Fungal Genomics

at Utrecht University

General Properties

Protein IDOphauB2|7310
Gene name
LocationContig_77:38493..40001
Strand+
Gene length (bp)1508
Transcript length (bp)1311
Coding sequence length (bp)1311
Protein length (aa) 437

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF05383 La La domain 7.7E-19 123 180
PF00076 RRM_1 RNA recognition motif. (a.k.a. RRM, RBD, or RNP domain) 1.9E-08 228 286

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|P87058|LAH1_SCHPO La protein homolog OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=sla1 PE=1 SV=1 116 301 8.0E-37
sp|P33399|LHP1_YEAST La protein homolog OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=LHP1 PE=1 SV=2 125 294 5.0E-23
sp|P05455|LA_HUMAN Lupus La protein OS=Homo sapiens GN=SSB PE=1 SV=2 123 307 2.0E-18
sp|P10881|LA_BOVIN Lupus La protein homolog OS=Bos taurus GN=SSB PE=2 SV=2 123 300 2.0E-17
sp|P32067|LA_MOUSE Lupus La protein homolog OS=Mus musculus GN=Ssb PE=1 SV=1 115 307 4.0E-17
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|P87058|LAH1_SCHPO La protein homolog OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=sla1 PE=1 SV=1 116 301 8.0E-37
sp|P33399|LHP1_YEAST La protein homolog OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=LHP1 PE=1 SV=2 125 294 5.0E-23
sp|P05455|LA_HUMAN Lupus La protein OS=Homo sapiens GN=SSB PE=1 SV=2 123 307 2.0E-18
sp|P10881|LA_BOVIN Lupus La protein homolog OS=Bos taurus GN=SSB PE=2 SV=2 123 300 2.0E-17
sp|P32067|LA_MOUSE Lupus La protein homolog OS=Mus musculus GN=Ssb PE=1 SV=1 115 307 4.0E-17
sp|P38656|LA_RAT Lupus La protein homolog OS=Rattus norvegicus GN=Ssb PE=1 SV=1 122 307 5.0E-17
sp|P28048|LAA_XENLA Lupus La protein homolog A OS=Xenopus laevis GN=ssb-a PE=2 SV=1 118 300 2.0E-15
sp|Q26457|LA_AEDAL La protein homolog OS=Aedes albopictus PE=1 SV=1 125 297 2.0E-15
sp|P28049|LAB_XENLA Lupus La protein homolog B OS=Xenopus laevis GN=ssb-b PE=2 SV=1 123 300 3.0E-15
sp|P40796|LA_DROME La protein homolog OS=Drosophila melanogaster GN=La PE=1 SV=2 123 300 2.0E-14
sp|Q93ZV7|LA1_ARATH La protein 1 OS=Arabidopsis thaliana GN=LA1 PE=1 SV=1 123 298 7.0E-10
sp|Q94A38|LRP6A_ARATH La-related protein 6A OS=Arabidopsis thaliana GN=LARP6A PE=2 SV=1 121 247 3.0E-09
sp|Q7ZWE3|LARP7_DANRE La-related protein 7 OS=Danio rerio GN=larp7 PE=2 SV=1 115 279 2.0E-08
sp|Q05CL8|LARP7_MOUSE La-related protein 7 OS=Mus musculus GN=Larp7 PE=1 SV=2 122 279 1.0E-06
sp|Q5XI01|LARP7_RAT La-related protein 7 OS=Rattus norvegicus GN=Larp7 PE=1 SV=2 122 279 3.0E-06
[Show less]

GO

GO Term Description Terminal node
GO:0003723 RNA binding Yes
GO:0003674 molecular_function No
GO:0005488 binding No
GO:1901363 heterocyclic compound binding No
GO:0097159 organic cyclic compound binding No
GO:0003676 nucleic acid binding No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 69 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >OphauB2|7310
MTDSDATSKPTTAAEVQQVAEEKVDTSNNPEPTKATPETGPAEAETELQQEAAQHEDADSKPEEALATSNPTEED
GKAAPDSSAGQGNSKMLKTKAKVNRQDFRKNRKFDPSVRRITDDPEEIRKQVEFYFGDWNFPQDKFMWESCGGAA
NKPIPISTIHSFKRMRCFQPYSAVVTALRQSNFLDVDGEEGQESVKRKVAYKSTAEAKAKAEASSVYVKGFGDED
PNTQFDLESFFAKFGEVRGLKLRRTNDGLFKGSVFVTFPDEEAAKQFIELQPAPTYKGHELKIMSKRAYCEEKSE
LIRQEVVAVVVVVXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXGRGGWRGGRGRDHGSGARGGSRDKDDDARN
AEHRDDTNDVKPRIQSTTDQGEGNTSTTTANNKRTREDDGSAQDGPPAKKVDTKGQVEAEA*
Coding >OphauB2|7310
ATGACCGATTCAGACGCCACATCCAAGCCCACCACAGCTGCAGAGGTGCAGCAAGTGGCCGAGGAAAAGGTCGAT
ACTTCCAATAACCCAGAGCCGACCAAGGCCACACCTGAAACAGGACCTGCAGAAGCAGAGACGGAGCTCCAGCAG
GAAGCCGCTCAACATGAAGATGCAGATTCCAAGCCCGAGGAGGCACTAGCAACATCCAATCCAACAGAGGAAGAT
GGAAAAGCAGCACCTGATTCCTCTGCCGGACAAGGAAACAGCAAGATGCTCAAGACCAAGGCCAAGGTTAATCGT
CAAGACTTTCGCAAGAATCGCAAATTCGATCCCAGTGTTCGAAGAATTACCGACGACCCGGAGGAGATTCGTAAG
CAGGTCGAGTTTTATTTTGGAGACTGGAATTTCCCCCAGGACAAATTCATGTGGGAATCCTGTGGAGGCGCAGCC
AACAAGCCCATTCCAATTTCCACGATTCACTCATTCAAGCGGATGCGCTGCTTCCAGCCCTATAGTGCTGTTGTT
ACAGCCCTTCGCCAAAGCAACTTTCTCGACGTTGATGGCGAAGAGGGCCAGGAAAGCGTCAAACGCAAGGTTGCG
TACAAGTCGACTGCCGAGGCCAAGGCCAAGGCGGAAGCTTCGTCGGTCTATGTCAAGGGCTTTGGCGATGAAGAT
CCCAACACGCAGTTTGACTTGGAGAGCTTTTTTGCAAAGTTTGGCGAGGTCAGGGGCCTCAAACTCCGTCGAACA
AATGATGGCCTCTTCAAGGGCTCAGTCTTTGTTACCTTTCCAGACGAAGAGGCTGCCAAGCAATTCATTGAGCTG
CAACCGGCACCGACTTACAAGGGGCATGAGCTGAAAATCATGTCCAAGCGCGCCTACTGCGAGGAAAAGTCGGAG
CTTATTCGACAAGAGGTGGTGGCGGTGGTGGTGGTGGTNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNGGACGCGGTGGCTGG
CGGGGCGGCCGTGGGCGAGATCACGGCAGCGGCGCCCGCGGTGGCTCGCGGGACAAGGATGACGATGCTAGGAAT
GCCGAGCATCGAGACGATACAAATGACGTCAAGCCCCGAATCCAATCAACAACAGACCAAGGCGAAGGAAACACG
TCGACAACGACTGCAAATAACAAGCGGACACGCGAAGACGACGGCTCGGCACAGGATGGCCCACCAGCTAAAAAG
GTGGACACCAAGGGCCAAGTCGAGGCTGAAGCATGA
Transcript >OphauB2|7310
ATGACCGATTCAGACGCCACATCCAAGCCCACCACAGCTGCAGAGGTGCAGCAAGTGGCCGAGGAAAAGGTCGAT
ACTTCCAATAACCCAGAGCCGACCAAGGCCACACCTGAAACAGGACCTGCAGAAGCAGAGACGGAGCTCCAGCAG
GAAGCCGCTCAACATGAAGATGCAGATTCCAAGCCCGAGGAGGCACTAGCAACATCCAATCCAACAGAGGAAGAT
GGAAAAGCAGCACCTGATTCCTCTGCCGGACAAGGAAACAGCAAGATGCTCAAGACCAAGGCCAAGGTTAATCGT
CAAGACTTTCGCAAGAATCGCAAATTCGATCCCAGTGTTCGAAGAATTACCGACGACCCGGAGGAGATTCGTAAG
CAGGTCGAGTTTTATTTTGGAGACTGGAATTTCCCCCAGGACAAATTCATGTGGGAATCCTGTGGAGGCGCAGCC
AACAAGCCCATTCCAATTTCCACGATTCACTCATTCAAGCGGATGCGCTGCTTCCAGCCCTATAGTGCTGTTGTT
ACAGCCCTTCGCCAAAGCAACTTTCTCGACGTTGATGGCGAAGAGGGCCAGGAAAGCGTCAAACGCAAGGTTGCG
TACAAGTCGACTGCCGAGGCCAAGGCCAAGGCGGAAGCTTCGTCGGTCTATGTCAAGGGCTTTGGCGATGAAGAT
CCCAACACGCAGTTTGACTTGGAGAGCTTTTTTGCAAAGTTTGGCGAGGTCAGGGGCCTCAAACTCCGTCGAACA
AATGATGGCCTCTTCAAGGGCTCAGTCTTTGTTACCTTTCCAGACGAAGAGGCTGCCAAGCAATTCATTGAGCTG
CAACCGGCACCGACTTACAAGGGGCATGAGCTGAAAATCATGTCCAAGCGCGCCTACTGCGAGGAAAAGTCGGAG
CTTATTCGACAAGAGGTGGTGGCGGTGGTGGTGGTGGTNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNGGACGCGGTGGCTGG
CGGGGCGGCCGTGGGCGAGATCACGGCAGCGGCGCCCGCGGTGGCTCGCGGGACAAGGATGACGATGCTAGGAAT
GCCGAGCATCGAGACGATACAAATGACGTCAAGCCCCGAATCCAATCAACAACAGACCAAGGCGAAGGAAACACG
TCGACAACGACTGCAAATAACAAGCGGACACGCGAAGACGACGGCTCGGCACAGGATGGCCCACCAGCTAAAAAG
GTGGACACCAAGGGCCAAGTCGAGGCTGAAGCATGA
Gene >OphauB2|7310
ATGACCGATTCAGACGCCACATCCAAGCCCACCACAGCTGCAGAGGTGCAGCAAGTGGCCGAGGAAAAGGTCGAT
ACTTCCAATAACCCAGAGCCGACCAAGGCCACACCTGAAACAGGACCTGCAGAAGCAGAGACGGAGCTCCAGCAG
GAAGCCGCTCAACATGAAGATGCAGATTCCAAGCCCGAGGAGGCACTAGCAACATCCAATCCAACAGAGGAAGAT
GGAAAAGCAGCACCTGATTCCTCTGCCGGACAAGGAAACAGCAAGATGCTCAAGACCAAGGCCAAGGTTAATCGT
CAAGACTTTCGCAAGAATCGCAAATTCGATCCCAGTGTTCGAAGAATTACCGACGACCCGGAGGAGATTCGTAAG
CAGGTAATTAGTCTTGTATAACCCCTTGTTGGTATCTGTTGGCTTCTAACGCCCTTGCTTGCAATAGGTCGAGTT
TTATTTTGGAGACTGGAATTTCCCCCAGGACAAATTCATGTGGGAATCCTGTGGAGGCGCAGCCAACAAGCCCAT
TCCAATTTCCACGATTCACTCATTCAAGCGGATGCGCTGCTTCCAGCCCTATAGTGCTGTTGTTACAGCCCTTCG
CCAAAGCAACTTTCTCGACGTTGATGGCGAAGAGGGCCAGGAAAGCGTCAAACGCAAGGTTGCGTACAAGTCGAC
TGCCGAGGCCAAGGCCAAGGCGGAAGCTTCGTCGGTCTATGTCAAGGGCTTTGGCGATGAAGATCCCAACACGCA
GTTTGACTTGGAGAGCTTTTTTGCAAAGTTTGGCGAGGTCAGGGGCCTCAAACTCCGTCGAACAAATGATGGCCT
CTTCAAGGGCTCAGTCTTTGTTACCTTTCCAGACGAAGAGGCTGCCAAGCAATTCATTGAGCTGCAACCGGCACC
GACTTACAAGGGGCATGAGCTGAAAATCATGTCCAAGCGCGCCTACTGCGAGGAAAAGTCGGAGCTTATTCGACA
AGGTAAGCTGCAGCCTAACCCTATTGCGCCCAAGAGATTTTTTGAGGGACATGATGGCACCAAGAGGATGCCCAA
TGGTAGAGGTGGTGGCGGTGGTGGTGGTGGTNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNGGACGCGGTGGCTGGCGGGGCG
GCCGTGGGCGAGATCACGGCAGCGGCGCCCGCGGTGGCTCGCGGGACAAGGATGACGATGCTAGGAATGCCGAGC
ATCGAGACGATACAAATGAGCAAGTCTGCCCCCCCATGGCGGTTTATTGTACCTTTGCTAACGTTGCAAACAGCG
TCAAGCCCCGAATCCAATCAACAACAGACCAAGGCGAAGGAAACACGTCGACAACGACTGCAAATAACAAGCGGA
CACGCGAAGACGACGGCTCGGCACAGGATGGCCCACCAGCTAAAAAGGTGGACACCAAGGGCCAAGTCGAGGCTG
AAGCATGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail