Fungal Genomics

at Utrecht University

General Properties

Protein IDOphauB2|7315
Gene name
LocationContig_77:53308..56773
Strand+
Gene length (bp)3465
Transcript length (bp)2931
Coding sequence length (bp)2931
Protein length (aa) 977

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF11707 Npa1 Ribosome 60S biogenesis N-terminal 1.3E-90 101 434
PF16201 NopRA1 Nucleolar pre-ribosomal-associated protein 1 1.1E-27 783 913

Swissprot hits

Swissprot ID Swissprot Description Start End E-value
sp|O74415|YJL2_SCHPO Uncharacterized protein C14G10.02 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPCC14G10.02 PE=4 SV=1 156 608 2.0E-23
sp|P34241|URB1_YEAST Nucleolar pre-ribosomal-associated protein 1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=URB1 PE=1 SV=2 103 525 3.0E-22

GO

(None)

Deeploc

Deeploc data not available for this genome

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

No expression data available for this genome

Orthologs

Orthofinder run ID4
Orthogroup1143
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|6771
Ophiocordyceps australis map64 (Brazil) OphauB2|7315 (this protein)
Ophiocordyceps camponoti-floridani Ophcf2|04234
Ophiocordyceps camponoti-rufipedis Ophun1|1503
Ophiocordyceps kimflemingae Ophio5|2398
Ophiocordyceps subramaniannii Hirsu2|10211
Ophiocordyceps subramaniannii Hirsu2|10212

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >OphauB2|7315
MPKHWLGGADGSAPLQHKRRKVVHEAPTSEQVVSCHQLRRLLAFDQDVRRARHGLQSFKLLLDSIAAASEEESSQ
QVAILQQYLEANEPSSAQDDNGVALPDIMETWVFAAQIDDEALMSAVAVVLALVLRIASTSLRLVPHGLAICQAL
MQQRQLKCVAKNLSASKGKAFVISPTLRLLREVVSLDGGAYAKRVLGARDYTLVSLARNLELDHVSDGPQDGSRV
SVRTNALLFVLSCFKFLHAQGRNEVLLQKDVVSHVTFMLKTDPPQLVIDVLHTLKTCVLMDSRIPRASKFKYFNT
KTLARVLALYAYTSPKHTAEQVEAVREKAHEFLVYACTAPVAGILCPCKGLYPKAPADDDEGAGQGQEDLRGGIS
IYNFALSEFARKLRPWASLPHNRLLVAMFAAAPELVADYFFHNGSFGFEPKLSMTWVGYAAFLFDTMSLELPEAF
GDGTRFCRAPPPSSILLDNILPPPLTHKVLVRCYTLSSQLTSLFATRILIVAVEKLAKACQMHQDGSSRRSSNVV
KIIVGCYKSIPAESPLHRVLLSRLLRLYYELIVRVDEAQPANPDAAAWNVLELENIVVVASLSLAMKWFSRLDSL
SLSPFVALLRLLCRAGEKVPQRQMLHELTVCLCICRCAAAPKKYLDQMHALAAQHGLPLACLVSLLFNACHAEHQ
DHSSLLALLHARIVHALPAITPLGHTPDLQALSTCPSPSLPDETNPSQHTTPTPTEPDDVFLSRLLAVQAPNYTD
TSPLTKCPSRSIHDVHIRMEALVTLDKLALRHIIAFACLALKVVISPTHALYPKVNAFLVRSPSWALHKMPLAHH
VLHLRPSRDGAHFAEVAHLLHLLLLGVRELADVLFLLRSRWLEKVLLLDCSVYLPADSRRRVLEIVYRAAAIPGG
AAALVSRASILGWLAAARQDDVQEVRIRRALAAYIVAMCGEDFVEAWRRGDSSSYSHALTTTPSVSSHEQDKSLP
N*
Coding >OphauB2|7315
ATGCCAAAACATTGGCTGGGCGGCGCAGACGGCAGCGCACCGCTGCAGCACAAGCGGCGCAAAGTGGTTCACGAA
GCGCCGACTAGCGAGCAAGTCGTGTCTTGCCACCAGCTGCGCAGACTGCTTGCCTTTGACCAAGACGTGCGCCGC
GCTCGCCATGGGCTTCAATCATTCAAGCTGCTTCTTGACAGCATCGCCGCAGCGAGTGAAGAAGAGAGCAGCCAA
CAAGTAGCCATTCTCCAACAGTACCTTGAAGCAAATGAGCCGTCGAGCGCCCAAGACGACAATGGCGTGGCCCTG
CCCGACATTATGGAGACGTGGGTGTTTGCGGCGCAGATTGATGACGAGGCGCTCATGTCTGCGGTTGCCGTCGTC
TTGGCTCTAGTCTTGCGCATTGCTTCGACGTCGCTGCGACTGGTGCCGCACGGGCTGGCCATTTGCCAAGCGCTG
ATGCAGCAACGGCAGCTCAAGTGCGTGGCCAAGAACTTGTCGGCCAGCAAGGGAAAAGCCTTTGTCATCTCGCCT
ACCCTGCGGCTGCTGAGGGAGGTTGTCAGTCTAGACGGCGGCGCCTACGCCAAGAGGGTCTTGGGCGCCAGGGAC
TATACGCTGGTGTCGCTGGCCCGGAACCTGGAGCTGGACCATGTATCCGACGGCCCGCAAGACGGGTCGAGAGTG
TCTGTGCGGACAAATGCCCTTTTATTTGTGCTGAGCTGCTTCAAGTTTCTGCATGCGCAGGGCCGCAACGAGGTG
TTGCTGCAAAAGGATGTGGTGTCGCACGTCACTTTTATGCTCAAGACGGATCCCCCGCAGCTCGTTATTGATGTT
TTGCATACGCTCAAGACTTGCGTGCTCATGGACAGCAGGATTCCGCGGGCCAGCAAGTTTAAATACTTCAACACC
AAGACGCTGGCTCGCGTGCTGGCTCTCTACGCATACACTAGCCCCAAGCATACAGCAGAGCAGGTAGAAGCAGTA
AGGGAAAAGGCGCACGAGTTTCTCGTCTATGCGTGCACGGCGCCTGTTGCTGGCATCCTGTGTCCCTGCAAGGGC
TTGTATCCCAAGGCGCCGGCCGACGACGACGAGGGCGCAGGGCAGGGCCAGGAGGATTTGCGAGGGGGCATTTCC
ATTTACAACTTTGCCCTGTCCGAGTTTGCGCGCAAGCTTCGGCCGTGGGCGAGCCTGCCGCATAACCGGCTGCTG
GTGGCCATGTTTGCCGCGGCGCCGGAGCTGGTGGCGGACTACTTTTTCCATAATGGCTCGTTTGGCTTTGAGCCC
AAGCTGTCCATGACGTGGGTTGGCTATGCGGCATTTCTCTTTGACACCATGAGTCTTGAGCTGCCCGAGGCGTTT
GGCGATGGGACTCGCTTTTGCAGGGCGCCGCCGCCAAGCTCCATACTGCTGGATAACATCCTGCCGCCGCCGCTT
ACCCACAAGGTGCTGGTGCGCTGCTATACGCTGTCGTCGCAGCTGACGTCGCTCTTTGCCACGAGGATTCTCATT
GTTGCGGTGGAAAAACTTGCCAAGGCTTGCCAGATGCACCAAGACGGGTCGTCACGGCGCAGCAGCAACGTCGTC
AAGATTATTGTCGGCTGCTACAAGAGCATTCCGGCAGAGAGCCCGCTGCACCGAGTCTTGCTGAGCCGGCTGCTG
CGGCTGTATTACGAGCTCATTGTACGGGTGGACGAGGCACAGCCTGCGAATCCCGACGCGGCGGCGTGGAATGTG
CTGGAGCTGGAGAATATCGTTGTTGTGGCGAGCCTCTCGCTGGCCATGAAGTGGTTCTCGCGGCTAGACAGCCTC
TCCTTGTCGCCATTTGTTGCGCTGCTGCGTCTGCTTTGCCGCGCCGGGGAAAAGGTGCCGCAGCGCCAGATGCTG
CACGAGCTGACGGTCTGCCTCTGCATTTGTCGATGTGCCGCCGCGCCCAAAAAGTATCTCGACCAGATGCATGCC
CTTGCCGCACAGCACGGCCTGCCGCTGGCGTGCCTCGTCTCGCTCCTCTTCAATGCCTGCCATGCCGAGCATCAA
GACCACTCCTCCCTCTTGGCCCTTTTGCACGCCCGCATCGTGCACGCCTTGCCCGCCATTACTCCCCTCGGCCAC
ACCCCCGACTTGCAAGCTCTATCAACCTGCCCCTCTCCCTCCCTCCCCGACGAAACAAACCCAAGCCAACACACC
ACACCCACCCCCACCGAACCCGACGACGTATTCCTCTCCCGCCTCCTTGCCGTGCAAGCCCCCAACTATACCGAC
ACGTCGCCTCTCACCAAATGCCCCTCGAGATCCATCCACGACGTACATATCCGCATGGAAGCCCTCGTCACGCTC
GATAAACTCGCTCTCCGGCACATTATTGCTTTTGCCTGTCTGGCGCTCAAAGTGGTCATCTCGCCCACCCATGCC
CTCTATCCCAAGGTTAATGCCTTTCTTGTCCGCAGCCCCTCTTGGGCCCTGCACAAGATGCCCCTTGCCCACCAT
GTTTTACATCTCCGCCCCTCGCGAGACGGCGCGCATTTTGCAGAAGTGGCGCATCTGTTGCATCTCTTGCTACTA
GGTGTGCGCGAACTTGCAGATGTCTTGTTTTTGCTGCGCTCCCGCTGGTTGGAAAAGGTGCTGCTGCTCGACTGT
AGCGTCTACTTGCCCGCAGACTCTAGGCGCCGCGTCCTGGAAATTGTTTATCGCGCTGCCGCTATTCCGGGCGGT
GCCGCGGCGCTCGTCTCGCGTGCTAGTATTTTGGGCTGGTTGGCGGCGGCGCGGCAAGACGACGTGCAAGAGGTG
CGCATACGTCGCGCCCTGGCCGCTTACATTGTTGCCATGTGCGGCGAGGATTTTGTCGAGGCGTGGCGCCGCGGT
GACTCGTCGTCGTATAGCCACGCCTTGACCACTACGCCCAGCGTCTCTAGCCATGAGCAAGACAAATCACTACCA
AATTAG
Transcript >OphauB2|7315
ATGCCAAAACATTGGCTGGGCGGCGCAGACGGCAGCGCACCGCTGCAGCACAAGCGGCGCAAAGTGGTTCACGAA
GCGCCGACTAGCGAGCAAGTCGTGTCTTGCCACCAGCTGCGCAGACTGCTTGCCTTTGACCAAGACGTGCGCCGC
GCTCGCCATGGGCTTCAATCATTCAAGCTGCTTCTTGACAGCATCGCCGCAGCGAGTGAAGAAGAGAGCAGCCAA
CAAGTAGCCATTCTCCAACAGTACCTTGAAGCAAATGAGCCGTCGAGCGCCCAAGACGACAATGGCGTGGCCCTG
CCCGACATTATGGAGACGTGGGTGTTTGCGGCGCAGATTGATGACGAGGCGCTCATGTCTGCGGTTGCCGTCGTC
TTGGCTCTAGTCTTGCGCATTGCTTCGACGTCGCTGCGACTGGTGCCGCACGGGCTGGCCATTTGCCAAGCGCTG
ATGCAGCAACGGCAGCTCAAGTGCGTGGCCAAGAACTTGTCGGCCAGCAAGGGAAAAGCCTTTGTCATCTCGCCT
ACCCTGCGGCTGCTGAGGGAGGTTGTCAGTCTAGACGGCGGCGCCTACGCCAAGAGGGTCTTGGGCGCCAGGGAC
TATACGCTGGTGTCGCTGGCCCGGAACCTGGAGCTGGACCATGTATCCGACGGCCCGCAAGACGGGTCGAGAGTG
TCTGTGCGGACAAATGCCCTTTTATTTGTGCTGAGCTGCTTCAAGTTTCTGCATGCGCAGGGCCGCAACGAGGTG
TTGCTGCAAAAGGATGTGGTGTCGCACGTCACTTTTATGCTCAAGACGGATCCCCCGCAGCTCGTTATTGATGTT
TTGCATACGCTCAAGACTTGCGTGCTCATGGACAGCAGGATTCCGCGGGCCAGCAAGTTTAAATACTTCAACACC
AAGACGCTGGCTCGCGTGCTGGCTCTCTACGCATACACTAGCCCCAAGCATACAGCAGAGCAGGTAGAAGCAGTA
AGGGAAAAGGCGCACGAGTTTCTCGTCTATGCGTGCACGGCGCCTGTTGCTGGCATCCTGTGTCCCTGCAAGGGC
TTGTATCCCAAGGCGCCGGCCGACGACGACGAGGGCGCAGGGCAGGGCCAGGAGGATTTGCGAGGGGGCATTTCC
ATTTACAACTTTGCCCTGTCCGAGTTTGCGCGCAAGCTTCGGCCGTGGGCGAGCCTGCCGCATAACCGGCTGCTG
GTGGCCATGTTTGCCGCGGCGCCGGAGCTGGTGGCGGACTACTTTTTCCATAATGGCTCGTTTGGCTTTGAGCCC
AAGCTGTCCATGACGTGGGTTGGCTATGCGGCATTTCTCTTTGACACCATGAGTCTTGAGCTGCCCGAGGCGTTT
GGCGATGGGACTCGCTTTTGCAGGGCGCCGCCGCCAAGCTCCATACTGCTGGATAACATCCTGCCGCCGCCGCTT
ACCCACAAGGTGCTGGTGCGCTGCTATACGCTGTCGTCGCAGCTGACGTCGCTCTTTGCCACGAGGATTCTCATT
GTTGCGGTGGAAAAACTTGCCAAGGCTTGCCAGATGCACCAAGACGGGTCGTCACGGCGCAGCAGCAACGTCGTC
AAGATTATTGTCGGCTGCTACAAGAGCATTCCGGCAGAGAGCCCGCTGCACCGAGTCTTGCTGAGCCGGCTGCTG
CGGCTGTATTACGAGCTCATTGTACGGGTGGACGAGGCACAGCCTGCGAATCCCGACGCGGCGGCGTGGAATGTG
CTGGAGCTGGAGAATATCGTTGTTGTGGCGAGCCTCTCGCTGGCCATGAAGTGGTTCTCGCGGCTAGACAGCCTC
TCCTTGTCGCCATTTGTTGCGCTGCTGCGTCTGCTTTGCCGCGCCGGGGAAAAGGTGCCGCAGCGCCAGATGCTG
CACGAGCTGACGGTCTGCCTCTGCATTTGTCGATGTGCCGCCGCGCCCAAAAAGTATCTCGACCAGATGCATGCC
CTTGCCGCACAGCACGGCCTGCCGCTGGCGTGCCTCGTCTCGCTCCTCTTCAATGCCTGCCATGCCGAGCATCAA
GACCACTCCTCCCTCTTGGCCCTTTTGCACGCCCGCATCGTGCACGCCTTGCCCGCCATTACTCCCCTCGGCCAC
ACCCCCGACTTGCAAGCTCTATCAACCTGCCCCTCTCCCTCCCTCCCCGACGAAACAAACCCAAGCCAACACACC
ACACCCACCCCCACCGAACCCGACGACGTATTCCTCTCCCGCCTCCTTGCCGTGCAAGCCCCCAACTATACCGAC
ACGTCGCCTCTCACCAAATGCCCCTCGAGATCCATCCACGACGTACATATCCGCATGGAAGCCCTCGTCACGCTC
GATAAACTCGCTCTCCGGCACATTATTGCTTTTGCCTGTCTGGCGCTCAAAGTGGTCATCTCGCCCACCCATGCC
CTCTATCCCAAGGTTAATGCCTTTCTTGTCCGCAGCCCCTCTTGGGCCCTGCACAAGATGCCCCTTGCCCACCAT
GTTTTACATCTCCGCCCCTCGCGAGACGGCGCGCATTTTGCAGAAGTGGCGCATCTGTTGCATCTCTTGCTACTA
GGTGTGCGCGAACTTGCAGATGTCTTGTTTTTGCTGCGCTCCCGCTGGTTGGAAAAGGTGCTGCTGCTCGACTGT
AGCGTCTACTTGCCCGCAGACTCTAGGCGCCGCGTCCTGGAAATTGTTTATCGCGCTGCCGCTATTCCGGGCGGT
GCCGCGGCGCTCGTCTCGCGTGCTAGTATTTTGGGCTGGTTGGCGGCGGCGCGGCAAGACGACGTGCAAGAGGTG
CGCATACGTCGCGCCCTGGCCGCTTACATTGTTGCCATGTGCGGCGAGGATTTTGTCGAGGCGTGGCGCCGCGGT
GACTCGTCGTCGTATAGCCACGCCTTGACCACTACGCCCAGCGTCTCTAGCCATGAGCAAGACAAATCACTACCA
AATTAG
Gene >OphauB2|7315
ATGCCAAAACATTGGCTGGGCGGCGCAGACGGCAGCGCACCGCTGCAGCACAAGCGGCGCAAAGTGGTTCACGAA
GCGCCGACTAGCGAGCAAGTCGTGTCTTGCCACCAGCTGCGCAGACTGCTTGCCTTTGACCAAGACGTGCGCCGC
GCTCGCCATGGCAAGTTTTCTTTTTTTTTTTGAGAGAGAGATAGAGAGAGAGAGGGGCTAACACCTTTTTTTTTC
GCAGGGCTTCAATCATTCAAGCTGCTTCTTGACAGCATCGCCGCAGCGAGTGAAGAAGAGAGCAGCCAACAAGTA
GCCATTCTCCAACAGTACCTTGAAGCAAATGAGCCGTCGAGCGCCCAAGACGACAATGGCGTGGCCCTGCCCGAC
ATTATGGAGACGTGGGTGTTTGCGGCGCAGATTGATGACGAGGCGCTCATGTCTGCGGTTGCCGTCGTCTTGGCT
CTAGTCTTGCGCATTGCTTCGACGTCGCTGCGACTGGTGCCGCACGGGCTGGCCATTTGCCAAGCGCTGATGCAG
CAACGGCAGCTCAAGTGCGTGGCCAAGAACTTGTCGGCCAGCAAGGGAAAAGCCTTTGTCATCTCGCCTACCCTG
CGGCTGCTGAGGGAGGTTGTCAGTCTAGACGGCGGCGCCTACGCCAAGAGGGTCTTGGGCGCCAGGGACTATACG
CTGGTGTCGCTGGCCCGGAACCTGGAGCTGGACCATGTATCCGACGGCCCGCAAGACGGGTCGAGAGTGTCTGTG
CGGACAAATGCCCTTTTATTTGTGCTGAGCTGCTTCAAGTTTCTGCATGCGCAGGGCCGCAACGAGGTGTTGCTG
CAAAAGGATGTGGTGTCGCACGTCACTTTTATGCTCAAGACGGATCCCCCGCAGCTCGTTATTGATGTTTTGCAT
ACGCTCAAGACTTGCGTGCTCATGGACAGCAGGATTCCGCGGGCCAGCAAGTTTAAATACTTCAACACCAAGACG
CTGGCTCGCGTGCTGGCTCTCTACGCATACACTAGCCCCAAGCATACAGCAGAGCAGGTAGAAGCAGTAAGGGAA
AAGGCGCACGAGTTTCTCGTCTATGCGTGCACGGCGCCTGTTGCTGGCATCCTGTGTCCCTGCAAGGGCTTGTAT
CCCAAGGCGCCGGCCGACGACGACGAGGGCGCAGGGCAGGGCCAGGAGGATTTGCGAGGGGGCATTTCCATTTAC
AACTTTGCCCTGTCCGAGTTTGCGCGCAAGCTTCGGCCGTGGGCGAGCCTGCCGCATAACCGGCTGCTGGTGGCC
ATGTTTGCCGCGGCGCCGGAGCTGGTGGCGGACTACTTTTTCCATAATGGCTCGTTTGGCTTTGAGCCCAAGCTG
TCCATGACGTGGGTTGGCTATGCGGCATTTCTCTTTGACACCATGAGTCTTGAGCTGCCCGAGGCGTTTGGCGAT
GGGACTCGCTTTTGCAGGGCGCCGCCGCCAAGCTCCATACTGCTGGATAACATCCTGCCGCCGCCGCTTACCCAC
AAGGTGCTGGTGCGCTGCTATACGCTGTCGTCGCAGCTGACGTCGCTCTTTGCCACGAGGATTCTCATTGTTGCG
GTGGAAAAACTTGCCAAGGCTTGCCAGATGCACCAAGACGGGTCGTCACGGCGCAGCAGCAACGTGTGGGTGCAG
GCCAAGCGGCGCCTGCTCGATGCCTTTTGCCAGCGCGTGCCCAGCGTCAAGATTATTGTCGGCTGCTACAAGAGC
ATTCCGGCAGAGAGCCCGCTGCACCGAGTCTTGCTGAGCCGGCTGCTGCGGCTGTATTACGAGGTGCTTCCTCGC
ACAACGCCAGCTGCCAAGCTCAATGCGGCGCCGCTCTTGGCCCAGCTCATTGTACGGGTGGACGAGGCACAGCCT
GCGAATCCCGACGCGGCGGCGTGGAATGTGCTGGAGCTGGAGAATATCGTTGTTGTGGCGAGCCTCTCGCTGGCC
ATGAAGTGGTTCTCGCGGCTAGACAGCCTCTCCTTGTCGCCATTTGTTGCGCTGCTGCGTCTGCTTTGCCGCGCC
GGGGAAAAGGTGCCGCAGCGCCAGATGCTGCACGAGCTGACGGTCGTGGGCGTGGAGAGCATGCTCTTTTCCTCG
GCCGCTGGTCTGCAGTGCCTCGTCCGCGCCGCACAGTGCGCAGCTGCCCGTCTCGACGACGAGGAGCAAGCGGCG
CGCATGTGGCTCTTTTTGGACCAGTGCATTTGTCGATGTGCCGCCGCGCCCAAAAAGTATCTCGACCAGATGCAT
GCCCTTGCCGCACAGCACGGCCTGCCGCGTGCCCGAGACGCGCCGTGGCTGCTCCTTGTCGTGGTGGCGGAGCAG
CTCGCCTTTGTCGCTGACGATGCGGCAGTGGCGTGCCTCGTCTCGCTCCTCTTCAATGCCTGCCATGCCGAGCAT
CAAGACCACTCCTCCCTCTTGGCCCTTTTGCACGCCCGCATCGTGCACGCCTTGCCCGCCATTACTCCCCTCGGC
CACACCCCCGACTTGCAAGCTCTATCAACCTGCCCCTCTCCCTCCCTCCCCGACGAAACAAACCCAAGCCAACAC
ACCACACCCACCCCCACCGAACCCGACGACGTATTCCTCTCCCGCCTCCTTGCCGTGCAAGCCCCCAACTATACC
GACACGTCGCCTCTCACCAAATGCCCCTCGAGATCCATCCACGACGTGTTGGAAGACGGCCTCGTCGCCCAGCTC
CTTCGCCTCTTGGCCTCCCCCCACAGACATATCCGCATGGAAGCCCTCGTCACGCTCGATAAACTCGCTCTCCGT
ATCCGCGCCTCCTCACACGATGCAAAAGAACAACTCGCCCTCCTCGTCGCACAAGTCGTCGAATCTGCTAGACCG
AGTATTCATGCCGAGCCCCTTCCAGGGCACATTATTGCTTTTGCCTGTCTGGCGCTCAAAGTGGTCATCTCGCCC
ACCCATGCCCTCTATCCCAAGGTTAATGCCTTTCTTGTCCGCAGCCCCTCTTGGGCCCTGCACAAGATGCCCCTT
GCCCACCATGTTTTACATCTCCGCCCCTCGCGAGACGGCGCGCATTTTGCAGAAGTGGCGCATCTGTTGCATCTC
TTGCTACTAGGTGTGCGCGAACTTGCAGATGTCTTGTTTTTGCTGCGCTCCCGCTGGTTGGAAAAGGTGCTGCTG
CTCGACTGTAGCGTCTACTTGCCCGCAGACTCTAGGCGCCGCGTCCTGGAAATTGTTTATCGCGCTGCCGCTATT
CCGGGCGGTGCCGCGGCGCTCGTCTCGCGTGCTAGTATTTTGGGCTGGTTGGCGGCGGCGCGGCAAGACGACGTG
CAAGAGGTGCGCATACGTCGCGCCCTGGCCGCTTACATTGTTGCCATGTGCGGCGAGGATTTTGTCGAGGCGTGG
CGCCGCGGTGACTCGTCGTCGTATAGCCACGCCTTGACCACTACGCCCAGCGTCTCTAGCCATGAGCAAGACAAA
TCACTACCAAATTAG

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail