Fungal Genomics

at Utrecht University

General Properties

Protein IDOphauB2|7318
Gene name
LocationContig_77:71411..72873
Strand-
Gene length (bp)1462
Transcript length (bp)1389
Coding sequence length (bp)1389
Protein length (aa) 463

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF10436 BCDHK_Adom3 Mitochondrial branched-chain alpha-ketoacid dehydrogenase kinase 1.5E-44 74 250
PF02518 HATPase_c Histidine kinase-, DNA gyrase B-, and HSP90-like ATPase 1.0E-11 295 455

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q2KJG8|BCKD_BOVIN [3-methyl-2-oxobutanoate dehydrogenase [lipoamide]] kinase, mitochondrial OS=Bos taurus GN=BCKDK PE=2 SV=1 90 457 8.0E-62
sp|O14874|BCKD_HUMAN [3-methyl-2-oxobutanoate dehydrogenase [lipoamide]] kinase, mitochondrial OS=Homo sapiens GN=BCKDK PE=1 SV=2 51 457 6.0E-61
sp|Q00972|BCKD_RAT [3-methyl-2-oxobutanoate dehydrogenase [lipoamide]] kinase, mitochondrial OS=Rattus norvegicus GN=Bckdk PE=1 SV=2 51 457 8.0E-61
sp|O55028|BCKD_MOUSE [3-methyl-2-oxobutanoate dehydrogenase [lipoamide]] kinase, mitochondrial OS=Mus musculus GN=Bckdk PE=1 SV=1 90 457 3.0E-60
sp|P40530|PDK1_YEAST [Pyruvate dehydrogenase (acetyl-transferring)] kinase 1, mitochondrial OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=PKP1 PE=1 SV=1 84 456 2.0E-48
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q2KJG8|BCKD_BOVIN [3-methyl-2-oxobutanoate dehydrogenase [lipoamide]] kinase, mitochondrial OS=Bos taurus GN=BCKDK PE=2 SV=1 90 457 8.0E-62
sp|O14874|BCKD_HUMAN [3-methyl-2-oxobutanoate dehydrogenase [lipoamide]] kinase, mitochondrial OS=Homo sapiens GN=BCKDK PE=1 SV=2 51 457 6.0E-61
sp|Q00972|BCKD_RAT [3-methyl-2-oxobutanoate dehydrogenase [lipoamide]] kinase, mitochondrial OS=Rattus norvegicus GN=Bckdk PE=1 SV=2 51 457 8.0E-61
sp|O55028|BCKD_MOUSE [3-methyl-2-oxobutanoate dehydrogenase [lipoamide]] kinase, mitochondrial OS=Mus musculus GN=Bckdk PE=1 SV=1 90 457 3.0E-60
sp|P40530|PDK1_YEAST [Pyruvate dehydrogenase (acetyl-transferring)] kinase 1, mitochondrial OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=PKP1 PE=1 SV=1 84 456 2.0E-48
sp|Q9SBJ1|PDK_ARATH [Pyruvate dehydrogenase (acetyl-transferring)] kinase, mitochondrial OS=Arabidopsis thaliana GN=PDK PE=1 SV=1 71 458 4.0E-46
sp|Q1KMR4|PDK4_RHIFE [Pyruvate dehydrogenase (acetyl-transferring)] kinase isozyme 4, mitochondrial OS=Rhinolophus ferrumequinum GN=PDK4 PE=2 SV=1 81 459 2.0E-35
sp|Q16654|PDK4_HUMAN [Pyruvate dehydrogenase (acetyl-transferring)] kinase isozyme 4, mitochondrial OS=Homo sapiens GN=PDK4 PE=1 SV=1 81 459 4.0E-35
sp|O54937|PDK4_RAT [Pyruvate dehydrogenase (acetyl-transferring)] kinase isozyme 4, mitochondrial OS=Rattus norvegicus GN=Pdk4 PE=1 SV=1 81 459 2.0E-34
sp|O70571|PDK4_MOUSE [Pyruvate dehydrogenase (acetyl-transferring)] kinase isozyme 4, mitochondrial OS=Mus musculus GN=Pdk4 PE=1 SV=1 81 459 2.0E-33
sp|Q9P6P9|PDK_SCHPO [Pyruvate dehydrogenase (acetyl-transferring)] kinase, mitochondrial OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=pkp1 PE=3 SV=1 66 455 6.0E-33
sp|O88345|PDK4_ICTTR [Pyruvate dehydrogenase (acetyl-transferring)] kinase isozyme 4, mitochondrial OS=Ictidomys tridecemlineatus GN=PDK4 PE=2 SV=1 81 459 1.0E-32
sp|Q64536|PDK2_RAT [Pyruvate dehydrogenase (acetyl-transferring)] kinase isozyme 2, mitochondrial OS=Rattus norvegicus GN=Pdk2 PE=1 SV=1 74 459 8.0E-32
sp|Q15119|PDK2_HUMAN [Pyruvate dehydrogenase (acetyl-transferring)] kinase isozyme 2, mitochondrial OS=Homo sapiens GN=PDK2 PE=1 SV=2 58 459 2.0E-31
sp|Q9JK42|PDK2_MOUSE [Pyruvate dehydrogenase (acetyl-transferring)] kinase isozyme 2, mitochondrial OS=Mus musculus GN=Pdk2 PE=1 SV=2 74 459 3.0E-31
sp|Q15118|PDK1_HUMAN [Pyruvate dehydrogenase (acetyl-transferring)] kinase isozyme 1, mitochondrial OS=Homo sapiens GN=PDK1 PE=1 SV=1 81 459 5.0E-29
sp|Q63065|PDK1_RAT [Pyruvate dehydrogenase (acetyl-transferring)] kinase isozyme 1, mitochondrial OS=Rattus norvegicus GN=Pdk1 PE=1 SV=1 81 459 2.0E-28
sp|Q8BFP9|PDK1_MOUSE [Pyruvate dehydrogenase (acetyl-transferring)] kinase isozyme 1, mitochondrial OS=Mus musculus GN=Pdk1 PE=1 SV=2 81 459 1.0E-27
sp|P53170|PDK2_YEAST [Pyruvate dehydrogenase (acetyl-transferring)] kinase 2, mitochondrial OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=PKP2 PE=1 SV=3 74 454 8.0E-26
sp|P91622|PDK_DROME [Pyruvate dehydrogenase (acetyl-transferring)] kinase, mitochondrial OS=Drosophila melanogaster GN=Pdk PE=2 SV=2 74 457 1.0E-25
sp|Q15120|PDK3_HUMAN [Pyruvate dehydrogenase (acetyl-transferring)] kinase isozyme 3, mitochondrial OS=Homo sapiens GN=PDK3 PE=1 SV=1 74 459 2.0E-24
sp|Q922H2|PDK3_MOUSE [Pyruvate dehydrogenase (acetyl-transferring)] kinase isozyme 3, mitochondrial OS=Mus musculus GN=Pdk3 PE=1 SV=1 74 459 5.0E-24
sp|O02623|PDK_ASCSU [Pyruvate dehydrogenase (acetyl-transferring)] kinase, mitochondrial OS=Ascaris suum PE=2 SV=1 64 457 6.0E-23
sp|Q02332|PDHK2_CAEEL Probable [pyruvate dehydrogenase (acetyl-transferring)] kinase, mitochondrial OS=Caenorhabditis elegans GN=pdhk-2 PE=3 SV=1 63 457 2.0E-20
[Show less]

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 20 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >OphauB2|7318
MRGVSRGLSTASLLRWSHCRHRSSSSSPSPPPCSSSSSPSPPPSSASSPPSPSASSTVSDAQLASLASKHQHHLT
LADLVRYGRPPLSQSSLLASANFALSLLPIRLARRIQALRNLPYIVVSNANISRIYDNYLHSLSILLPYCRAAAT
HRRPAIASLDDEVAFTEVLAELVATHTDTIPVLAKGFLECRRYIAAPQVTQFLDHHLRARIGTRLIAEQHIALHY
SSQPLDTASGASHVKPDPCYVGVIDSALRPAATIDSCAGFVADICELRYGSRPRLLVDGEPDATFAFVPMHLEYI
VTELLKNAFRATLESRSNEPIVVTIAPERPLNHHHLRLLPDALSTSSGSLQDNAPGVTIRIRDRGGGIPPDILPH
IWSYSFTTFTQDDSLSFPSASASASIDGLGVISSAGAGGSSIAGLGYGLPLSRAYAEYFGGGITVQTLYGWGTDV
YLRLKGVGTIAA*
Coding >OphauB2|7318
ATGAGAGGCGTGTCCCGCGGCTTGTCGACAGCCAGCCTGCTGCGCTGGTCGCACTGCCGCCACCGCTCCTCCTCT
TCCTCGCCCTCACCACCCCCATGCTCATCTTCATCCTCGCCTTCACCACCCCCATCCTCAGCTTCATCCCCGCCT
TCACCATCTGCAAGCTCAACCGTCTCAGACGCTCAACTCGCCTCCCTTGCCAGCAAACACCAACACCACCTCACT
CTAGCCGATTTAGTCCGCTACGGCCGCCCTCCCCTCTCGCAATCCTCCCTCCTCGCCTCTGCCAACTTTGCCCTC
TCGCTTCTCCCCATTCGTCTGGCCCGCCGCATCCAAGCCCTGCGCAACCTGCCCTACATCGTCGTGTCCAATGCA
AACATTTCCCGCATCTACGACAATTACCTCCACTCCCTCTCCATCCTCCTACCCTACTGCCGCGCCGCCGCCACG
CACCGCCGCCCAGCCATTGCCTCGCTCGACGACGAGGTGGCCTTTACCGAGGTGCTGGCCGAGCTGGTGGCTACC
CACACAGACACCATTCCCGTCTTGGCAAAGGGCTTTCTCGAATGCCGCCGCTACATTGCCGCTCCCCAAGTCACC
CAGTTTCTCGACCATCATCTTCGCGCCCGCATCGGCACCCGCCTCATTGCTGAGCAGCACATTGCCTTGCACTAT
AGCAGCCAGCCCCTCGACACGGCCTCCGGCGCCTCGCACGTAAAACCCGACCCTTGCTACGTGGGCGTCATTGAC
TCGGCTCTGCGGCCCGCCGCCACTATTGACTCGTGCGCCGGCTTCGTTGCTGATATTTGCGAGCTGCGCTACGGC
TCGCGCCCCCGGCTTCTTGTCGACGGCGAGCCCGACGCCACCTTTGCCTTTGTTCCCATGCACCTCGAGTACATT
GTCACGGAGCTGCTCAAGAATGCCTTTCGCGCTACCCTCGAAAGCCGCTCCAACGAACCCATTGTCGTCACCATT
GCGCCAGAACGCCCGCTCAATCACCATCACCTCCGCCTGCTGCCCGACGCCCTCTCCACCTCGTCTGGCTCCTTG
CAAGACAATGCTCCCGGCGTCACCATTCGCATTCGTGACCGTGGCGGCGGAATCCCTCCCGACATTCTCCCCCAT
ATTTGGTCCTACTCCTTCACCACCTTTACGCAAGACGACAGCCTCTCCTTCCCAAGCGCCTCGGCATCTGCTTCC
ATTGACGGCCTGGGCGTAATCAGCTCTGCTGGAGCTGGTGGAAGCTCCATTGCCGGCCTGGGCTATGGCCTGCCC
CTCAGCCGAGCATATGCCGAATACTTTGGCGGTGGCATTACCGTCCAAACCCTCTATGGCTGGGGGACCGACGTC
TATCTTAGGCTCAAGGGCGTTGGCACCATTGCCGCATAG
Transcript >OphauB2|7318
ATGAGAGGCGTGTCCCGCGGCTTGTCGACAGCCAGCCTGCTGCGCTGGTCGCACTGCCGCCACCGCTCCTCCTCT
TCCTCGCCCTCACCACCCCCATGCTCATCTTCATCCTCGCCTTCACCACCCCCATCCTCAGCTTCATCCCCGCCT
TCACCATCTGCAAGCTCAACCGTCTCAGACGCTCAACTCGCCTCCCTTGCCAGCAAACACCAACACCACCTCACT
CTAGCCGATTTAGTCCGCTACGGCCGCCCTCCCCTCTCGCAATCCTCCCTCCTCGCCTCTGCCAACTTTGCCCTC
TCGCTTCTCCCCATTCGTCTGGCCCGCCGCATCCAAGCCCTGCGCAACCTGCCCTACATCGTCGTGTCCAATGCA
AACATTTCCCGCATCTACGACAATTACCTCCACTCCCTCTCCATCCTCCTACCCTACTGCCGCGCCGCCGCCACG
CACCGCCGCCCAGCCATTGCCTCGCTCGACGACGAGGTGGCCTTTACCGAGGTGCTGGCCGAGCTGGTGGCTACC
CACACAGACACCATTCCCGTCTTGGCAAAGGGCTTTCTCGAATGCCGCCGCTACATTGCCGCTCCCCAAGTCACC
CAGTTTCTCGACCATCATCTTCGCGCCCGCATCGGCACCCGCCTCATTGCTGAGCAGCACATTGCCTTGCACTAT
AGCAGCCAGCCCCTCGACACGGCCTCCGGCGCCTCGCACGTAAAACCCGACCCTTGCTACGTGGGCGTCATTGAC
TCGGCTCTGCGGCCCGCCGCCACTATTGACTCGTGCGCCGGCTTCGTTGCTGATATTTGCGAGCTGCGCTACGGC
TCGCGCCCCCGGCTTCTTGTCGACGGCGAGCCCGACGCCACCTTTGCCTTTGTTCCCATGCACCTCGAGTACATT
GTCACGGAGCTGCTCAAGAATGCCTTTCGCGCTACCCTCGAAAGCCGCTCCAACGAACCCATTGTCGTCACCATT
GCGCCAGAACGCCCGCTCAATCACCATCACCTCCGCCTGCTGCCCGACGCCCTCTCCACCTCGTCTGGCTCCTTG
CAAGACAATGCTCCCGGCGTCACCATTCGCATTCGTGACCGTGGCGGCGGAATCCCTCCCGACATTCTCCCCCAT
ATTTGGTCCTACTCCTTCACCACCTTTACGCAAGACGACAGCCTCTCCTTCCCAAGCGCCTCGGCATCTGCTTCC
ATTGACGGCCTGGGCGTAATCAGCTCTGCTGGAGCTGGTGGAAGCTCCATTGCCGGCCTGGGCTATGGCCTGCCC
CTCAGCCGAGCATATGCCGAATACTTTGGCGGTGGCATTACCGTCCAAACCCTCTATGGCTGGGGGACCGACGTC
TATCTTAGGCTCAAGGGCGTTGGCACCATTGCCGCATAG
Gene >OphauB2|7318
ATGAGAGGCGTGTCCCGCGGCTTGTCGACAGCCAGCCTGCTGCGCTGGTCGCACTGCCGCCACCGCTCCTCCTCT
TCCTCGCCCTCACCACCCCCATGCTCATCTTCATCCTCGCCTTCACCACCCCCATCCTCAGCTTCATCCCCGCCT
TCACCATCTGCAAGCTCAACCGTCTCAGACGCTCAACTCGCCTCCCTTGCCAGCAAACACCAACACCACCTCACT
CTAGCCGATTTAGTCCGGTATCAAAACCACACCCCATCCCCCCCTCCCCACGCAACAAACATTACTGACTCCCTC
TCTCCCTTGTCCCAGCTACGGCCGCCCTCCCCTCTCGCAATCCTCCCTCCTCGCCTCTGCCAACTTTGCCCTCTC
GCTTCTCCCCATTCGTCTGGCCCGCCGCATCCAAGCCCTGCGCAACCTGCCCTACATCGTCGTGTCCAATGCAAA
CATTTCCCGCATCTACGACAATTACCTCCACTCCCTCTCCATCCTCCTACCCTACTGCCGCGCCGCCGCCACGCA
CCGCCGCCCAGCCATTGCCTCGCTCGACGACGAGGTGGCCTTTACCGAGGTGCTGGCCGAGCTGGTGGCTACCCA
CACAGACACCATTCCCGTCTTGGCAAAGGGCTTTCTCGAATGCCGCCGCTACATTGCCGCTCCCCAAGTCACCCA
GTTTCTCGACCATCATCTTCGCGCCCGCATCGGCACCCGCCTCATTGCTGAGCAGCACATTGCCTTGCACTATAG
CAGCCAGCCCCTCGACACGGCCTCCGGCGCCTCGCACGTAAAACCCGACCCTTGCTACGTGGGCGTCATTGACTC
GGCTCTGCGGCCCGCCGCCACTATTGACTCGTGCGCCGGCTTCGTTGCTGATATTTGCGAGCTGCGCTACGGCTC
GCGCCCCCGGCTTCTTGTCGACGGCGAGCCCGACGCCACCTTTGCCTTTGTTCCCATGCACCTCGAGTACATTGT
CACGGAGCTGCTCAAGAATGCCTTTCGCGCTACCCTCGAAAGCCGCTCCAACGAACCCATTGTCGTCACCATTGC
GCCAGAACGCCCGCTCAATCACCATCACCTCCGCCTGCTGCCCGACGCCCTCTCCACCTCGTCTGGCTCCTTGCA
AGACAATGCTCCCGGCGTCACCATTCGCATTCGTGACCGTGGCGGCGGAATCCCTCCCGACATTCTCCCCCATAT
TTGGTCCTACTCCTTCACCACCTTTACGCAAGACGACAGCCTCTCCTTCCCAAGCGCCTCGGCATCTGCTTCCAT
TGACGGCCTGGGCGTAATCAGCTCTGCTGGAGCTGGTGGAAGCTCCATTGCCGGCCTGGGCTATGGCCTGCCCCT
CAGCCGAGCATATGCCGAATACTTTGGCGGTGGCATTACCGTCCAAACCCTCTATGGCTGGGGGACCGACGTCTA
TCTTAGGCTCAAGGGCGTTGGCACCATTGCCGCATAG

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail