYP1A1 PE=2 SV=1 332 523 5.0E-10
sp|Q02315|CP51_PICKU Lanosterol 14-alpha demethylase (Fragment) OS=Pichia kudriavzevii GN=CYP51 PE=3 SV=1 113 487 5.0E-10
sp|Q9GMC7|CP17A_BISBI Steroid 17-alpha-hydroxylase/17,20 lyase OS=Bison bison GN=CYP17A1 PE=2 SV=1 330 503 5.0E-10
sp|Q6Z5I7|C76M6_ORYSJ Oryzalexin E synthase OS=Oryza sativa subsp. japonica GN=CYP76M6 PE=1 SV=1 335 510 5.0E-10
sp|D4AY62|A1131_ARTBC Cytochrome P450 ARB_01131 OS=Arthroderma benhamiae (strain ATCC MYA-4681 / CBS 112371) GN=ARB_01131 PE=3 SV=1 342 498 5.0E-10
sp|Q64680|CP2DI_RAT Cytochrome P450 2D18 OS=Rattus norvegicus GN=Cyp2d18 PE=2 SV=1 332 501 5.0E-10
sp|Q9GQM9|CP6L1_BLAGE Cytochrome P450 6l1 OS=Blattella germanica GN=CYP6L1 PE=2 SV=1 333 517 6.0E-10
sp|P9WPM1|CP139_MYCTU Putative cytochrome P450 139 OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=cyp139 PE=1 SV=1 332 503 6.0E-10
sp|P9WPM0|CP139_MYCTO Putative cytochrome P450 139 OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) GN=cyp139 PE=3 SV=1 332 503 6.0E-10
sp|P63720|CP139_MYCBO Putative cytochrome P450 139 OS=Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97) GN=cyp139 PE=3 SV=1 332 503 6.0E-10
sp|P79402|CP242_PIG Cytochrome P450 2C42 (Fragment) OS=Sus scrofa GN=CYP2C42 PE=2 SV=1 252 511 6.0E-10
sp|Q9V776|CP317_DROME Probable cytochrome P450 317a1 OS=Drosophila melanogaster GN=Cyp317a1 PE=3 SV=2 336 489 6.0E-10
sp|Q9V774|C6A21_DROME Probable cytochrome P450 6a21 OS=Drosophila melanogaster GN=Cyp6a21 PE=2 SV=1 350 501 6.0E-10
sp|P11509|CP2A6_HUMAN Cytochrome P450 2A6 OS=Homo sapiens GN=CYP2A6 PE=1 SV=3 52 527 6.0E-10
sp|I3PFJ5|C76AD_BETVU Cytochrome P450 76AD1 OS=Beta vulgaris GN=CYP76AD1 PE=2 SV=1 336 499 6.0E-10
sp|P58050|C71BD_ARATH Cytochrome P450 71B13 OS=Arabidopsis thaliana GN=CYP71B13 PE=2 SV=1 332 500 6.0E-10
sp|O48927|C78A3_SOYBN Cytochrome P450 78A3 OS=Glycine max GN=CYP78A3 PE=2 SV=1 332 490 7.0E-10
sp|O64636|C76C1_ARATH Cytochrome P450 76C1 OS=Arabidopsis thaliana GN=CYP76C1 PE=2 SV=1 336 526 7.0E-10
sp|O62671|CP241_CANLF Cytochrome P450 2C41 OS=Canis lupus familiaris GN=CYP2C41 PE=2 SV=1 311 511 7.0E-10
sp|P56655|CP238_MOUSE Cytochrome P450 2C38 OS=Mus musculus GN=Cyp2c38 PE=2 SV=2 75 531 8.0E-10
sp|F2Z9C1|P6H_ESCCA Protopine 6-monooxygenase OS=Eschscholzia californica GN=CYP82N2v2 PE=1 SV=1 334 503 8.0E-10
sp|Q9SLP1|C78A9_ARATH Cytochrome P450 78A9 OS=Arabidopsis thaliana GN=CYP78A9 PE=2 SV=1 73 540 8.0E-10
sp|Q9LZ31|C77A4_ARATH Cytochrome P450 77A4 OS=Arabidopsis thaliana GN=CYP77A4 PE=2 SV=1 322 513 9.0E-10
sp|Q9LMX7|C78A5_ARATH Cytochrome P450 78A5 OS=Arabidopsis thaliana GN=CYP78A5 PE=2 SV=1 72 523 9.0E-10
sp|Q27516|C13A8_CAEEL Putative cytochrome P450 CYP13A8 OS=Caenorhabditis elegans GN=cyp-13A8 PE=3 SV=2 330 511 9.0E-10
sp|D5JBW8|GAO_CICIN Germacrene A oxidase OS=Cichorium intybus PE=1 SV=1 332 510 1.0E-09
sp|P33264|CP2CR_MESAU Cytochrome P450 2C27 OS=Mesocricetus auratus GN=CYP2C27 PE=2 SV=1 332 531 1.0E-09
sp|Q6QNI4|C71AJ_AMMMJ Psoralen synthase OS=Ammi majus GN=CYP71AJ1 PE=1 SV=1 337 493 1.0E-09
sp|P79716|CP1A1_DICLA Cytochrome P450 1A1 OS=Dicentrarchus labrax GN=cyp1a1 PE=2 SV=1 333 515 1.0E-09
sp|O65787|C71B6_ARATH Cytochrome P450 71B6 OS=Arabidopsis thaliana GN=CYP71B6 PE=2 SV=1 332 487 1.0E-09
sp|Q9ZNR0|C78A6_ARATH Cytochrome P450 78A6 OS=Arabidopsis thaliana GN=CYP78A6 PE=2 SV=1 332 490 1.0E-09
sp|Q9V559|CP4P3_DROME Probable cytochrome P450 4p3 OS=Drosophila melanogaster GN=Cyp4p3 PE=2 SV=3 337 493 1.0E-09
sp|P33261|CP2CJ_HUMAN Cytochrome P450 2C19 OS=Homo sapiens GN=CYP2C19 PE=1 SV=3 231 501 1.0E-09
sp|Q05421|CP2E1_MOUSE Cytochrome P450 2E1 OS=Mus musculus GN=Cyp2e1 PE=1 SV=1 292 501 1.0E-09
sp|Q9V771|C6A23_DROME Probable cytochrome P450 6a23 OS=Drosophila melanogaster GN=Cyp6a23 PE=2 SV=2 336 489 1.0E-09
sp|Q5Z5R4|C7016_ORYSJ Ent-kaurene oxidase 2 OS=Oryza sativa subsp. japonica GN=CYP701A6 PE=1 SV=1 80 493 1.0E-09
sp|Q1ZXL7|C5083_DICDI Probable cytochrome P450 508A3 OS=Dictyostelium discoideum GN=cyp508A3-1 PE=3 SV=1 337 510 1.0E-09
sp|Q9VE01|C12A5_DROME Probable cytochrome P450 12a5, mitochondrial OS=Drosophila melanogaster GN=Cyp12a5 PE=2 SV=1 344 515 1.0E-09
sp|Q9VFP1|CP6D5_DROME Probable cytochrome P450 6d5 OS=Drosophila melanogaster GN=Cyp6d5 PE=2 SV=1 337 503 1.0E-09
sp|Q29510|CP2CU_RABIT Cytochrome P450 2C30 OS=Oryctolagus cuniculus GN=CYP2C30 PE=2 SV=1 332 511 1.0E-09
sp|Q9LTL8|C71BO_ARATH Cytochrome P450 71B24 OS=Arabidopsis thaliana GN=CYP71B24 PE=2 SV=1 337 493 1.0E-09
sp|P33262|CP2CK_MACFA Cytochrome P450 2C20 OS=Macaca fascicularis GN=CYP2C20 PE=2 SV=1 234 501 1.0E-09
sp|D5J9U8|GAO_LACSA Germacrene A oxidase OS=Lactuca sativa GN=GAO1 PE=1 SV=1 332 510 1.0E-09
sp|I3V6B1|C80BX_PAPSO (S)-N-methylcoclaurine 3'-hydroxylase-like protein OS=Papaver somniferum GN=CYP80BX PE=2 SV=1 334 489 1.0E-09
sp|Q6YV88|C71Z7_ORYSJ Ent-cassadiene C2-hydroxylase OS=Oryza sativa subsp. japonica GN=CYP71Z7 PE=1 SV=1 322 502 1.0E-09
sp|Q9LMM1|C86A4_ARATH Cytochrome P450 86A4 OS=Arabidopsis thaliana GN=CYP86A4 PE=1 SV=1 332 540 1.0E-09
sp|Q9VMT5|C28D1_DROME Probable cytochrome P450 28d1 OS=Drosophila melanogaster GN=Cyp28d1 PE=2 SV=1 336 499 1.0E-09
sp|Q95031|CP6B6_HELAM Cytochrome P450 6B6 OS=Helicoverpa armigera GN=CYP6B6 PE=2 SV=1 311 503 1.0E-09
sp|Q9LUC9|C7A11_ARATH Cytochrome P450 72A11 OS=Arabidopsis thaliana GN=CYP72A11 PE=2 SV=1 281 535 1.0E-09
sp|O35293|CP2F2_RAT Cytochrome P450 2F2 OS=Rattus norvegicus GN=Cyp2f2 PE=2 SV=1 128 523 1.0E-09
sp|P37121|C76A1_SOLME Cytochrome P450 76A1 (Fragment) OS=Solanum melongena GN=CYP76A1 PE=2 SV=1 323 535 1.0E-09
sp|O35132|CP27B_RAT 25-hydroxyvitamin D-1 alpha hydroxylase, mitochondrial OS=Rattus norvegicus GN=Cyp27b1 PE=2 SV=2 337 503 2.0E-09
sp|P20853|CP2A7_HUMAN Cytochrome P450 2A7 OS=Homo sapiens GN=CYP2A7 PE=2 SV=2 337 527 2.0E-09
sp|P58048|C71B8_ARATH Cytochrome P450 71B8 OS=Arabidopsis thaliana GN=CYP71B8 PE=3 SV=1 302 511 2.0E-09
sp|P33263|CP2CQ_MESAU Cytochrome P450 2C26 OS=Mesocricetus auratus GN=CYP2C26 PE=2 SV=1 332 531 2.0E-09
sp|Q9FF18|C7351_ARATH Cytokinin hydroxylase OS=Arabidopsis thaliana GN=CYP735A1 PE=1 SV=1 343 530 2.0E-09
sp|Q9SRQ1|C89A9_ARATH Cytochrome P450 89A9 OS=Arabidopsis thaliana GN=CYP89A9 PE=2 SV=1 266 510 2.0E-09
sp|P11712|CP2C9_HUMAN Cytochrome P450 2C9 OS=Homo sapiens GN=CYP2C9 PE=1 SV=3 332 501 2.0E-09
sp|Q9ZU07|C71BC_ARATH Cytochrome P450 71B12 OS=Arabidopsis thaliana GN=CYP71B12 PE=2 SV=1 75 489 2.0E-09
sp|Q6XQ14|C71E7_MANES 2-methylbutanal oxime monooxygenase OS=Manihot esculenta GN=CYP71E7 PE=1 SV=1 333 489 2.0E-09
sp|Q9LTL0|C71BQ_ARATH Cytochrome P450 71B26 OS=Arabidopsis thaliana GN=CYP71B26 PE=2 SV=1 170 507 2.0E-09
sp|P9WPM5|CP137_MYCTU Putative cytochrome P450 137 OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=cyp137 PE=1 SV=1 332 509 2.0E-09
sp|P9WPM4|CP137_MYCTO Putative cytochrome P450 137 OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) GN=cyp137 PE=3 SV=1 332 509 2.0E-09
sp|Q9WVK8|CP46A_MOUSE Cholesterol 24-hydroxylase OS=Mus musculus GN=Cyp46a1 PE=1 SV=1 94 503 2.0E-09
sp|O49858|C82A3_SOYBN Cytochrome P450 82A3 OS=Glycine max GN=CYP82A3 PE=2 SV=1 340 500 2.0E-09
sp|P19100|CP17A_PIG Steroid 17-alpha-hydroxylase/17,20 lyase OS=Sus scrofa GN=CYP17A1 PE=2 SV=3 325 500 2.0E-09
sp|P13108|CP2D4_RAT Cytochrome P450 2D4 OS=Rattus norvegicus GN=Cyp2d4 PE=2 SV=2 332 501 2.0E-09
sp|Q0DS59|C14B2_ORYSJ Cytochrome P450 714B2 OS=Oryza sativa subsp. japonica GN=CYP714B2 PE=1 SV=2 337 501 2.0E-09
sp|A3A871|C71Z6_ORYSJ Ent-isokaurene C2-hydroxylase OS=Oryza sativa subsp. japonica GN=CYP71Z6 PE=1 SV=1 322 510 2.0E-09
[Show less]

GO

GO Term Description Terminal node
GO:0004497 monooxygenase activity Yes
GO:0020037 heme binding Yes
GO:0005506 iron ion binding Yes
GO:0016705 oxidoreductase activity, acting on paired donors, with incorporation or reduction of molecular oxygen Yes
GO:0003824 catalytic activity No
GO:0046872 metal ion binding No
GO:0046906 tetrapyrrole binding No
GO:0003674 molecular_function No
GO:0005488 binding No
GO:1901363 heterocyclic compound binding No
GO:0016491 oxidoreductase activity No
GO:0097159 organic cyclic compound binding No
GO:0043167 ion binding No
GO:0046914 transition metal ion binding No
GO:0043169 cation binding No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 11 0.5

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >OphauB2|7320
MASAAVANATAHSASVLDSLTASSKYGGIALPVQVDHVVRALGATSPWALLLTLVAMCVVYDQVSYIINKGSIAG
PSWKLPFIGPFLQSVNPKFEEYYSKWASGPLSCVSVFHKFVVIASTRDMARKVLNSPAYVKPCVVDAAHKLLGHD
NWVFLDGKAHVDFRKGLNGLFTRKALESYLPGQEEVYKRYFEKFVNVTRHNGGKPVPFMAEFRELMCAVSCRTFV
GHYMSNESIKKIADDYYLITAALELVNFPIIVPYTKTWYGKKAADMVLGEFAKCAAKSKVRMAAGGDVTCIMDGW
ILQMLESERWRRAQEQDSAPLGDKPSPLLRMFTDYEIAQTIFTFLFASQDATSSAATWLFQIVAQRPDVLDRVRD
ENLKVRNGNLHAELNMDQLESLTYTRAVVRELLRYRPPVLMIPYEVKKAFPITDSYTVPKGSMLVPTTYMALHDP
DVYDKPDDFDPDRYYSGDAEARGAKNYLVFGTGPHYCLGQLYAQLNLALFLGKASVLLKWTHHATPLSEEIKVFA
TIFPKDDCPLTFEERTP*
Coding >OphauB2|7320
ATGGCTTCTGCCGCTGTTGCCAATGCGACTGCCCACTCTGCCTCTGTCCTGGACTCGTTGACTGCCAGCTCAAAG
TATGGCGGCATTGCTCTGCCTGTGCAGGTGGATCACGTTGTCCGAGCCCTCGGCGCAACGAGCCCCTGGGCGCTG
CTCTTGACCCTGGTGGCAATGTGCGTCGTTTACGATCAAGTGAGCTACATCATCAACAAGGGCTCCATTGCTGGC
CCCTCGTGGAAGCTTCCCTTTATCGGCCCCTTTTTACAGTCTGTAAATCCCAAGTTTGAGGAATACTACTCCAAA
TGGGCCAGCGGGCCCCTGAGCTGCGTCTCCGTCTTCCACAAGTTTGTCGTGATTGCTTCGACGCGAGACATGGCC
CGCAAGGTGCTCAACTCACCGGCCTATGTCAAGCCTTGTGTCGTGGATGCTGCTCACAAGCTCCTTGGCCACGAT
AACTGGGTCTTTCTCGATGGCAAGGCCCATGTCGACTTTCGCAAAGGCCTCAATGGCCTCTTCACCCGCAAGGCT
CTCGAGTCGTATCTGCCCGGCCAGGAAGAGGTGTACAAGCGCTACTTTGAAAAGTTTGTCAATGTGACGCGGCAC
AATGGCGGAAAGCCTGTGCCCTTCATGGCCGAGTTTCGCGAGCTCATGTGCGCCGTCTCGTGCCGCACCTTTGTC
GGCCACTACATGTCCAACGAGTCCATCAAGAAGATTGCCGACGACTACTACCTCATCACGGCCGCCCTTGAGCTT
GTAAACTTTCCCATCATTGTGCCCTATACCAAGACGTGGTATGGCAAAAAGGCGGCCGACATGGTGCTGGGCGAA
TTTGCAAAATGCGCAGCTAAGAGCAAGGTGCGCATGGCTGCTGGCGGCGATGTGACTTGCATCATGGACGGCTGG
ATTCTGCAGATGCTAGAGTCTGAGCGCTGGCGAAGGGCTCAGGAGCAAGACTCGGCGCCTCTGGGCGACAAGCCA
TCGCCCCTGCTGCGCATGTTTACCGACTATGAAATTGCCCAAACCATTTTTACCTTTCTCTTTGCCTCGCAAGAT
GCCACGAGCAGCGCCGCCACTTGGCTCTTCCAAATCGTTGCCCAGCGACCCGACGTGCTTGACCGCGTGCGAGAC
GAGAACCTCAAGGTTCGCAATGGCAATTTGCACGCCGAGCTCAATATGGATCAACTCGAATCCCTTACTTATACT
CGCGCCGTTGTTCGGGAGCTTTTGCGCTACCGGCCCCCCGTCCTCATGATTCCCTACGAGGTCAAGAAGGCGTTT
CCTATAACCGACTCTTATACCGTTCCCAAGGGCTCCATGCTCGTTCCCACAACATACATGGCGCTTCACGACCCC
GACGTGTACGACAAGCCCGACGACTTTGACCCCGATCGCTACTACTCTGGTGATGCCGAGGCCAGGGGCGCCAAG
AACTATCTTGTTTTTGGCACCGGTCCGCACTATTGCCTGGGCCAGCTGTACGCCCAGCTCAACCTGGCGCTGTTT
CTCGGCAAGGCTTCGGTCCTTCTCAAGTGGACTCATCATGCCACGCCTCTGTCGGAGGAGATTAAAGTCTTTGCC
ACCATTTTTCCCAAGGACGATTGCCCGCTTACGTTTGAAGAGCGTACGCCATGA
Transcript >OphauB2|7320
ATGGCTTCTGCCGCTGTTGCCAATGCGACTGCCCACTCTGCCTCTGTCCTGGACTCGTTGACTGCCAGCTCAAAG
TATGGCGGCATTGCTCTGCCTGTGCAGGTGGATCACGTTGTCCGAGCCCTCGGCGCAACGAGCCCCTGGGCGCTG
CTCTTGACCCTGGTGGCAATGTGCGTCGTTTACGATCAAGTGAGCTACATCATCAACAAGGGCTCCATTGCTGGC
CCCTCGTGGAAGCTTCCCTTTATCGGCCCCTTTTTACAGTCTGTAAATCCCAAGTTTGAGGAATACTACTCCAAA
TGGGCCAGCGGGCCCCTGAGCTGCGTCTCCGTCTTCCACAAGTTTGTCGTGATTGCTTCGACGCGAGACATGGCC
CGCAAGGTGCTCAACTCACCGGCCTATGTCAAGCCTTGTGTCGTGGATGCTGCTCACAAGCTCCTTGGCCACGAT
AACTGGGTCTTTCTCGATGGCAAGGCCCATGTCGACTTTCGCAAAGGCCTCAATGGCCTCTTCACCCGCAAGGCT
CTCGAGTCGTATCTGCCCGGCCAGGAAGAGGTGTACAAGCGCTACTTTGAAAAGTTTGTCAATGTGACGCGGCAC
AATGGCGGAAAGCCTGTGCCCTTCATGGCCGAGTTTCGCGAGCTCATGTGCGCCGTCTCGTGCCGCACCTTTGTC
GGCCACTACATGTCCAACGAGTCCATCAAGAAGATTGCCGACGACTACTACCTCATCACGGCCGCCCTTGAGCTT
GTAAACTTTCCCATCATTGTGCCCTATACCAAGACGTGGTATGGCAAAAAGGCGGCCGACATGGTGCTGGGCGAA
TTTGCAAAATGCGCAGCTAAGAGCAAGGTGCGCATGGCTGCTGGCGGCGATGTGACTTGCATCATGGACGGCTGG
ATTCTGCAGATGCTAGAGTCTGAGCGCTGGCGAAGGGCTCAGGAGCAAGACTCGGCGCCTCTGGGCGACAAGCCA
TCGCCCCTGCTGCGCATGTTTACCGACTATGAAATTGCCCAAACCATTTTTACCTTTCTCTTTGCCTCGCAAGAT
GCCACGAGCAGCGCCGCCACTTGGCTCTTCCAAATCGTTGCCCAGCGACCCGACGTGCTTGACCGCGTGCGAGAC
GAGAACCTCAAGGTTCGCAATGGCAATTTGCACGCCGAGCTCAATATGGATCAACTCGAATCCCTTACTTATACT
CGCGCCGTTGTTCGGGAGCTTTTGCGCTACCGGCCCCCCGTCCTCATGATTCCCTACGAGGTCAAGAAGGCGTTT
CCTATAACCGACTCTTATACCGTTCCCAAGGGCTCCATGCTCGTTCCCACAACATACATGGCGCTTCACGACCCC
GACGTGTACGACAAGCCCGACGACTTTGACCCCGATCGCTACTACTCTGGTGATGCCGAGGCCAGGGGCGCCAAG
AACTATCTTGTTTTTGGCACCGGTCCGCACTATTGCCTGGGCCAGCTGTACGCCCAGCTCAACCTGGCGCTGTTT
CTCGGCAAGGCTTCGGTCCTTCTCAAGTGGACTCATCATGCCACGCCTCTGTCGGAGGAGATTAAAGTCTTTGCC
ACCATTTTTCCCAAGGACGATTGCCCGCTTACGTTTGAAGAGCGTACGCCATGA
Gene >OphauB2|7320
ATGGCTTCTGCCGCTGTTGCCAATGCGACTGCCCACTCTGCCTCTGTCCTGGACTCGTTGACTGCCAGCTCAAAG
TATGGCGGCATTGCTCTGCCTGTGCAGGTGGATCACGTTGTCCGAGCCCTCGGCGCAACGAGCCCCTGGGCGCTG
CTCTTGACCCTGGTGGCAATGTGCGTCGTTTACGATCAAGGTGCGTTGTTGTGGTGGTTGAATGGGCTGGGAGAG
GGCTTTTGCAACTGACCGACGTGGCTGCCACAAGTGAGCTACATCATCAACAAGGGCTCCATTGCTGGCCCCTCG
TGGAAGCTTCCCTTTATCGGCCCCTTTTTACAGTCTGTAAATCCCAAGTTTGAGGAATACTACTCCAAATGGGCC
AGCGGGCCCCTGAGCTGCGTCTCCGTCTTCCACAAGTACTCGCCGCCGCAGCCCCCTTTTTGCTTGGCTGGCCAT
GCAGATGCTGACTGGCAAATGCAGGTTTGTCGTGATTGCTTCGACGCGAGACATGGCCCGCAAGGTGCTCAACTC
ACCGGCCTATGTCAAGCCTTGTGTCGTGGATGCTGCTCACAAGCTCCTTGGCCACGATAACTGGGTCTTTCTCGA
TGGCAAGGCCCATGTCGACTTTCGCAAAGGCCTCAATGGCCTCTTCACCCGCAAGGCTCTCGAGTCGTATCTGCC
CGGCCAGGAAGAGGTGTACAAGCGCTACTTTGAAAAGTTTGTCAATGTGACGCGGCACAATGGCGGAAAGCCTGT
GCCCTTCATGGCCGAGTTTCGCGAGCTCATGTGCGCCGTCTCGTGCCGCACCTTTGTCGGCCACTACATGTCCAA
CGAGTCCATCAAGAAGATTGCCGACGACTACTACCTCATCACGGCCGCCCTTGAGCTTGTAAACTTTCCCATCAT
TGTGCCCTATACCAAGACGTGGTATGGCAAAAAGGCGGCCGACATGGTGCTGGGCGAATTTGCAAAATGCGCAGC
TAAGAGCAAGGTGCGCATGGCTGCTGGCGGCGATGTGACTTGCATCATGGACGGCTGGATTCTGCAGATGCTAGA
GTCTGAGCGCTGGCGAAGGGCTCAGGAGCAAGACTCGGCGCCTCTGGGCGACAAGCCATCGCCCCTGCTGCGCAT
GTTTACCGACTATGAAATTGCCCAAACCATTTTTACCTTTCTCTTTGCCTCGCAAGATGCCACGAGCAGCGCCGC
CACTTGGCTCTTCCAAATCGTTGCCCAGCGACCCGACGTGCTTGACCGCGTGCGAGACGAGAACCTCAAGGTTCG
CAATGGCAATTTGCACGCCGAGCTCAATATGGATCAACTCGAATCCCTTACTTATACTCGCGCCGTTGTTCGGGA
GCTTTTGCGCTACCGGCCCCCCGTCCTCATGATTCCCTACGAGGTCAAGAAGGCGTTTCCTATAACCGACTCTTA
TACCGTTCCCAAGGGTATGTCTATTGGCGCGCGCAAGTTGGAACCGTGACGGCCAATGTCAGACTAACCAGAGCT
GCCATGATTTGTAGGCTCCATGCTCGTTCCCACAACATACATGGCGCTTCACGACCCCGACGTGTACGACAAGCC
CGACGACTTTGACCCCGATCGCTACTACTCTGGTGATGCCGAGGCCAGGGGCGCCAAGAACTATCTTGTTTTTGG
CACCGGTCCGCACTATTGCCTGGGCCAGCTGTACGCCCAGCTCAACCTGGCGCTGTTTCTCGGCAAGGCTTCGGT
CCTTCTCAAGTGGACTCATCATGCCACGCCTCTGTCGGAGGAGATTAAAGTCTTTGCCACCATTTTTCCCAAGGT
GAGGGCGGGAAAAGCAGACCCCCCCGGTTGTAGCCCAAGGTGCTGACTTGAAGCGCACCAGGACGATTGCCCGCT
TACGTTTGAAGAGCGTACGCCATGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail