Fungal Genomics

at Utrecht University

General Properties

Protein IDOphauB2|7305
Gene name
LocationContig_77:25109..28712
Strand-
Gene length (bp)3603
Transcript length (bp)3189
Coding sequence length (bp)3189
Protein length (aa) 1063

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00067 p450 Cytochrome P450 4.4E-73 8 454
PF00667 FAD_binding_1 FAD binding domain 5.7E-30 678 881
PF00258 Flavodoxin_1 Flavodoxin 4.4E-26 503 637
PF00175 NAD_binding_1 Oxidoreductase NAD-binding domain 2.8E-09 916 1021

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q9Y8G7|C505_FUSOX Bifunctional P-450:NADPH-P450 reductase OS=Fusarium oxysporum GN=CYP505 PE=1 SV=1 1 1061 0.0E+00
sp|O08336|CYPB_BACSU Bifunctional cytochrome P450/NADPH--P450 reductase 2 OS=Bacillus subtilis (strain 168) GN=cypB PE=1 SV=1 1 1061 0.0E+00
sp|O08394|CYPD_BACSU Bifunctional cytochrome P450/NADPH--P450 reductase 1 OS=Bacillus subtilis (strain 168) GN=cypD PE=1 SV=1 1 1016 0.0E+00
sp|P14779|CPXB_BACME Bifunctional cytochrome P450/NADPH--P450 reductase OS=Bacillus megaterium GN=cyp102A1 PE=1 SV=2 7 1062 0.0E+00
sp|P37040|NCPR_MOUSE NADPH--cytochrome P450 reductase OS=Mus musculus GN=Por PE=1 SV=2 477 1061 3.0E-64
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q9Y8G7|C505_FUSOX Bifunctional P-450:NADPH-P450 reductase OS=Fusarium oxysporum GN=CYP505 PE=1 SV=1 1 1061 0.0E+00
sp|O08336|CYPB_BACSU Bifunctional cytochrome P450/NADPH--P450 reductase 2 OS=Bacillus subtilis (strain 168) GN=cypB PE=1 SV=1 1 1061 0.0E+00
sp|O08394|CYPD_BACSU Bifunctional cytochrome P450/NADPH--P450 reductase 1 OS=Bacillus subtilis (strain 168) GN=cypD PE=1 SV=1 1 1016 0.0E+00
sp|P14779|CPXB_BACME Bifunctional cytochrome P450/NADPH--P450 reductase OS=Bacillus megaterium GN=cyp102A1 PE=1 SV=2 7 1062 0.0E+00
sp|P37040|NCPR_MOUSE NADPH--cytochrome P450 reductase OS=Mus musculus GN=Por PE=1 SV=2 477 1061 3.0E-64
sp|P16435|NCPR_HUMAN NADPH--cytochrome P450 reductase OS=Homo sapiens GN=POR PE=1 SV=2 497 1061 5.0E-64
sp|P00388|NCPR_RAT NADPH--cytochrome P450 reductase OS=Rattus norvegicus GN=Por PE=1 SV=3 477 1061 4.0E-63
sp|P04175|NCPR_PIG NADPH--cytochrome P450 reductase OS=Sus scrofa GN=POR PE=1 SV=2 497 1061 1.0E-62
sp|P37039|NCPR_CAVPO NADPH--cytochrome P450 reductase OS=Cavia porcellus GN=Por PE=2 SV=2 497 1061 2.0E-62
sp|Q3SYT8|NCPR_BOVIN NADPH--cytochrome P450 reductase OS=Bos taurus GN=POR PE=2 SV=3 497 1061 2.0E-60
sp|P00389|NCPR_RABIT NADPH--cytochrome P450 reductase OS=Oryctolagus cuniculus GN=POR PE=1 SV=1 497 1061 3.0E-60
sp|Q2UHA7|NCPR_ASPOR NADPH--cytochrome P450 reductase OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) GN=cprA PE=3 SV=1 497 1016 6.0E-57
sp|Q0CMM0|NCPR_ASPTN NADPH--cytochrome P450 reductase OS=Aspergillus terreus (strain NIH 2624 / FGSC A1156) GN=cprA PE=3 SV=1 497 1016 1.0E-55
sp|Q4WM67|NCPR_ASPFU NADPH--cytochrome P450 reductase OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=cprA PE=1 SV=1 497 1016 6.0E-55
sp|P19618|NCPR_SALTR NADPH--cytochrome P450 reductase (Fragments) OS=Salmo trutta GN=por PE=1 SV=1 477 1061 8.0E-55
sp|Q5BFT5|NCPR_EMENI NADPH--cytochrome P450 reductase OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=cprA PE=3 SV=1 497 1016 1.0E-54
sp|Q55CT1|NCPR_DICDI NADPH--cytochrome P450 reductase OS=Dictyostelium discoideum GN=redB PE=2 SV=1 499 1061 1.0E-54
sp|Q27597|NCPR_DROME NADPH--cytochrome P450 reductase OS=Drosophila melanogaster GN=Cpr PE=2 SV=2 497 1061 2.0E-53
sp|A2QS05|NCPR_ASPNC NADPH--cytochrome P450 reductase OS=Aspergillus niger (strain CBS 513.88 / FGSC A1513) GN=cprA PE=3 SV=1 497 1016 3.0E-53
sp|Q00141|NCPR_ASPNG NADPH--cytochrome P450 reductase OS=Aspergillus niger GN=cprA PE=1 SV=2 497 1016 1.0E-52
sp|Q07994|NCPR_MUSDO NADPH--cytochrome P450 reductase OS=Musca domestica PE=2 SV=1 496 1061 3.0E-52
sp|Q9SUM3|NCPR2_ARATH NADPH--cytochrome P450 reductase 2 OS=Arabidopsis thaliana GN=ATR2 PE=1 SV=1 499 1061 2.0E-48
sp|Q9SB48|NCPR1_ARATH NADPH--cytochrome P450 reductase 1 OS=Arabidopsis thaliana GN=ATR1 PE=1 SV=1 486 1061 9.0E-48
sp|Q94IN5|PNO_EUGGR Pyruvate dehydrogenase [NADP(+)], mitochondrial OS=Euglena gracilis GN=PNO PE=1 SV=1 430 1056 2.0E-47
sp|P37116|NCPR_VIGRR NADPH--cytochrome P450 reductase OS=Vigna radiata var. radiata PE=1 SV=1 494 1061 3.0E-46
sp|P50126|NCPR_CANMA NADPH--cytochrome P450 reductase OS=Candida maltosa GN=NCP1 PE=2 SV=1 497 1061 1.0E-45
sp|Q05001|NCPR_CATRO NADPH--cytochrome P450 reductase OS=Catharanthus roseus GN=CPR PE=2 SV=1 499 1061 1.0E-42
sp|O32214|CYSJ_BACSU Sulfite reductase [NADPH] flavoprotein alpha-component OS=Bacillus subtilis (strain 168) GN=cysJ PE=1 SV=1 499 1061 6.0E-40
sp|P37201|NCPR_CANTR NADPH--cytochrome P450 reductase OS=Candida tropicalis GN=NCP1 PE=3 SV=1 481 1061 2.0E-39
sp|P36587|NCPR_SCHPO NADPH--cytochrome P450 reductase OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=ccr1 PE=2 SV=1 502 1016 5.0E-38
sp|Q9Z0J4|NOS1_MOUSE Nitric oxide synthase, brain OS=Mus musculus GN=Nos1 PE=1 SV=1 579 1062 3.0E-37
sp|P29476|NOS1_RAT Nitric oxide synthase, brain OS=Rattus norvegicus GN=Nos1 PE=1 SV=1 579 1062 8.0E-37
sp|P29475|NOS1_HUMAN Nitric oxide synthase, brain OS=Homo sapiens GN=NOS1 PE=1 SV=2 579 1062 2.0E-36
sp|Q6NPS8|NDOR1_ARATH NADPH-dependent diflavin oxidoreductase 1 OS=Arabidopsis thaliana GN=ATR3 PE=1 SV=1 499 1017 1.0E-35
sp|O19132|NOS1_RABIT Nitric oxide synthase, brain OS=Oryctolagus cuniculus GN=NOS1 PE=2 SV=1 579 1062 2.0E-35
sp|Q27571|NOS_DROME Nitric oxide synthase OS=Drosophila melanogaster GN=Nos PE=2 SV=3 579 1062 2.0E-35
sp|Q9HDG2|NCPR_PHACH NADPH--cytochrome P450 reductase OS=Phanerochaete chrysosporium GN=CPR PE=2 SV=1 483 1055 2.0E-35
sp|O61608|NOS_ANOST Nitric oxide synthase OS=Anopheles stephensi PE=2 SV=2 579 1062 6.0E-35
sp|Q6LM58|CYSJ_PHOPR Sulfite reductase [NADPH] flavoprotein alpha-component OS=Photobacterium profundum GN=cysJ PE=3 SV=1 488 1061 2.0E-34
sp|Q9KUX4|CYSJ_VIBCH Sulfite reductase [NADPH] flavoprotein alpha-component OS=Vibrio cholerae serotype O1 (strain ATCC 39315 / El Tor Inaba N16961) GN=cysJ PE=3 SV=1 490 1061 2.0E-34
sp|A5F3I4|CYSJ_VIBC3 Sulfite reductase [NADPH] flavoprotein alpha-component OS=Vibrio cholerae serotype O1 (strain ATCC 39541 / Classical Ogawa 395 / O395) GN=cysJ PE=3 SV=1 490 1061 3.0E-34
sp|P35228|NOS2_HUMAN Nitric oxide synthase, inducible OS=Homo sapiens GN=NOS2 PE=1 SV=2 501 1062 7.0E-34
sp|P57503|CYSJ_BUCAI Sulfite reductase [NADPH] flavoprotein alpha-component OS=Buchnera aphidicola subsp. Acyrthosiphon pisum (strain APS) GN=cysJ PE=3 SV=1 501 1061 2.0E-33
sp|F4IK45|C70B2_ARATH Cytochrome P450 709B2 OS=Arabidopsis thaliana GN=CYP709B2 PE=2 SV=1 30 450 2.0E-33
sp|Q54B10|REDA_DICDI NADPH oxidoreductase A OS=Dictyostelium discoideum GN=redA PE=2 SV=1 500 1061 2.0E-33
sp|Q8EAZ9|CYSJ_SHEON Sulfite reductase [NADPH] flavoprotein alpha-component OS=Shewanella oneidensis (strain MR-1) GN=cysJ PE=3 SV=1 485 1061 3.0E-33
sp|Q62600|NOS3_RAT Nitric oxide synthase, endothelial OS=Rattus norvegicus GN=Nos3 PE=1 SV=4 582 1062 3.0E-33
sp|Q28969|NOS3_PIG Nitric oxide synthase, endothelial OS=Sus scrofa GN=NOS3 PE=1 SV=4 582 1062 4.0E-33
sp|P9WPN2|CP132_MYCTO Putative cytochrome P450 132 OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) GN=cyp132 PE=3 SV=1 40 451 7.0E-33
sp|P59954|CP132_MYCBO Putative cytochrome P450 132 OS=Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97) GN=cyp132 PE=3 SV=1 40 451 7.0E-33
sp|O54705|NOS2_CAVPO Nitric oxide synthase, inducible OS=Cavia porcellus GN=NOS2 PE=2 SV=1 503 1062 7.0E-33
sp|P9WPN3|CP132_MYCTU Putative cytochrome P450 132 OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=cyp132 PE=1 SV=1 40 451 9.0E-33
sp|P70313|NOS3_MOUSE Nitric oxide synthase, endothelial OS=Mus musculus GN=Nos3 PE=1 SV=4 582 1062 1.0E-32
sp|Q90703|NOS2_CHICK Nitric oxide synthase, inducible OS=Gallus gallus GN=NOS2 PE=2 SV=1 501 1062 4.0E-32
sp|P29473|NOS3_BOVIN Nitric oxide synthase, endothelial OS=Bos taurus GN=NOS3 PE=1 SV=3 582 1062 6.0E-32
sp|Q93VK5|LUT5_ARATH Protein LUTEIN DEFICIENT 5, chloroplastic OS=Arabidopsis thaliana GN=CYP97A3 PE=1 SV=1 30 432 7.0E-32
sp|B1B557|NOSL_BOMMO Nitric oxide synthase-like protein OS=Bombyx mori GN=NSL PE=2 SV=1 579 1062 8.0E-32
sp|P29474|NOS3_HUMAN Nitric oxide synthase, endothelial OS=Homo sapiens GN=NOS3 PE=1 SV=3 582 1062 2.0E-31
sp|Q1LTP1|CYSJ_BAUCH Sulfite reductase [NADPH] flavoprotein alpha-component OS=Baumannia cicadellinicola subsp. Homalodisca coagulata GN=cysJ PE=3 SV=1 496 1042 3.0E-31
sp|P16603|NCPR_YEAST NADPH--cytochrome P450 reductase OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=NCP1 PE=1 SV=3 482 1061 3.0E-31
sp|O17624|C13B1_CAEEL Putative cytochrome P450 cyp-13B1 OS=Caenorhabditis elegans GN=cyp-13B1 PE=3 SV=2 7 448 4.0E-31
sp|A0KTH4|CYSJ_SHESA Sulfite reductase [NADPH] flavoprotein alpha-component OS=Shewanella sp. (strain ANA-3) GN=cysJ PE=3 SV=1 493 1061 4.0E-31
sp|Q06518|NOS2_RAT Nitric oxide synthase, inducible OS=Rattus norvegicus GN=Nos2 PE=1 SV=2 502 1062 6.0E-31
sp|Q5E841|CYSJ_VIBF1 Sulfite reductase [NADPH] flavoprotein alpha-component OS=Vibrio fischeri (strain ATCC 700601 / ES114) GN=cysJ PE=3 SV=1 485 1061 7.0E-31
sp|Q8T8C0|NOS_BOMMO Nitric oxide synthase OS=Bombyx mori GN=NOS PE=2 SV=1 579 1062 1.0E-30
sp|Q0HYB4|CYSJ_SHESR Sulfite reductase [NADPH] flavoprotein alpha-component OS=Shewanella sp. (strain MR-7) GN=cysJ PE=3 SV=1 482 1061 1.0E-30
sp|Q0HFL6|CYSJ_SHESM Sulfite reductase [NADPH] flavoprotein alpha-component OS=Shewanella sp. (strain MR-4) GN=cysJ PE=3 SV=1 493 1061 1.0E-30
sp|P29477|NOS2_MOUSE Nitric oxide synthase, inducible OS=Mus musculus GN=Nos2 PE=1 SV=1 502 1062 1.0E-30
sp|O62699|NOS2_CANLF Nitric oxide synthase, inducible OS=Canis lupus familiaris GN=NOS2 PE=2 SV=2 501 1062 3.0E-30
sp|Q5NRM1|CYSJ_ZYMMO Sulfite reductase [NADPH] flavoprotein alpha-component OS=Zymomonas mobilis subsp. mobilis (strain ATCC 31821 / ZM4 / CP4) GN=cysJ PE=3 SV=1 501 1061 3.0E-30
sp|Q26240|NOS_RHOPR Nitric oxide synthase, salivary gland OS=Rhodnius prolixus PE=2 SV=1 579 1062 4.0E-30
sp|O42563|CP3AR_ONCMY Cytochrome P450 3A27 OS=Oncorhynchus mykiss GN=cyp3a27 PE=2 SV=1 7 466 6.0E-30
sp|Q65T53|CYSJ_MANSM Sulfite reductase [NADPH] flavoprotein alpha-component OS=Mannheimia succiniciproducens (strain MBEL55E) GN=cysJ PE=3 SV=1 462 1061 9.0E-30
sp|O94613|NDOR1_SCHPO NADPH-dependent diflavin oxidoreductase 1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=tah18 PE=3 SV=2 501 1061 2.0E-29
sp|Q9UHB4|NDOR1_HUMAN NADPH-dependent diflavin oxidoreductase 1 OS=Homo sapiens GN=NDOR1 PE=1 SV=1 501 1036 2.0E-29
sp|Q27995|NOS2_BOVIN Nitric oxide synthase, inducible OS=Bos taurus GN=NOS2 PE=2 SV=3 503 1062 2.0E-28
sp|O18993|CP3AL_CALJA Cytochrome P450 3A21 OS=Callithrix jacchus GN=CYP3A21 PE=2 SV=1 7 430 2.0E-28
sp|Q87L90|CYSJ_VIBPA Sulfite reductase [NADPH] flavoprotein alpha-component OS=Vibrio parahaemolyticus serotype O3:K6 (strain RIMD 2210633) GN=cysJ PE=3 SV=1 501 1061 2.0E-28
sp|A2RRT9|CP4V2_RAT Cytochrome P450 4V2 OS=Rattus norvegicus GN=Cyp4v2 PE=2 SV=1 40 464 2.0E-28
sp|P33268|CP3A8_MACFA Cytochrome P450 3A8 OS=Macaca fascicularis GN=CYP3A8 PE=1 SV=1 7 430 4.0E-28
sp|O70537|CP3AV_MESAU Cytochrome P450 3A31 OS=Mesocricetus auratus GN=CYP3A31 PE=2 SV=1 7 430 4.0E-28
sp|P20815|CP3A5_HUMAN Cytochrome P450 3A5 OS=Homo sapiens GN=CYP3A5 PE=1 SV=1 7 430 4.0E-28
sp|Q8C1A3|MTRR_MOUSE Methionine synthase reductase OS=Mus musculus GN=Mtrr PE=1 SV=2 646 1061 1.0E-27
sp|Q54JL0|NDOR1_DICDI NADPH-dependent diflavin oxidoreductase 1 OS=Dictyostelium discoideum GN=redC PE=2 SV=1 498 1033 2.0E-27
sp|Q6TBX7|LUT1_ARATH Carotene epsilon-monooxygenase, chloroplastic OS=Arabidopsis thaliana GN=CYP97C1 PE=1 SV=1 30 432 3.0E-27
sp|P08684|CP3A4_HUMAN Cytochrome P450 3A4 OS=Homo sapiens GN=CYP3A4 PE=1 SV=4 7 430 4.0E-27
sp|Q9T093|C70B3_ARATH Cytochrome P450 709B3 OS=Arabidopsis thaliana GN=CYP709B3 PE=2 SV=1 37 437 5.0E-27
sp|Q12181|NDOR1_YEAST NADPH-dependent diflavin oxidoreductase 1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TAH18 PE=1 SV=1 497 1061 6.0E-27
sp|A7MJ63|CYSJ_CROS8 Sulfite reductase [NADPH] flavoprotein alpha-component OS=Cronobacter sakazakii (strain ATCC BAA-894) GN=cysJ PE=3 SV=1 445 1061 7.0E-27
sp|A2AI05|NDOR1_MOUSE NADPH-dependent diflavin oxidoreductase 1 OS=Mus musculus GN=Ndor1 PE=2 SV=1 501 1036 8.0E-27
sp|Q498R1|MTRR_RAT Methionine synthase reductase OS=Rattus norvegicus GN=Mtrr PE=2 SV=2 646 1062 8.0E-27
sp|Q7N8L6|CYSJ_PHOLL Sulfite reductase [NADPH] flavoprotein alpha-component OS=Photorhabdus luminescens subsp. laumondii (strain TT01) GN=cysJ PE=3 SV=1 461 1061 8.0E-27
sp|Q9TUX8|NOS3_CANLF Nitric oxide synthase, endothelial OS=Canis lupus familiaris GN=NOS3 PE=2 SV=1 503 1062 1.0E-26
sp|A9LZ73|CYSJ_NEIM0 Sulfite reductase [NADPH] flavoprotein alpha-component OS=Neisseria meningitidis serogroup C (strain 053442) GN=cysJ PE=3 SV=1 490 1061 1.0E-26
sp|Q9JMA7|CP341_MOUSE Cytochrome P450 3A41 OS=Mus musculus GN=Cyp3a41a PE=1 SV=2 7 430 1.0E-26
sp|P24462|CP3A7_HUMAN Cytochrome P450 3A7 OS=Homo sapiens GN=CYP3A7 PE=1 SV=2 7 430 2.0E-26
sp|Q9DBW0|CP4V2_MOUSE Cytochrome P450 4V2 OS=Mus musculus GN=Cyp4v2 PE=1 SV=1 40 464 2.0E-26
sp|P51538|CP3A9_RAT Cytochrome P450 3A9 OS=Rattus norvegicus GN=Cyp3a9 PE=2 SV=2 7 430 2.0E-26
sp|Q64581|CP3AI_RAT Cytochrome P450 3A18 OS=Rattus norvegicus GN=Cyp3a18 PE=2 SV=1 7 429 2.0E-26
sp|Q9EP75|CP4FE_MOUSE Leukotriene-B4 omega-hydroxylase 3 OS=Mus musculus GN=Cyp4f14 PE=1 SV=1 8 434 3.0E-26
sp|P11707|CP3A6_RABIT Cytochrome P450 3A6 OS=Oryctolagus cuniculus GN=CYP3A6 PE=2 SV=2 7 432 4.0E-26
sp|O23365|C97B3_ARATH Cytochrome P450 97B3, chloroplastic OS=Arabidopsis thaliana GN=CYP97B3 PE=2 SV=2 37 451 4.0E-26
sp|P33274|CP4F1_RAT Cytochrome P450 4F1 OS=Rattus norvegicus GN=Cyp4f1 PE=2 SV=1 7 434 4.0E-26
sp|Q4JIJ2|MTRR_BOVIN Methionine synthase reductase OS=Bos taurus GN=MTRR PE=2 SV=1 706 1061 4.0E-26
sp|A8G9X6|CYSJ_SERP5 Sulfite reductase [NADPH] flavoprotein alpha-component OS=Serratia proteamaculans (strain 568) GN=cysJ PE=3 SV=1 503 1061 5.0E-26
sp|Q6D1A1|CYSJ_PECAS Sulfite reductase [NADPH] flavoprotein alpha-component OS=Pectobacterium atrosepticum (strain SCRI 1043 / ATCC BAA-672) GN=cysJ PE=3 SV=1 499 1061 6.0E-26
sp|P33267|CP2F2_MOUSE Cytochrome P450 2F2 OS=Mus musculus GN=Cyp2f2 PE=1 SV=1 8 435 8.0E-26
sp|Q6FRH1|NDOR1_CANGA NADPH-dependent diflavin oxidoreductase 1 OS=Candida glabrata (strain ATCC 2001 / CBS 138 / JCM 3761 / NBRC 0622 / NRRL Y-65) GN=TAH18 PE=3 SV=1 497 1061 1.0E-25
sp|O19114|NOS2_RABIT Nitric oxide synthase, inducible (Fragment) OS=Oryctolagus cuniculus GN=NOS2 PE=2 SV=1 707 1062 1.0E-25
sp|A1KU06|CYSJ_NEIMF Sulfite reductase [NADPH] flavoprotein alpha-component OS=Neisseria meningitidis serogroup C / serotype 2a (strain ATCC 700532 / DSM 15464 / FAM18) GN=cysJ PE=3 SV=1 490 1061 1.0E-25
sp|Q64459|CP3AB_MOUSE Cytochrome P450 3A11 OS=Mus musculus GN=Cyp3a11 PE=1 SV=1 7 430 1.0E-25
sp|Q9UBK8|MTRR_HUMAN Methionine synthase reductase OS=Homo sapiens GN=MTRR PE=1 SV=3 706 1061 1.0E-25
sp|O48921|C97B2_SOYBN Cytochrome P450 97B2, chloroplastic OS=Glycine max GN=CYP97B2 PE=2 SV=1 37 451 1.0E-25
sp|Q83QD9|CYSJ_SHIFL Sulfite reductase [NADPH] flavoprotein alpha-component OS=Shigella flexneri GN=cysJ PE=3 SV=3 445 1061 2.0E-25
sp|Q0T1I8|CYSJ_SHIF8 Sulfite reductase [NADPH] flavoprotein alpha-component OS=Shigella flexneri serotype 5b (strain 8401) GN=cysJ PE=3 SV=1 445 1061 2.0E-25
sp|Q8DCK2|CYSJ_VIBVU Sulfite reductase [NADPH] flavoprotein alpha-component OS=Vibrio vulnificus (strain CMCP6) GN=cysJ PE=3 SV=1 482 1061 2.0E-25
sp|Q6ZWL3|CP4V2_HUMAN Cytochrome P450 4V2 OS=Homo sapiens GN=CYP4V2 PE=1 SV=2 40 451 2.0E-25
sp|Q8K9D3|CYSJ_BUCAP Sulfite reductase [NADPH] flavoprotein alpha-component OS=Buchnera aphidicola subsp. Schizaphis graminum (strain Sg) GN=cysJ PE=3 SV=1 499 1061 3.0E-25
sp|Q9JS45|CYSJ_NEIMB Sulfite reductase [NADPH] flavoprotein alpha-component OS=Neisseria meningitidis serogroup B (strain MC58) GN=cysJ1 PE=3 SV=1 490 1061 3.0E-25
sp|B9X287|C7346_ORYSJ Cytochrome P450 734A6 OS=Oryza sativa subsp. japonica GN=CYP734A6 PE=2 SV=1 37 441 4.0E-25
sp|Q27712|CP2L1_PANAR Cytochrome P450 2L1 OS=Panulirus argus GN=CYP2L1 PE=1 SV=1 10 431 4.0E-25
sp|Q6PFP6|NDOR1_DANRE NADPH-dependent diflavin oxidoreductase 1 OS=Danio rerio GN=ndor1 PE=2 SV=1 497 1062 4.0E-25
sp|Q6NRG5|NDOR1_XENLA NADPH-dependent diflavin oxidoreductase 1 OS=Xenopus laevis GN=ndor1 PE=2 SV=1 501 1062 4.0E-25
sp|Q27589|CP4D2_DROME Cytochrome P450 4d2 OS=Drosophila melanogaster GN=Cyp4d2 PE=2 SV=2 7 430 5.0E-25
sp|P79102|CP3AS_BOVIN Cytochrome P450 3A28 OS=Bos taurus GN=CYP3A28 PE=2 SV=1 7 430 6.0E-25
sp|Q64464|CP3AD_MOUSE Cytochrome P450 3A13 OS=Mus musculus GN=Cyp3a13 PE=1 SV=1 7 428 6.0E-25
sp|P05179|CP2C7_RAT Cytochrome P450 2C7 OS=Rattus norvegicus GN=Cyp2c7 PE=1 SV=2 8 430 6.0E-25
sp|Q8X7U1|CYSJ_ECO57 Sulfite reductase [NADPH] flavoprotein alpha-component OS=Escherichia coli O157:H7 GN=cysJ PE=3 SV=3 501 1061 6.0E-25
sp|Q64417|CP3AE_CAVPO Cytochrome P450 3A14 OS=Cavia porcellus GN=CYP3A14 PE=2 SV=2 7 430 6.0E-25
sp|Q5RCN6|CP4V2_PONAB Cytochrome P450 4V2 OS=Pongo abelii GN=CYP4V2 PE=2 SV=1 40 451 6.0E-25
sp|P33272|CP2BC_RAT Cytochrome P450 2B12 OS=Rattus norvegicus GN=Cyp2b12 PE=2 SV=1 8 431 8.0E-25
sp|P04800|CP3A1_RAT Cytochrome P450 3A1 OS=Rattus norvegicus GN=Cyp3a1 PE=1 SV=1 7 430 8.0E-25
sp|A8A3P5|CYSJ_ECOHS Sulfite reductase [NADPH] flavoprotein alpha-component OS=Escherichia coli O9:H4 (strain HS) GN=cysJ PE=3 SV=1 501 1061 9.0E-25
sp|A4WDW1|CYSJ_ENT38 Sulfite reductase [NADPH] flavoprotein alpha-component OS=Enterobacter sp. (strain 638) GN=cysJ PE=3 SV=1 445 1061 9.0E-25
sp|P38038|CYSJ_ECOLI Sulfite reductase [NADPH] flavoprotein alpha-component OS=Escherichia coli (strain K12) GN=cysJ PE=1 SV=4 501 1061 1.0E-24
sp|Q29496|CP3AO_SHEEP Cytochrome P450 3A24 OS=Ovis aries GN=CYP3A24 PE=2 SV=1 10 430 1.0E-24
sp|Q6NT55|CP4FN_HUMAN Cytochrome P450 4F22 OS=Homo sapiens GN=CYP4F22 PE=2 SV=1 85 456 1.0E-24
sp|O48786|C734A_ARATH Cytochrome P450 734A1 OS=Arabidopsis thaliana GN=CYP734A1 PE=2 SV=1 10 451 2.0E-24
sp|Q7MHA5|CYSJ_VIBVY Sulfite reductase [NADPH] flavoprotein alpha-component OS=Vibrio vulnificus (strain YJ016) GN=cysJ PE=3 SV=2 482 1061 2.0E-24
sp|P79401|CP3AT_PIG Cytochrome P450 3A29 OS=Sus scrofa GN=CYP3A29 PE=2 SV=1 7 430 2.0E-24
sp|O09158|CP3AP_MOUSE Cytochrome P450 3A25 OS=Mus musculus GN=Cyp3a25 PE=1 SV=1 7 428 2.0E-24
sp|Q64481|CP3AG_MOUSE Cytochrome P450 3A16 OS=Mus musculus GN=Cyp3a16 PE=2 SV=2 7 430 2.0E-24
sp|P38039|CYSJ_SALTY Sulfite reductase [NADPH] flavoprotein alpha-component OS=Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) GN=cysJ PE=3 SV=2 501 1061 2.0E-24
sp|P29981|CP4C1_BLADI Cytochrome P450 4C1 OS=Blaberus discoidalis GN=CYP4C1 PE=2 SV=1 7 451 3.0E-24
sp|B1IU77|CYSJ_ECOLC Sulfite reductase [NADPH] flavoprotein alpha-component OS=Escherichia coli (strain ATCC 8739 / DSM 1576 / Crooks) GN=cysJ PE=3 SV=1 501 1061 3.0E-24
sp|A7ZQK7|CYSJ_ECO24 Sulfite reductase [NADPH] flavoprotein alpha-component OS=Escherichia coli O139:H28 (strain E24377A / ETEC) GN=cysJ PE=3 SV=1 501 1061 3.0E-24
sp|P24463|CP3AC_CANLF Cytochrome P450 3A12 OS=Canis lupus familiaris GN=CYP3A12 PE=2 SV=1 7 430 3.0E-24
sp|P05177|CP1A2_HUMAN Cytochrome P450 1A2 OS=Homo sapiens GN=CYP1A2 PE=1 SV=3 8 432 3.0E-24
sp|Q1R7T4|CYSJ_ECOUT Sulfite reductase [NADPH] flavoprotein alpha-component OS=Escherichia coli (strain UTI89 / UPEC) GN=cysJ PE=3 SV=1 501 1061 4.0E-24
sp|Q0TEA2|CYSJ_ECOL5 Sulfite reductase [NADPH] flavoprotein alpha-component OS=Escherichia coli O6:K15:H31 (strain 536 / UPEC) GN=cysJ PE=3 SV=1 501 1061 4.0E-24
sp|A1AEV0|CYSJ_ECOK1 Sulfite reductase [NADPH] flavoprotein alpha-component OS=Escherichia coli O1:K1 / APEC GN=cysJ PE=3 SV=1 501 1061 4.0E-24
sp|Q1JPJ0|NDOR1_BOVIN NADPH-dependent diflavin oxidoreductase 1 OS=Bos taurus GN=NDOR1 PE=2 SV=2 501 1051 4.0E-24
sp|P05183|CP3A2_RAT Cytochrome P450 3A2 OS=Rattus norvegicus GN=Cyp3a2 PE=1 SV=2 7 430 5.0E-24
sp|Q9VB31|C6A18_DROME Probable cytochrome P450 6a18 OS=Drosophila melanogaster GN=Cyp6a18 PE=2 SV=1 93 431 5.0E-24
sp|Q8Z458|CYSJ_SALTI Sulfite reductase [NADPH] flavoprotein alpha-component OS=Salmonella typhi GN=cysJ PE=3 SV=3 501 1061 5.0E-24
sp|Q8FEI7|CYSJ_ECOL6 Sulfite reductase [NADPH] flavoprotein alpha-component OS=Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC) GN=cysJ PE=3 SV=3 501 1061 5.0E-24
sp|Q3YY94|CYSJ_SHISS Sulfite reductase [NADPH] flavoprotein alpha-component OS=Shigella sonnei (strain Ss046) GN=cysJ PE=3 SV=1 501 1061 5.0E-24
sp|Q9ASR3|C7091_ARATH Cytochrome P450 709B1 OS=Arabidopsis thaliana GN=CYP709B1 PE=2 SV=1 37 450 6.0E-24
sp|A9N2E6|CYSJ_SALPB Sulfite reductase [NADPH] flavoprotein alpha-component OS=Salmonella paratyphi B (strain ATCC BAA-1250 / SPB7) GN=cysJ PE=3 SV=1 493 1061 7.0E-24
sp|Q32CG3|CYSJ_SHIDS Sulfite reductase [NADPH] flavoprotein alpha-component OS=Shigella dysenteriae serotype 1 (strain Sd197) GN=cysJ PE=3 SV=1 501 1061 1.0E-23
sp|Q6NKZ8|C14A2_ARATH Cytochrome P450 714A2 OS=Arabidopsis thaliana GN=CYP714A2 PE=2 SV=1 21 451 1.0E-23
sp|Q31XM4|CYSJ_SHIBS Sulfite reductase [NADPH] flavoprotein alpha-component OS=Shigella boydii serotype 4 (strain Sb227) GN=cysJ PE=3 SV=1 501 1061 1.0E-23
sp|Q6R7M4|C15A1_DIPPU Methyl farnesoate epoxidase OS=Diploptera punctata GN=CYP15A1 PE=1 SV=1 8 453 1.0E-23
sp|Q2NVN4|CYSJ_SODGM Sulfite reductase [NADPH] flavoprotein alpha-component OS=Sodalis glossinidius (strain morsitans) GN=cysJ PE=3 SV=1 501 1061 1.0E-23
sp|Q9STK7|C71AQ_ARATH Cytochrome P450 71A26 OS=Arabidopsis thaliana GN=CYP71A26 PE=3 SV=1 7 432 2.0E-23
sp|P00182|CP2C3_RABIT Cytochrome P450 2C3 OS=Oryctolagus cuniculus GN=CYP2C3 PE=1 SV=2 8 435 3.0E-23
sp|Q9CA60|C98A9_ARATH Cytochrome P450 98A9 OS=Arabidopsis thaliana GN=CYP98A9 PE=1 SV=1 4 443 3.0E-23
sp|A8ANX1|CYSJ_CITK8 Sulfite reductase [NADPH] flavoprotein alpha-component OS=Citrobacter koseri (strain ATCC BAA-895 / CDC 4225-83 / SGSC4696) GN=cysJ PE=3 SV=1 522 1061 3.0E-23
sp|Q09744|YB63_SCHPO Uncharacterized FAD-binding protein C12C2.03c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPBC12C2.03c PE=3 SV=1 682 1061 3.0E-23
sp|C0SPF7|C15C1_BOMMO Farnesoate epoxidase OS=Bombyx mori GN=CYP15C1 PE=1 SV=2 8 454 3.0E-23
sp|Q5PEH7|CYSJ_SALPA Sulfite reductase [NADPH] flavoprotein alpha-component OS=Salmonella paratyphi A (strain ATCC 9150 / SARB42) GN=cysJ PE=3 SV=3 493 1061 3.0E-23
sp|Q05047|C72A1_CATRO Secologanin synthase OS=Catharanthus roseus GN=CYP72A1 PE=2 SV=1 30 450 4.0E-23
sp|Q9STL0|C71AN_ARATH Cytochrome P450 71A23 OS=Arabidopsis thaliana GN=CYP71A23 PE=2 SV=1 5 434 4.0E-23
sp|Q7VQH2|CYSJ_BLOFL Sulfite reductase [NADPH] flavoprotein alpha-component OS=Blochmannia floridanus GN=cysJ PE=3 SV=1 501 1061 5.0E-23
sp|O55071|CP2BJ_MOUSE Cytochrome P450 2B19 OS=Mus musculus GN=Cyp2b19 PE=2 SV=1 8 431 5.0E-23
sp|Q95078|CP18A_DROME Cytochrome P450 18a1 OS=Drosophila melanogaster GN=Cyp18a1 PE=2 SV=2 8 454 6.0E-23
sp|P14581|CP4A7_RABIT Cytochrome P450 4A7 OS=Oryctolagus cuniculus GN=CYP4A7 PE=1 SV=1 7 459 6.0E-23
sp|Q57KH7|CYSJ_SALCH Sulfite reductase [NADPH] flavoprotein alpha-component OS=Salmonella choleraesuis (strain SC-B67) GN=cysJ PE=3 SV=3 501 1061 7.0E-23
sp|O61309|NOS_LYMST Nitric oxide synthase OS=Lymnaea stagnalis GN=NOS PE=2 SV=1 502 931 8.0E-23
sp|Q964T1|CP4CU_BLAGE Cytochrome P450 4c21 OS=Blattella germanica GN=CYP4C21 PE=2 SV=1 7 456 1.0E-22
sp|P82711|C6A19_DROME Probable cytochrome P450 6a19 OS=Drosophila melanogaster GN=Cyp6a19 PE=3 SV=1 9 432 1.0E-22
sp|Q9Y6A2|CP46A_HUMAN Cholesterol 24-hydroxylase OS=Homo sapiens GN=CYP46A1 PE=1 SV=1 3 449 1.0E-22
sp|Q64406|CP3AF_CAVPO Cytochrome P450 3A15 OS=Cavia porcellus GN=CYP3A15 PE=2 SV=1 7 430 1.0E-22
sp|P51869|CP4F4_RAT Cytochrome P450 4F4 OS=Rattus norvegicus GN=Cyp4f4 PE=2 SV=1 7 434 1.0E-22
sp|O35293|CP2F2_RAT Cytochrome P450 2F2 OS=Rattus norvegicus GN=Cyp2f2 PE=2 SV=1 8 428 1.0E-22
sp|Q9VYQ7|CP311_DROME Probable cytochrome P450 311a1 OS=Drosophila melanogaster GN=Cyp311a1 PE=2 SV=1 7 451 1.0E-22
sp|A6TD49|CYSJ_KLEP7 Sulfite reductase [NADPH] flavoprotein alpha-component OS=Klebsiella pneumoniae subsp. pneumoniae (strain ATCC 700721 / MGH 78578) GN=cysJ PE=3 SV=1 541 1061 1.0E-22
sp|Q9STK8|C71AP_ARATH Cytochrome P450 71A25 OS=Arabidopsis thaliana GN=CYP71A25 PE=2 SV=1 8 432 2.0E-22
sp|Q8AXY5|C356_FUNHE Cytochrome P450 3A56 OS=Fundulus heteroclitus GN=cyp3a56 PE=2 SV=1 7 432 2.0E-22
sp|H1A988|C7254_GLYUR 11-oxo-beta-amyrin 30-oxidase OS=Glycyrrhiza uralensis GN=CYP72A154 PE=1 SV=1 45 451 2.0E-22
sp|Q9MZY0|CP2E1_CANLF Cytochrome P450 2E1 OS=Canis lupus familiaris GN=CYP2E1 PE=2 SV=1 10 436 2.0E-22
sp|P05181|CP2E1_HUMAN Cytochrome P450 2E1 OS=Homo sapiens GN=CYP2E1 PE=1 SV=1 4 435 3.0E-22
sp|P30607|CP52B_CANTR Cytochrome P450 52A2 OS=Candida tropicalis GN=CYP52A2 PE=1 SV=1 85 436 3.0E-22
sp|Q9VA27|CP4C3_DROME Cytochrome P450 4c3 OS=Drosophila melanogaster GN=Cyp4c3 PE=2 SV=1 7 464 3.0E-22
sp|Q9WVK8|CP46A_MOUSE Cholesterol 24-hydroxylase OS=Mus musculus GN=Cyp46a1 PE=1 SV=1 3 449 3.0E-22
sp|P47195|C80A1_BERST Berbamunine synthase OS=Berberis stolonifera GN=CYP80A1 PE=1 SV=1 4 447 4.0E-22
sp|Q4WU59|NDOR1_ASPFU NADPH-dependent diflavin oxidoreductase 1 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=tah18 PE=3 SV=1 491 1036 4.0E-22
sp|Q9K498|EIZFM_STRCO Epi-isozizaene 5-monooxygenase/(E)-beta-farnesene synthase OS=Streptomyces coelicolor (strain ATCC BAA-471 / A3(2) / M145) GN=SCO5223 PE=1 SV=1 9 459 4.0E-22
sp|P10611|CP4A4_RABIT Cytochrome P450 4A4 OS=Oryctolagus cuniculus GN=CYP4A4 PE=1 SV=3 93 451 4.0E-22
sp|Q8N118|CP4X1_HUMAN Cytochrome P450 4X1 OS=Homo sapiens GN=CYP4X1 PE=2 SV=1 93 451 5.0E-22
sp|Q3MID2|CP4F3_RAT Leukotriene-B(4) omega-hydroxylase 2 OS=Rattus norvegicus GN=Cyp4f3 PE=2 SV=1 79 434 5.0E-22
sp|Q43078|C97B1_PEA Cytochrome P450 97B1, chloroplastic OS=Pisum sativum GN=CYP97B1 PE=2 SV=1 37 426 7.0E-22
sp|Q5RBQ1|CP1A2_PONAB Cytochrome P450 1A2 OS=Pongo abelii GN=CYP1A2 PE=2 SV=3 8 432 7.0E-22
sp|Q9PVE8|C330_FUNHE Cytochrome P450 3A30 OS=Fundulus heteroclitus GN=cyp3a30 PE=2 SV=2 7 432 8.0E-22
sp|Q9HB55|CP343_HUMAN Cytochrome P450 3A43 OS=Homo sapiens GN=CYP3A43 PE=1 SV=1 7 430 9.0E-22
sp|A1JJS2|CYSJ_YERE8 Sulfite reductase [NADPH] flavoprotein alpha-component OS=Yersinia enterocolitica serotype O:8 / biotype 1B (strain NCTC 13174 / 8081) GN=cysJ PE=3 SV=1 501 1061 1.0E-21
sp|Q99N16|CP4F3_MOUSE Leukotriene-B(4) omega-hydroxylase 2 OS=Mus musculus GN=Cyp4f3 PE=1 SV=2 85 434 1.0E-21
sp|O77809|CP1A2_MACFA Cytochrome P450 1A2 OS=Macaca fascicularis GN=CYP1A2 PE=1 SV=3 8 432 1.0E-21
sp|P00185|CP1A1_RAT Cytochrome P450 1A1 OS=Rattus norvegicus GN=Cyp1a1 PE=1 SV=1 8 432 1.0E-21
sp|C0SJS3|ANGS_PASSA Angelicin synthase (Fragment) OS=Pastinaca sativa GN=CYP71AJ4 PE=1 SV=1 2 434 1.0E-21
sp|Q42799|C93A2_SOYBN Cytochrome P450 93A2 OS=Glycine max GN=CYP93A2 PE=2 SV=1 8 443 1.0E-21
sp|Q8ZBN6|CYSJ_YERPE Sulfite reductase [NADPH] flavoprotein alpha-component OS=Yersinia pestis GN=cysJ PE=3 SV=1 503 1061 1.0E-21
sp|Q1C3Z0|CYSJ_YERPA Sulfite reductase [NADPH] flavoprotein alpha-component OS=Yersinia pestis bv. Antiqua (strain Antiqua) GN=cysJ PE=3 SV=1 503 1061 1.0E-21
sp|Q98T91|C340_ORYLA Cytochrome P450 3A40 OS=Oryzias latipes GN=cyp3a40 PE=2 SV=1 7 432 1.0E-21
sp|P51871|CP4F6_RAT Cytochrome P450 4F6 OS=Rattus norvegicus GN=Cyp4f6 PE=2 SV=1 85 434 1.0E-21
sp|P20816|CP4A2_RAT Cytochrome P450 4A2 OS=Rattus norvegicus GN=Cyp4a2 PE=1 SV=2 96 451 1.0E-21
sp|Q27593|CP6A8_DROME Cytochrome P450 6a8 OS=Drosophila melanogaster GN=Cyp6a8 PE=2 SV=2 93 452 2.0E-21
sp|Q27520|C13A1_CAEEL Putative cytochrome P450 CYP13A1 OS=Caenorhabditis elegans GN=cyp-13A1 PE=3 SV=1 10 430 2.0E-21
sp|Q9VXY0|CP4S3_DROME Probable cytochrome P450 4s3 OS=Drosophila melanogaster GN=Cyp4s3 PE=3 SV=1 7 430 2.0E-21
sp|Q6GUQ4|CP2E1_MACMU Cytochrome P450 2E1 OS=Macaca mulatta GN=CYP2E1 PE=2 SV=1 4 435 3.0E-21
sp|Q9SAB6|C71AI_ARATH Cytochrome P450 71A18 OS=Arabidopsis thaliana GN=CYP71A18 PE=2 SV=2 4 433 3.0E-21
sp|E9Q816|CP2W1_MOUSE Cytochrome P450 2W1 OS=Mus musculus GN=Cyp2w1 PE=2 SV=1 10 464 3.0E-21
sp|H1A981|C7263_MEDTR 11-oxo-beta-amyrin 30-oxidase OS=Medicago truncatula GN=CYP72A63 PE=1 SV=1 16 451 3.0E-21
sp|P20817|CP4AE_RAT Cytochrome P450 4A14 OS=Rattus norvegicus GN=Cyp4a14 PE=1 SV=2 96 451 3.0E-21
sp|Q75B78|NDOR1_ASHGO NADPH-dependent diflavin oxidoreductase 1 OS=Ashbya gossypii (strain ATCC 10895 / CBS 109.51 / FGSC 9923 / NRRL Y-1056) GN=TAH18 PE=3 SV=1 501 1061 4.0E-21
sp|O77810|CP1A2_CALJA Cytochrome P450 1A2 OS=Callithrix jacchus GN=CYP1A2 PE=2 SV=3 8 462 4.0E-21
sp|Q00557|CP1A1_MESAU Cytochrome P450 1A1 OS=Mesocricetus auratus GN=CYP1A1 PE=2 SV=2 8 432 4.0E-21
sp|P29980|CPXN_NOSS1 Probable cytochrome P450 110 OS=Nostoc sp. (strain PCC 7120 / UTEX 2576) GN=cyp110 PE=3 SV=3 220 432 4.0E-21
sp|Q8SPK1|CP4AO_PIG Cytochrome P450 4A24 OS=Sus scrofa GN=CYP4A24 PE=2 SV=1 7 459 4.0E-21
sp|P08682|CP2E1_RABIT Cytochrome P450 2E1 OS=Oryctolagus cuniculus GN=CYP2E1 PE=2 SV=2 4 435 5.0E-21
sp|O18963|CP2E1_BOVIN Cytochrome P450 2E1 OS=Bos taurus GN=CYP2E1 PE=2 SV=1 10 435 5.0E-21
sp|Q9CA61|C98A8_ARATH Cytochrome P450 98A8 OS=Arabidopsis thaliana GN=CYP98A8 PE=1 SV=1 4 443 6.0E-21
sp|Q6VVW9|CP2R1_MOUSE Vitamin D 25-hydroxylase OS=Mus musculus GN=Cyp2r1 PE=2 SV=1 8 459 6.0E-21
sp|Q64148|CP3AA_MESAU Lithocholate 6-beta-hydroxylase OS=Mesocricetus auratus GN=CYP3A10 PE=1 SV=2 7 451 6.0E-21
sp|Q8VWZ7|C76B6_CATRO Geraniol 8-hydroxylase OS=Catharanthus roseus GN=CYP76B6 PE=1 SV=1 2 433 6.0E-21
sp|P98187|CP4F8_HUMAN Cytochrome P450 4F8 OS=Homo sapiens GN=CYP4F8 PE=1 SV=1 85 428 7.0E-21
sp|Q9LIP6|C71BV_ARATH Cytochrome P450 71B34 OS=Arabidopsis thaliana GN=CYP71B34 PE=2 SV=1 8 451 7.0E-21
sp|P39692|MET10_YEAST Sulfite reductase [NADPH] flavoprotein component OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=MET10 PE=1 SV=2 706 1036 7.0E-21
sp|P33262|CP2CK_MACFA Cytochrome P450 2C20 OS=Macaca fascicularis GN=CYP2C20 PE=2 SV=1 8 449 8.0E-21
sp|A4TPY5|CYSJ_YERPP Sulfite reductase [NADPH] flavoprotein alpha-component OS=Yersinia pestis (strain Pestoides F) GN=cysJ PE=3 SV=1 503 1061 8.0E-21
sp|Q1CLS8|CYSJ_YERPN Sulfite reductase [NADPH] flavoprotein alpha-component OS=Yersinia pestis bv. Antiqua (strain Nepal516) GN=cysJ PE=3 SV=1 503 1061 8.0E-21
sp|P10632|CP2C8_HUMAN Cytochrome P450 2C8 OS=Homo sapiens GN=CYP2C8 PE=1 SV=2 8 434 1.0E-20
sp|P33263|CP2CQ_MESAU Cytochrome P450 2C26 OS=Mesocricetus auratus GN=CYP2C26 PE=2 SV=1 8 428 1.0E-20
sp|P51870|CP4F5_RAT Cytochrome P450 4F5 OS=Rattus norvegicus GN=Cyp4f5 PE=2 SV=1 85 434 1.0E-20
sp|A7FLZ0|CYSJ_YERP3 Sulfite reductase [NADPH] flavoprotein alpha-component OS=Yersinia pseudotuberculosis serotype O:1b (strain IP 31758) GN=cysJ PE=3 SV=1 503 1061 1.0E-20
sp|P11712|CP2C9_HUMAN Cytochrome P450 2C9 OS=Homo sapiens GN=CYP2C9 PE=1 SV=3 8 435 1.0E-20
sp|Q9JUD8|CYSJ_NEIMA Sulfite reductase [NADPH] flavoprotein alpha-component OS=Neisseria meningitidis serogroup A / serotype 4A (strain Z2491) GN=cysJ PE=3 SV=1 682 1061 2.0E-20
sp|Q55AJ4|C516B_DICDI Probable cytochrome P450 516B1 OS=Dictyostelium discoideum GN=cyp516B1 PE=3 SV=1 10 431 2.0E-20
sp|Q6WNQ8|C81E8_MEDTR Cytochrome P450 81E8 OS=Medicago truncatula GN=CYP81E8 PE=2 SV=1 3 430 2.0E-20
sp|Q968X7|PNO_CRYPV Pyruvate dehydrogenase [NADP(+)] OS=Cryptosporidium parvum GN=PFOR PE=2 SV=1 450 1020 2.0E-20
sp|Q4H4C3|CP1A2_MACFU Cytochrome P450 1A2 OS=Macaca fuscata fuscata GN=CYP1A2 PE=2 SV=3 8 432 2.0E-20
sp|O35728|CP4AE_MOUSE Cytochrome P450 4A14 OS=Mus musculus GN=Cyp4a14 PE=1 SV=1 97 451 2.0E-20
sp|Q64409|CP3AH_CAVPO Cytochrome P450 3A17 OS=Cavia porcellus GN=CYP3A17 PE=2 SV=1 7 430 2.0E-20
sp|Q42798|C93A1_SOYBN 3,9-dihydroxypterocarpan 6A-monooxygenase OS=Glycine max GN=CYP93A1 PE=1 SV=1 3 443 2.0E-20
sp|P78329|CP4F2_HUMAN Phylloquinone omega-hydroxylase CYP4F2 OS=Homo sapiens GN=CYP4F2 PE=1 SV=1 30 429 2.0E-20
sp|Q27902|CP6B4_PAPGL Cytochrome P450 6B4 OS=Papilio glaucus GN=CYP6B4 PE=2 SV=1 81 430 2.0E-20
sp|P00176|CP2B1_RAT Cytochrome P450 2B1 OS=Rattus norvegicus GN=Cyp2b1 PE=1 SV=1 194 431 3.0E-20
sp|Q6Z6D6|C7342_ORYSJ Cytochrome P450 734A2 OS=Oryza sativa subsp. japonica GN=CYP734A2 PE=2 SV=1 37 437 3.0E-20
sp|P12790|CP2B9_MOUSE Cytochrome P450 2B9 OS=Mus musculus GN=Cyp2b9 PE=1 SV=2 26 429 3.0E-20
sp|Q9GJX5|CP4AL_PIG Taurochenodeoxycholic 6 alpha-hydroxylase OS=Sus scrofa GN=CYP4A21 PE=1 SV=1 8 459 3.0E-20
sp|Q8SPK0|CP4AP_PIG Cytochrome P450 4A25 OS=Sus scrofa GN=CYP4A25 PE=2 SV=1 7 433 3.0E-20
sp|Q5AD27|NDOR1_CANAL NADPH-dependent diflavin oxidoreductase 1 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=TAH18 PE=3 SV=1 501 1017 3.0E-20
sp|Q9V770|C6A17_DROME Probable cytochrome P450 6a17 OS=Drosophila melanogaster GN=Cyp6a17 PE=2 SV=1 97 456 3.0E-20
sp|P33261|CP2CJ_HUMAN Cytochrome P450 2C19 OS=Homo sapiens GN=CYP2C19 PE=1 SV=3 8 435 4.0E-20
sp|P00178|CP2B4_RABIT Cytochrome P450 2B4 OS=Oryctolagus cuniculus GN=CYP2B4 PE=1 SV=1 8 431 4.0E-20
sp|P37122|C76A2_SOLME Cytochrome P450 76A2 OS=Solanum melongena GN=CYP76A2 PE=2 SV=1 8 458 4.0E-20
sp|A9MF16|CYSJ_SALAR Sulfite reductase [NADPH] flavoprotein alpha-component OS=Salmonella arizonae (strain ATCC BAA-731 / CDC346-86 / RSK2980) GN=cysJ PE=3 SV=1 549 1061 4.0E-20
sp|Q66ED4|CYSJ_YERPS Sulfite reductase [NADPH] flavoprotein alpha-component OS=Yersinia pseudotuberculosis serotype I (strain IP32953) GN=cysJ PE=3 SV=1 503 1061 4.0E-20
sp|Q9FF18|C7351_ARATH Cytokinin hydroxylase OS=Arabidopsis thaliana GN=CYP735A1 PE=1 SV=1 1 450 4.0E-20
sp|P56590|CP1A1_CANLF Cytochrome P450 1A1 OS=Canis lupus familiaris GN=CYP1A1 PE=2 SV=1 8 432 4.0E-20
sp|Q9T0K2|C71AK_ARATH Cytochrome P450 71A20 OS=Arabidopsis thaliana GN=CYP71A20 PE=2 SV=2 4 433 5.0E-20
sp|Q9T0K0|C71AJ_ARATH Cytochrome P450 71A19 OS=Arabidopsis thaliana GN=CYP71A19 PE=2 SV=1 4 433 5.0E-20
sp|Q7Z449|CP2U1_HUMAN Cytochrome P450 2U1 OS=Homo sapiens GN=CYP2U1 PE=1 SV=1 2 459 5.0E-20
sp|P0CP12|NDOR1_CRYNJ NADPH-dependent diflavin oxidoreductase 1 OS=Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565) GN=TAH18 PE=3 SV=1 503 1055 6.0E-20
sp|P0CP13|NDOR1_CRYNB NADPH-dependent diflavin oxidoreductase 1 OS=Cryptococcus neoformans var. neoformans serotype D (strain B-3501A) GN=TAH18 PE=3 SV=1 503 1055 6.0E-20
sp|Q95036|CP6B5_PAPGL Cytochrome P450 6B5 (Fragment) OS=Papilio glaucus GN=CYP6B5 PE=2 SV=1 81 430 6.0E-20
sp|Q6CVG8|NDOR1_KLULA NADPH-dependent diflavin oxidoreductase 1 OS=Kluyveromyces lactis (strain ATCC 8585 / CBS 2359 / DSM 70799 / NBRC 1267 / NRRL Y-1140 / WM37) GN=TAH18 PE=3 SV=1 498 1061 6.0E-20
sp|P56656|CP239_MOUSE Cytochrome P450 2C39 OS=Mus musculus GN=Cyp2c39 PE=1 SV=2 8 428 6.0E-20
sp|P56592|CP1A2_CANLF Cytochrome P450 1A2 OS=Canis lupus familiaris GN=CYP1A2 PE=1 SV=2 8 432 7.0E-20
sp|Q1ZXF5|C5084_DICDI Probable cytochrome P450 508A4 OS=Dictyostelium discoideum GN=cyp508A4 PE=3 SV=1 10 450 7.0E-20
sp|Q27515|C13A6_CAEEL Putative cytochrome P450 CYP13A6 OS=Caenorhabditis elegans GN=cyp-13A6 PE=3 SV=1 7 459 7.0E-20
sp|O73853|CP17A_ICTPU Steroid 17-alpha-hydroxylase/17,20 lyase OS=Ictalurus punctatus GN=cyp17a1 PE=2 SV=1 8 459 7.0E-20
sp|Q9V4U9|C6A13_DROME Probable cytochrome P450 6a13 OS=Drosophila melanogaster GN=Cyp6a13 PE=2 SV=1 91 454 8.0E-20
sp|Q59990|CP120_SYNY3 Putative cytochrome P450 120 OS=Synechocystis sp. (strain PCC 6803 / Kazusa) GN=cyp120 PE=1 SV=1 219 462 9.0E-20
sp|P19225|CP270_RAT Cytochrome P450 2C70 OS=Rattus norvegicus GN=Cyp2c70 PE=2 SV=1 8 430 9.0E-20
sp|O88833|CP4AA_MOUSE Cytochrome P450 4A10 OS=Mus musculus GN=Cyp4a10 PE=2 SV=2 97 451 9.0E-20
sp|P16496|CP52C_CANMA Cytochrome P450 52A3-A OS=Candida maltosa GN=CYP52A3-A PE=1 SV=3 85 461 1.0E-19
sp|Q27594|CP6A9_DROME Cytochrome P450 6a9 OS=Drosophila melanogaster GN=Cyp6a9 PE=2 SV=3 93 432 1.0E-19
sp|Q64583|CP2BF_RAT Cytochrome P450 2B15 OS=Rattus norvegicus GN=Cyp2b15 PE=3 SV=2 8 431 1.0E-19
sp|P30437|CP17A_ONCMY Steroid 17-alpha-hydroxylase/17,20 lyase OS=Oncorhynchus mykiss GN=cyp17a1 PE=2 SV=1 8 468 1.0E-19
sp|Q9HCS2|CP4FC_HUMAN Cytochrome P450 4F12 OS=Homo sapiens GN=CYP4F12 PE=1 SV=2 7 447 1.0E-19
sp|C0SJS2|C71AJ_PASSA Psoralen synthase (Fragment) OS=Pastinaca sativa GN=CYP71AJ3 PE=1 SV=1 2 434 2.0E-19
sp|Q9HBI6|CP4FB_HUMAN Phylloquinone omega-hydroxylase CYP4F11 OS=Homo sapiens GN=CYP4F11 PE=1 SV=3 96 428 2.0E-19
sp|Q4V8D1|CP2U1_RAT Cytochrome P450 2U1 OS=Rattus norvegicus GN=Cyp2u1 PE=1 SV=1 2 459 2.0E-19
sp|Q9ZW95|C7352_ARATH Cytokinin hydroxylase OS=Arabidopsis thaliana GN=CYP735A2 PE=1 SV=1 34 450 2.0E-19
sp|O48922|C98A2_SOYBN Cytochrome P450 98A2 OS=Glycine max GN=CYP98A2 PE=2 SV=1 8 431 2.0E-19
sp|Q93Z79|C14A1_ARATH Cytochrome P450 714A1 OS=Arabidopsis thaliana GN=CYP714A1 PE=2 SV=1 21 460 2.0E-19
sp|Q64458|CP2CT_MOUSE Cytochrome P450 2C29 OS=Mus musculus GN=Cyp2c29 PE=1 SV=2 8 428 2.0E-19
sp|P14580|CP4A6_RABIT Cytochrome P450 4A6 OS=Oryctolagus cuniculus GN=CYP4A6 PE=1 SV=1 96 459 2.0E-19
sp|P00181|CP2C2_RABIT Cytochrome P450 2C2 OS=Oryctolagus cuniculus GN=CYP2C2 PE=1 SV=2 8 428 2.0E-19
sp|O54749|CP2J5_MOUSE Cytochrome P450 2J5 OS=Mus musculus GN=Cyp2j5 PE=1 SV=1 3 456 2.0E-19
sp|O18809|CP2F3_CAPHI Cytochrome P450 2F3 OS=Capra hircus GN=CYP2F3 PE=2 SV=1 8 430 2.0E-19
sp|P00184|CP1A1_MOUSE Cytochrome P450 1A1 OS=Mus musculus GN=Cyp1a1 PE=1 SV=2 200 432 3.0E-19
sp|P10615|CP52A_CANTR Cytochrome P450 52A1 OS=Candida tropicalis GN=CYP52A1 PE=1 SV=3 85 447 3.0E-19
sp|P14579|CP4A5_RABIT Cytochrome P450 4A5 OS=Oryctolagus cuniculus GN=CYP4A5 PE=2 SV=1 97 451 3.0E-19
sp|Q8K4D6|CP4X1_RAT Cytochrome P450 4X1 OS=Rattus norvegicus GN=Cyp4x1 PE=2 SV=1 93 433 3.0E-19
sp|P24461|CP2G1_RABIT Cytochrome P450 2G1 OS=Oryctolagus cuniculus GN=CYP2G1 PE=1 SV=1 8 429 3.0E-19
sp|Q9VG40|CP134_DROME Probable cytochrome P450 313a4 OS=Drosophila melanogaster GN=Cyp313a4 PE=2 SV=4 7 451 3.0E-19
sp|Q86W10|CP4Z1_HUMAN Cytochrome P450 4Z1 OS=Homo sapiens GN=CYP4Z1 PE=2 SV=1 86 433 3.0E-19
sp|Q9LUC9|C7A11_ARATH Cytochrome P450 72A11 OS=Arabidopsis thaliana GN=CYP72A11 PE=2 SV=1 11 450 3.0E-19
sp|O46054|C4AE1_DROME Cytochrome P450 4ae1 OS=Drosophila melanogaster GN=Cyp4ae1 PE=2 SV=1 73 416 3.0E-19
sp|Q5KQT7|CP1A1_FELCA Cytochrome P450 1A1 OS=Felis catus GN=CYP1A1 PE=2 SV=1 8 432 3.0E-19
sp|P12394|CP17A_CHICK Steroid 17-alpha-hydroxylase/17,20 lyase OS=Gallus gallus GN=CYP17A1 PE=2 SV=1 11 459 3.0E-19
sp|Q9LUC6|C7A14_ARATH Cytochrome P450 72A14 OS=Arabidopsis thaliana GN=CYP72A14 PE=2 SV=1 32 450 3.0E-19
sp|Q4HZQ1|NDOR1_GIBZE NADPH-dependent diflavin oxidoreductase 1 OS=Gibberella zeae (strain PH-1 / ATCC MYA-4620 / FGSC 9075 / NRRL 31084) GN=TAH18 PE=3 SV=2 495 1051 4.0E-19
sp|Q9V773|C6A20_DROME Probable cytochrome P450 6a20 OS=Drosophila melanogaster GN=Cyp6a20 PE=2 SV=2 9 432 4.0E-19
sp|Q96581|C75A4_GENTR Flavonoid 3',5'-hydroxylase OS=Gentiana triflora GN=CYP75A4 PE=2 SV=1 221 447 4.0E-19
sp|O48956|C98A1_SORBI Cytochrome P450 98A1 OS=Sorghum bicolor GN=CYP98A1 PE=2 SV=1 8 434 4.0E-19
sp|P17666|CP2CE_RABIT Cytochrome P450 2C14 OS=Oryctolagus cuniculus GN=CYP2C14 PE=2 SV=1 8 435 4.0E-19
sp|Q91WL5|CP4CA_MOUSE Cytochrome P450 4A12A OS=Mus musculus GN=Cyp4a12a PE=1 SV=2 7 451 4.0E-19
sp|P79383|CP2E1_PIG Cytochrome P450 2E1 OS=Sus scrofa GN=CYP2E1 PE=2 SV=1 10 435 4.0E-19
sp|P24470|CP2CN_RAT Cytochrome P450 2C23 OS=Rattus norvegicus GN=Cyp2c23 PE=2 SV=2 8 430 5.0E-19
sp|Q9Y757|CP52L_DEBHN Cytochrome P450 52A12 OS=Debaryomyces hansenii GN=CYP52A12 PE=2 SV=2 71 437 5.0E-19
sp|Q5IZM4|CP51_MYCVP Lanosterol 14-alpha demethylase OS=Mycobacterium vanbaalenii (strain DSM 7251 / PYR-1) GN=cyp51 PE=3 SV=1 218 435 6.0E-19
sp|B9DFU2|MAX1_ARATH Cytochrome P450 711A1 OS=Arabidopsis thaliana GN=CYP711A1 PE=2 SV=1 7 430 6.0E-19
sp|P24465|C71A1_PERAE Cytochrome P450 71A1 OS=Persea americana GN=CYP71A1 PE=1 SV=2 15 432 6.0E-19
sp|Q08078|CP2CP_MESAU Cytochrome P450 2C25 OS=Mesocricetus auratus GN=CYP2C25 PE=2 SV=1 8 428 6.0E-19
sp|Q9VFJ0|CA131_DROME Probable cytochrome P450 313a1 OS=Drosophila melanogaster GN=Cyp313a1 PE=3 SV=2 7 448 7.0E-19
sp|O16805|CP4D1_DROSI Cytochrome P450 4d1 OS=Drosophila simulans GN=Cyp4d1 PE=3 SV=1 7 428 8.0E-19
sp|P56654|CP237_MOUSE Cytochrome P450 2C37 OS=Mus musculus GN=Cyp2c37 PE=1 SV=2 8 430 8.0E-19
sp|P08516|CP4AA_RAT Cytochrome P450 4A10 OS=Rattus norvegicus GN=Cyp4a10 PE=1 SV=2 97 451 9.0E-19
sp|Q12581|CP52X_CANMA Cytochrome P450 52A5 OS=Candida maltosa GN=CYP52A5 PE=1 SV=1 259 436 1.0E-18
sp|P00187|CP1A2_RABIT Cytochrome P450 1A2 OS=Oryctolagus cuniculus GN=CYP1A2 PE=1 SV=3 7 432 1.0E-18
sp|O49342|C71AD_ARATH Indoleacetaldoxime dehydratase OS=Arabidopsis thaliana GN=CYP71A13 PE=1 SV=1 4 433 1.0E-18
sp|Q9V771|C6A23_DROME Probable cytochrome P450 6a23 OS=Drosophila melanogaster GN=Cyp6a23 PE=2 SV=2 97 432 1.0E-18
sp|Q82IY3|PTLI_STRAW Pentalenene oxygenase OS=Streptomyces avermitilis (strain ATCC 31267 / DSM 46492 / JCM 5070 / NBRC 14893 / NCIMB 12804 / NRRL 8165 / MA-4680) GN=ptlI PE=1 SV=1 10 433 1.0E-18
sp|P13107|CP2B3_RAT Cytochrome P450 2B3 OS=Rattus norvegicus GN=Cyp2b3 PE=2 SV=1 200 450 1.0E-18
sp|Q02928|CP4AB_HUMAN Cytochrome P450 4A11 OS=Homo sapiens GN=CYP4A11 PE=1 SV=1 96 471 1.0E-18
sp|P24464|CP4AC_RAT Cytochrome P450 4A12 OS=Rattus norvegicus GN=Cyp4a12 PE=2 SV=2 96 451 1.0E-18
sp|P04167|CP2B2_RAT Cytochrome P450 2B2 OS=Rattus norvegicus GN=Cyp2b2 PE=1 SV=2 194 431 1.0E-18
sp|P56594|CP2CL_CANLF Cytochrome P450 2C21 (Fragment) OS=Canis lupus familiaris GN=CYP2C21 PE=2 SV=2 8 435 1.0E-18
sp|C0SJS4|C71AJ_APIGR Psoralen synthase (Fragment) OS=Apium graveolens GN=CYP71AJ2 PE=1 SV=1 2 434 1.0E-18
sp|Q9LTM6|C71BH_ARATH Cytochrome P450 71B17 OS=Arabidopsis thaliana GN=CYP71B17 PE=3 SV=1 4 447 1.0E-18
sp|Q964R1|CP6J1_BLAGE Cytochrome P450 6j1 OS=Blattella germanica GN=CYP6J1 PE=2 SV=1 13 456 2.0E-18
sp|P05176|CP1A1_RABIT Cytochrome P450 1A1 OS=Oryctolagus cuniculus GN=CYP1A1 PE=2 SV=1 7 432 2.0E-18
sp|Q50EK4|C75A1_PINTA Cytochrome P450 750A1 OS=Pinus taeda GN=CYP750A1 PE=2 SV=1 233 448 2.0E-18
sp|P9WPM1|CP139_MYCTU Putative cytochrome P450 139 OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=cyp139 PE=1 SV=1 199 459 2.0E-18
sp|P9WPM0|CP139_MYCTO Putative cytochrome P450 139 OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) GN=cyp139 PE=3 SV=1 199 459 2.0E-18
sp|P63720|CP139_MYCBO Putative cytochrome P450 139 OS=Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97) GN=cyp139 PE=3 SV=1 199 459 2.0E-18
sp|Q08477|CP4F3_HUMAN Docosahexaenoic acid omega-hydroxylase CYP4F3 OS=Homo sapiens GN=CYP4F3 PE=1 SV=2 79 429 2.0E-18
sp|Q9LTM3|C71BK_ARATH Cytochrome P450 71B20 OS=Arabidopsis thaliana GN=CYP71B20 PE=2 SV=1 4 447 2.0E-18
sp|P33269|CP4D1_DROME Cytochrome P450 4d1 OS=Drosophila melanogaster GN=Cyp4d1 PE=2 SV=2 7 455 2.0E-18
sp|P9WPN1|C135A_MYCTU Putative cytochrome P450 135A1 OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=cyp135A1 PE=1 SV=1 37 436 2.0E-18
sp|P9WPN0|C135A_MYCTO Putative cytochrome P450 135A1 OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) GN=cyp135A1 PE=3 SV=1 37 436 2.0E-18
sp|P15129|CP4B1_RAT Cytochrome P450 4B1 OS=Rattus norvegicus GN=Cyp4b1 PE=1 SV=3 93 451 3.0E-18
sp|Q09653|C13AA_CAEEL Putative cytochrome P450 CYP13A10 OS=Caenorhabditis elegans GN=cyp-13A10 PE=3 SV=3 7 432 3.0E-18
sp|Q9LUC5|C7A15_ARATH Cytochrome P450 72A15 OS=Arabidopsis thaliana GN=CYP72A15 PE=2 SV=1 11 450 3.0E-18
sp|Q9LVD2|C71BA_ARATH Cytochrome P450 71B10 OS=Arabidopsis thaliana GN=CYP71B10 PE=3 SV=1 8 432 3.0E-18
sp|Q0IIF9|CP2U1_BOVIN Cytochrome P450 2U1 OS=Bos taurus GN=CYP2U1 PE=2 SV=1 209 459 4.0E-18
sp|P9WPM5|CP137_MYCTU Putative cytochrome P450 137 OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=cyp137 PE=1 SV=1 221 451 4.0E-18
sp|P9WPM4|CP137_MYCTO Putative cytochrome P450 137 OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) GN=cyp137 PE=3 SV=1 221 451 4.0E-18
sp|Q6GUR1|CP1A1_MACMU Cytochrome P450 1A1 OS=Macaca mulatta GN=CYP1A1 PE=2 SV=1 8 432 4.0E-18
sp|P16141|CP52D_CANMA Cytochrome P450 52A4 OS=Candida maltosa GN=CYP52A4 PE=1 SV=4 85 447 4.0E-18
sp|P24458|CP52E_CANMA Cytochrome P450 52A3-B OS=Candida maltosa GN=CYP52A3-B PE=1 SV=1 259 461 4.0E-18
sp|O46051|C4D14_DROME Probable cytochrome P450 4d14 OS=Drosophila melanogaster GN=Cyp4d14 PE=3 SV=1 10 430 4.0E-18
sp|Q9D816|CP255_MOUSE Cytochrome P450 2C55 OS=Mus musculus GN=Cyp2c55 PE=1 SV=1 8 429 4.0E-18
sp|P27786|CP17A_MOUSE Steroid 17-alpha-hydroxylase/17,20 lyase OS=Mus musculus GN=Cyp17a1 PE=1 SV=1 11 469 5.0E-18
sp|Q3LFT9|CP1A2_BALAC Cytochrome P450 1A2 OS=Balaenoptera acutorostrata GN=CYP1A2 PE=2 SV=3 8 459 5.0E-18
sp|Q6XQ14|C71E7_MANES 2-methylbutanal oxime monooxygenase OS=Manihot esculenta GN=CYP71E7 PE=1 SV=1 8 409 5.0E-18
sp|O49858|C82A3_SOYBN Cytochrome P450 82A3 OS=Glycine max GN=CYP82A3 PE=2 SV=1 14 430 5.0E-18
sp|Q5Z5S6|C7019_ORYSJ Ent-kaurene oxidase-like 5 OS=Oryza sativa subsp. japonica GN=CYP701A9 PE=2 SV=1 4 432 5.0E-18
sp|Q6A152|CP4X1_MOUSE Cytochrome P450 4X1 OS=Mus musculus GN=Cyp4x1 PE=1 SV=1 93 433 6.0E-18
sp|P33273|CP255_RAT Cytochrome P450 2C55 OS=Rattus norvegicus GN=Cyp2c55 PE=2 SV=2 8 430 6.0E-18
sp|Q09878|MET10_SCHPO Probable sulfite reductase [NADPH] flavoprotein component OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPCC584.01c PE=3 SV=2 518 1016 6.0E-18
sp|Q69XM6|C7344_ORYSJ Cytochrome P450 734A4 OS=Oryza sativa subsp. japonica GN=CYP734A4 PE=2 SV=1 1 441 6.0E-18
sp|Q9CX98|CP2U1_MOUSE Cytochrome P450 2U1 OS=Mus musculus GN=Cyp2u1 PE=2 SV=2 8 459 6.0E-18
sp|P93147|C81E1_GLYEC Isoflavone 2'-hydroxylase OS=Glycyrrhiza echinata GN=CYP81E1 PE=1 SV=2 3 432 7.0E-18
sp|Q556M5|C5081_DICDI Probable cytochrome P450 508A1 OS=Dictyostelium discoideum GN=cyp508A1-1 PE=3 SV=1 10 459 7.0E-18
sp|O57525|CP17A_RANDY Steroid 17-alpha-hydroxylase/17,20 lyase OS=Rana dybowskii GN=CYP17A1 PE=2 SV=1 11 459 7.0E-18
sp|P00179|CP2C5_RABIT Cytochrome P450 2C5 OS=Oryctolagus cuniculus GN=CYP2C5 PE=1 SV=2 8 435 7.0E-18
sp|P56655|CP238_MOUSE Cytochrome P450 2C38 OS=Mus musculus GN=Cyp2c38 PE=2 SV=2 8 428 8.0E-18
sp|P08683|CP2CB_RAT Cytochrome P450 2C11 OS=Rattus norvegicus GN=Cyp2c11 PE=1 SV=1 8 429 8.0E-18
sp|F8S1H3|C7BL1_HELAN Cytochrome P450 71BL1 OS=Helianthus annuus GN=CYP71BL1 PE=2 SV=1 3 434 8.0E-18
sp|P33616|CP1A1_MACFA Cytochrome P450 1A1 OS=Macaca fascicularis GN=CYP1A1 PE=2 SV=1 8 432 8.0E-18
sp|Q54DT2|C516A_DICDI Probable cytochrome P450 516A1 OS=Dictyostelium discoideum GN=cyp516A1 PE=3 SV=2 8 430 9.0E-18
sp|O04790|C75A7_EUSER Flavonoid 3',5'-hydroxylase OS=Eustoma exaltatum subsp. russellianum GN=CYP75A7 PE=2 SV=1 221 447 9.0E-18
sp|D1MI46|C76BA_SWEMU Geraniol 8-hydroxylase OS=Swertia mussotii GN=CYP76B10 PE=1 SV=1 16 433 1.0E-17
sp|P30610|CP52H_CANTR Cytochrome P450 52A8 OS=Candida tropicalis GN=CYP52A8 PE=2 SV=1 85 429 1.0E-17
sp|P37120|C75A2_SOLME Flavonoid 3',5'-hydroxylase OS=Solanum melongena GN=CYP75A2 PE=2 SV=1 221 447 1.0E-17
sp|O81972|C82A2_SOYBN Cytochrome P450 82A2 OS=Glycine max GN=CYP82A2 PE=2 SV=1 14 428 1.0E-17
sp|P56591|CP1A1_SHEEP Cytochrome P450 1A1 OS=Ovis aries GN=CYP1A1 PE=2 SV=1 8 432 1.0E-17
sp|Q3LFU0|CP1A1_BALAC Cytochrome P450 1A1 OS=Balaenoptera acutorostrata GN=CYP1A1 PE=2 SV=1 8 430 1.0E-17
sp|Q8WNE1|CP2F5_GORGO Cytochrome P450 2F5 OS=Gorilla gorilla gorilla GN=CYP2F5 PE=3 SV=2 204 430 1.0E-17
sp|P00180|CP2C1_RABIT Cytochrome P450 2C1 OS=Oryctolagus cuniculus GN=CYP2C1 PE=1 SV=2 8 428 1.0E-17
sp|O61387|CP6B7_HELAM Cytochrome P450 6B7 OS=Helicoverpa armigera GN=CYP6B7 PE=2 SV=1 4 467 1.0E-17
sp|Q27516|C13A8_CAEEL Putative cytochrome P450 CYP13A8 OS=Caenorhabditis elegans GN=cyp-13A8 PE=3 SV=2 7 430 1.0E-17
sp|Q96418|C75A5_EUSER Flavonoid 3',5'-hydroxylase OS=Eustoma exaltatum subsp. russellianum GN=CYP75A5 PE=2 SV=1 221 447 2.0E-17
sp|Q5BB41|NDOR1_EMENI NADPH-dependent diflavin oxidoreductase 1 OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=tah18 PE=3 SV=3 503 1028 2.0E-17
sp|P33260|CP2CI_HUMAN Cytochrome P450 2C18 OS=Homo sapiens GN=CYP2C18 PE=1 SV=3 10 430 2.0E-17
sp|D5JBW9|GAO_SAUCO Germacrene A oxidase OS=Saussurea costus PE=1 SV=1 7 438 2.0E-17
sp|Q9LTM4|C71BJ_ARATH Cytochrome P450 71B19 OS=Arabidopsis thaliana GN=CYP71B19 PE=2 SV=1 4 447 2.0E-17
sp|Q9FMY1|C86B1_ARATH Cytochrome P450 86B1 OS=Arabidopsis thaliana GN=CYP86B1 PE=2 SV=1 65 416 2.0E-17
sp|P9WPP9|CP51_MYCTU Lanosterol 14-alpha demethylase OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=cyp51 PE=1 SV=1 87 435 2.0E-17
sp|P9WPP8|CP51_MYCTO Lanosterol 14-alpha demethylase OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) GN=cyp51 PE=3 SV=1 87 435 2.0E-17
sp|P0A513|CP51_MYCBO Lanosterol 14-alpha demethylase OS=Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97) GN=cyp51 PE=3 SV=1 87 435 2.0E-17
sp|O81970|C71A9_SOYBN Cytochrome P450 71A9 OS=Glycine max GN=CYP71A9 PE=2 SV=1 8 432 2.0E-17
sp|Q06367|CP1A1_CAVPO Cytochrome P450 1A1 OS=Cavia porcellus GN=CYP1A1 PE=1 SV=1 8 431 2.0E-17
sp|P58046|C71AF_ARATH Cytochrome P450 71A15 OS=Arabidopsis thaliana GN=CYP71A15 PE=3 SV=1 3 433 2.0E-17
sp|O04164|C71A6_NEPRA Cytochrome P450 71A6 (Fragment) OS=Nepeta racemosa GN=CYP71A6 PE=2 SV=1 15 436 2.0E-17
sp|O81973|C93A3_SOYBN Cytochrome P450 93A3 OS=Glycine max GN=CYP93A3 PE=2 SV=1 15 443 2.0E-17
sp|Q95031|CP6B6_HELAM Cytochrome P450 6B6 OS=Helicoverpa armigera GN=CYP6B6 PE=2 SV=1 80 467 2.0E-17
sp|Q27514|C13A5_CAEEL Putative cytochrome P450 CYP13A5 OS=Caenorhabditis elegans GN=cyp-13A5 PE=3 SV=1 10 461 2.0E-17
sp|P24460|CP2BB_CANLF Cytochrome P450 2B11 OS=Canis lupus familiaris GN=CYP2B11 PE=2 SV=1 228 429 2.0E-17
sp|P12789|CP2B5_RABIT Cytochrome P450 2B5 OS=Oryctolagus cuniculus GN=CYP2B5 PE=2 SV=1 196 431 2.0E-17
sp|Q64391|CP1A2_CAVPO Cytochrome P450 1A2 OS=Cavia porcellus GN=CYP1A2 PE=2 SV=1 8 449 2.0E-17
sp|P37118|C71A2_SOLME Cytochrome P450 71A2 OS=Solanum melongena GN=CYP71A2 PE=2 SV=1 7 432 3.0E-17
sp|P51590|CP2J3_RAT Cytochrome P450 2J3 OS=Rattus norvegicus GN=Cyp2j3 PE=2 SV=1 3 430 3.0E-17
sp|H2DH18|C7A12_PANGI Cytochrome P450 CYP736A12 OS=Panax ginseng PE=2 SV=1 8 436 3.0E-17
sp|Q04552|CP6B1_PAPPO Cytochrome P450 6B1 OS=Papilio polyxenes GN=CYP6B1 PE=1 SV=1 199 424 3.0E-17
sp|P17549|CP53_ASPNG Benzoate 4-monooxygenase OS=Aspergillus niger GN=bphA PE=1 SV=1 232 454 3.0E-17
sp|O64636|C76C1_ARATH Cytochrome P450 76C1 OS=Arabidopsis thaliana GN=CYP76C1 PE=2 SV=1 223 432 3.0E-17
sp|Q91W64|CP270_MOUSE Cytochrome P450 2C70 OS=Mus musculus GN=Cyp2c70 PE=1 SV=2 8 430 3.0E-17
sp|P24453|CP1A2_MESAU Cytochrome P450 1A2 OS=Mesocricetus auratus GN=CYP1A2 PE=1 SV=4 8 450 3.0E-17
sp|B6SSW8|C14B3_MAIZE Cytochrome P450 714B3 OS=Zea mays GN=CYP714B3 PE=2 SV=1 37 450 3.0E-17
sp|P30608|CP52F_CANTR Cytochrome P450 52A6 OS=Candida tropicalis GN=CYP52A6 PE=2 SV=1 259 428 3.0E-17
sp|P47787|THAS_PIG Thromboxane-A synthase OS=Sus scrofa GN=TBXAS1 PE=2 SV=1 3 451 4.0E-17
sp|O42430|CP1A1_LIMLI Cytochrome P450 1A1 OS=Limanda limanda GN=cyp1a1 PE=2 SV=1 7 459 4.0E-17
sp|P12791|CP2BA_MOUSE Cytochrome P450 2B10 OS=Mus musculus GN=Cyp2b10 PE=1 SV=1 229 429 4.0E-17
sp|O64718|C71B9_ARATH Cytochrome P450 71B9 OS=Arabidopsis thaliana GN=CYP71B9 PE=2 SV=3 8 434 4.0E-17
sp|P24557|THAS_HUMAN Thromboxane-A synthase OS=Homo sapiens GN=TBXAS1 PE=1 SV=3 3 451 4.0E-17
sp|Q0DBF4|C7018_ORYSJ Ent-sandaracopimaradiene 3-hydroxylase OS=Oryza sativa subsp. japonica GN=CYP701A8 PE=1 SV=1 6 432 4.0E-17
sp|Q64462|CP4B1_MOUSE Cytochrome P450 4B1 OS=Mus musculus GN=Cyp4b1 PE=1 SV=1 149 451 4.0E-17
sp|B9G934|C14C3_ORYSJ Cytochrome P450 714C3 OS=Oryza sativa subsp. japonica GN=CYP714C3 PE=3 SV=2 22 449 4.0E-17
sp|Q54SK0|C508B_DICDI Probable cytochrome P450 508B1 OS=Dictyostelium discoideum GN=cyp508B1 PE=3 SV=1 10 454 5.0E-17
sp|Q92109|CP1A3_ONCMY Cytochrome P450 1A3 OS=Oncorhynchus mykiss GN=cyp1a3 PE=2 SV=2 7 459 5.0E-17
sp|Q5TCH4|CP4AM_HUMAN Cytochrome P450 4A22 OS=Homo sapiens GN=CYP4A22 PE=1 SV=1 96 471 5.0E-17
sp|P36423|THAS_MOUSE Thromboxane-A synthase OS=Mus musculus GN=Tbxas1 PE=1 SV=2 3 451 5.0E-17
sp|O62671|CP241_CANLF Cytochrome P450 2C41 OS=Canis lupus familiaris GN=CYP2C41 PE=2 SV=1 8 435 5.0E-17
sp|Q9STL1|C71AM_ARATH Cytochrome P450 71A22 OS=Arabidopsis thaliana GN=CYP71A22 PE=2 SV=1 10 442 5.0E-17
sp|Q9LIP4|C71BX_ARATH Cytochrome P450 71B36 OS=Arabidopsis thaliana GN=CYP71B36 PE=3 SV=1 8 407 5.0E-17
sp|O65782|C83B1_ARATH Cytochrome P450 83B1 OS=Arabidopsis thaliana GN=CYP83B1 PE=1 SV=1 8 432 5.0E-17
sp|Q8TAV3|CP2W1_HUMAN Cytochrome P450 2W1 OS=Homo sapiens GN=CYP2W1 PE=1 SV=2 8 430 5.0E-17
sp|P37121|C76A1_SOLME Cytochrome P450 76A1 (Fragment) OS=Solanum melongena GN=CYP76A1 PE=2 SV=1 198 458 6.0E-17
sp|Q64441|CP24A_MOUSE 1,25-dihydroxyvitamin D(3) 24-hydroxylase, mitochondrial OS=Mus musculus GN=Cyp24a1 PE=2 SV=1 7 434 6.0E-17
sp|P9WPM3|CP138_MYCTU Putative cytochrome P450 138 OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=cyp138 PE=1 SV=1 219 430 6.0E-17
sp|P9WPM2|CP138_MYCTO Putative cytochrome P450 138 OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) GN=cyp138 PE=3 SV=1 219 430 6.0E-17
sp|P63718|CP138_MYCBO Putative cytochrome P450 138 OS=Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97) GN=cyp138 PE=3 SV=1 219 430 6.0E-17
sp|Q27519|C13A7_CAEEL Putative cytochrome P450 CYP13A7 OS=Caenorhabditis elegans GN=cyp-13A7 PE=3 SV=1 10 430 8.0E-17
sp|Q9STL2|C71AL_ARATH Cytochrome P450 71A21 OS=Arabidopsis thaliana GN=CYP71A21 PE=2 SV=1 10 432 9.0E-17
sp|Q5KQT6|CP1A2_FELCA Cytochrome P450 1A2 OS=Felis catus GN=CYP1A2 PE=2 SV=1 8 432 9.0E-17
sp|Q9LTL0|C71BQ_ARATH Cytochrome P450 71B26 OS=Arabidopsis thaliana GN=CYP71B26 PE=2 SV=1 7 432 9.0E-17
sp|Q9VL92|CP4E3_DROME Cytochrome P450 4e3 OS=Drosophila melanogaster GN=Cyp4e3 PE=2 SV=1 10 423 9.0E-17
sp|Q27664|CP6B2_HELAM Cytochrome P450 6B2 OS=Helicoverpa armigera GN=CYP6B2 PE=2 SV=1 43 466 1.0E-16
sp|P33266|CP2E1_MACFA Cytochrome P450 2E1 (Fragment) OS=Macaca fascicularis GN=CYP2E1 PE=2 SV=1 25 435 1.0E-16
sp|P24457|CP2DB_MOUSE Cytochrome P450 2D11 OS=Mus musculus GN=Cyp2d11 PE=2 SV=2 8 434 1.0E-16
sp|P04798|CP1A1_HUMAN Cytochrome P450 1A1 OS=Homo sapiens GN=CYP1A1 PE=1 SV=1 200 432 1.0E-16
sp|P37117|C71A4_SOLME Cytochrome P450 71A4 OS=Solanum melongena GN=CYP71A4 PE=2 SV=1 8 432 1.0E-16
sp|O49340|C71AC_ARATH Cytochrome P450 71A12 OS=Arabidopsis thaliana GN=CYP71A12 PE=2 SV=1 4 430 1.0E-16
sp|P15128|CP4B1_RABIT Cytochrome P450 4B1 OS=Oryctolagus cuniculus GN=CYP4B1 PE=1 SV=1 93 451 1.0E-16
sp|Q27518|C13A2_CAEEL Putative cytochrome P450 CYP13A2 OS=Caenorhabditis elegans GN=cyp-13A2 PE=3 SV=1 10 430 1.0E-16
sp|O65790|C81F1_ARATH Cytochrome P450 81F1 OS=Arabidopsis thaliana GN=CYP81F1 PE=2 SV=2 4 430 1.0E-16
sp|O64637|C76C2_ARATH Cytochrome P450 76C2 OS=Arabidopsis thaliana GN=CYP76C2 PE=2 SV=1 173 451 1.0E-16
sp|Q9LUC8|C7A13_ARATH Cytochrome P450 72A13 OS=Arabidopsis thaliana GN=CYP72A13 PE=2 SV=1 32 450 1.0E-16
sp|P49264|C71B1_THLAR Cytochrome P450 71B1 OS=Thlaspi arvense GN=CYP71B1 PE=2 SV=1 3 436 1.0E-16
sp|P24903|CP2F1_HUMAN Cytochrome P450 2F1 OS=Homo sapiens GN=CYP2F1 PE=1 SV=2 204 430 1.0E-16
sp|Q12588|CP52J_CANMA Cytochrome P450 52A10 OS=Candida maltosa GN=CYP52A10 PE=2 SV=1 86 468 2.0E-16
sp|Q9FXW4|C80B2_COPJA Probable (S)-N-methylcoclaurine 3'-hydroxylase isozyme 2 OS=Coptis japonica GN=CYP80B2 PE=2 SV=1 3 432 2.0E-16
sp|Q9VLZ7|C4D21_DROME Probable cytochrome P450 4d21 OS=Drosophila melanogaster GN=Cyp4d21 PE=3 SV=1 10 423 2.0E-16
sp|Q9V4U7|C6A14_DROME Probable cytochrome P450 6a14 OS=Drosophila melanogaster GN=Cyp6a14 PE=3 SV=2 7 434 2.0E-16
sp|O64635|C76C4_ARATH Cytochrome P450 76C4 OS=Arabidopsis thaliana GN=CYP76C4 PE=3 SV=1 173 436 2.0E-16
sp|Q9ZUX1|C94C1_ARATH Cytochrome P450 94C1 OS=Arabidopsis thaliana GN=CYP94C1 PE=2 SV=1 22 449 2.0E-16
sp|Q92095|CP1A1_OPSTA Cytochrome P450 1A1 OS=Opsanus tau GN=cyp1a1 PE=2 SV=1 7 459 2.0E-16
sp|O18596|C4D10_DROMT Cytochrome P450 4d10 OS=Drosophila mettleri GN=Cyp4d10 PE=1 SV=1 7 416 2.0E-16
sp|P48418|C75A1_PETHY Flavonoid 3',5'-hydroxylase 1 OS=Petunia hybrida GN=CYP75A1 PE=2 SV=1 221 447 2.0E-16
sp|H2DH22|C7A10_PANGI Cytochrome P450 CYP73A100 OS=Panax ginseng PE=2 SV=1 4 432 2.0E-16
sp|Q27606|CP4E2_DROME Cytochrome P450 4e2 OS=Drosophila melanogaster GN=Cyp4e2 PE=2 SV=2 10 428 2.0E-16
sp|Q6JZS3|CP1A1_ORYLA Cytochrome P450 1A1 OS=Oryzias latipes GN=cyp1a1 PE=3 SV=1 7 459 2.0E-16
sp|O22203|C98A3_ARATH Cytochrome P450 98A3 OS=Arabidopsis thaliana GN=CYP98A3 PE=1 SV=1 203 431 2.0E-16
sp|O13317|TRI11_FUSSP Isotrichodermin C-15 hydroxylase OS=Fusarium sporotrichioides GN=TRI11 PE=3 SV=1 135 454 2.0E-16
sp|Q964T2|CP9E2_BLAGE Cytochrome P450 9e2 OS=Blattella germanica GN=CYP9E2 PE=2 SV=1 97 432 2.0E-16
sp|P24456|CP2DA_MOUSE Cytochrome P450 2D10 OS=Mus musculus GN=Cyp2d10 PE=1 SV=2 8 434 2.0E-16
sp|Q9AR74|TCMO_RUTGR Trans-cinnamate 4-monooxygenase OS=Ruta graveolens GN=CYP73A2 PE=2 SV=1 8 428 2.0E-16
sp|O18992|CP2DJ_CALJA Cytochrome P450 2D19 OS=Callithrix jacchus GN=CYP2D19 PE=2 SV=1 229 432 3.0E-16
sp|H2DH21|C7A29_PANGI Cytochrome P450 CYP72A219 OS=Panax ginseng PE=2 SV=1 32 450 3.0E-16
sp|Q05421|CP2E1_MOUSE Cytochrome P450 2E1 OS=Mus musculus GN=Cyp2e1 PE=1 SV=1 28 435 3.0E-16
sp|Q9VG82|CP9F2_DROME Probable cytochrome P450 9f2 OS=Drosophila melanogaster GN=Cyp9f2 PE=2 SV=1 86 431 3.0E-16
sp|Q9VG17|CP304_DROME Probable cytochrome P450 304a1 OS=Drosophila melanogaster GN=Cyp304a1 PE=2 SV=2 8 460 3.0E-16
sp|Q92088|CP2M1_ONCMY Cytochrome P450 2M1 OS=Oncorhynchus mykiss GN=cyp2m1 PE=1 SV=1 222 435 3.0E-16
sp|P93531|C71D7_SOLCH Cytochrome P450 71D7 OS=Solanum chacoense GN=CYP71D7 PE=3 SV=1 218 432 4.0E-16
sp|Q29510|CP2CU_RABIT Cytochrome P450 2C30 OS=Oryctolagus cuniculus GN=CYP2C30 PE=2 SV=1 8 435 4.0E-16
sp|Q9V9L1|CP6W1_DROME Probable cytochrome P450 6w1 OS=Drosophila melanogaster GN=Cyp6w1 PE=2 SV=1 95 434 4.0E-16
sp|F4JW83|C84A4_ARATH Cytochrome P450 84A4 OS=Arabidopsis thaliana GN=CYP84A4 PE=1 SV=1 8 434 4.0E-16
sp|P20814|CP2CD_RAT Cytochrome P450 2C13, male-specific OS=Rattus norvegicus GN=Cyp2c13 PE=1 SV=1 8 435 4.0E-16
sp|Q12589|CP52K_CANMA Cytochrome P450 52A11 OS=Candida maltosa GN=CYP52A11 PE=2 SV=1 259 428 4.0E-16
sp|P15123|CP2CG_RABIT Cytochrome P450 2C16 OS=Oryctolagus cuniculus GN=CYP2C16 PE=2 SV=1 8 435 5.0E-16
sp|P11371|CP2C4_RABIT Cytochrome P450 2C4 OS=Oryctolagus cuniculus GN=CYP2C4 PE=2 SV=1 8 435 5.0E-16
sp|O54750|CP2J6_MOUSE Cytochrome P450 2J6 OS=Mus musculus GN=Cyp2j6 PE=2 SV=2 3 431 5.0E-16
sp|P33265|CP2CS_MESAU Cytochrome P450 2C28 OS=Mesocricetus auratus GN=CYP2C28 PE=2 SV=1 16 430 5.0E-16
sp|P20813|CP2B6_HUMAN Cytochrome P450 2B6 OS=Homo sapiens GN=CYP2B6 PE=1 SV=1 26 431 5.0E-16
sp|P33270|CP6A2_DROME Cytochrome P450 6a2 OS=Drosophila melanogaster GN=Cyp6a2 PE=2 SV=2 93 434 5.0E-16
[Show less]

GO

GO Term Description Terminal node
GO:0016491 oxidoreductase activity Yes
GO:0004497 monooxygenase activity Yes
GO:0020037 heme binding Yes
GO:0016705 oxidoreductase activity, acting on paired donors, with incorporation or reduction of molecular oxygen Yes
GO:0010181 FMN binding Yes
GO:0005506 iron ion binding Yes
GO:0046914 transition metal ion binding No
GO:0043168 anion binding No
GO:0005488 binding No
GO:0003674 molecular_function No
GO:0046906 tetrapyrrole binding No
GO:0000166 nucleotide binding No
GO:0043167 ion binding No
GO:0032553 ribonucleotide binding No
GO:0097367 carbohydrate derivative binding No
GO:0046872 metal ion binding No
GO:0003824 catalytic activity No
GO:0043169 cation binding No
GO:0097159 organic cyclic compound binding No
GO:1901265 nucleoside phosphate binding No
GO:1901363 heterocyclic compound binding No
GO:0036094 small molecule binding No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 12 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >OphauB2|7305
MAENVPIPEPPGLPLIGNLGEFTTSMTKDLSRLADTYGAIFRLHKGSQPQVYVSSYELLNEICNEKRFHKSIGGS
LLQVREGVHDGLFTAYDDEPNWEKAHRILVPAFGPLTIRAMFDDMYDISTQLALKIARYGPQTPIPVSDTFTRLA
LDTLALCAMDYRFNSFYSDEMHPFVGAMCDFLDECGRRGRRPAFAPNFLYRAANEKFYKDIGIMRKTAEDVIEAR
KANPSDRKDLLNAMLNGTDSKTGEKLSDDNVASQLITFLTAGHETTSGLLSFAFYNLLKTPSAYQAVQREVDTVI
GRDKVAVEHTTKLPYITAVLRETLRVTATIFAIGVEPYEDTLLAGKYLVHKGETITALLSKAHLDPAVYGEDAND
FKPERMLDENFARLNKEFPNCWKPFGNGKRACIGRPFAWQEAIISMAVLFQNFNFSLDDPNYHLETQETLTLKPK
NFNIRASLRHNMTPTQLELQLTGKRPKVEQEAPDAAQQDGSSASAGSGKPLAIFYGSNSGTCEAFAQRVAANASR
HGFKATTVAPLDDANQKMPKDRPVVIVTASYEGQPPSNAALFVGWIEGLKGQEMQGVSYAVFGCGHHDWPATYQR
IPKLVDSTLEKLGGQRLLPIGAADAGAGDMFEDFETWEEKSLWPGLQAKYGAEDNEANAGSGISVEVSVARKKKL
RQEVEEAMVVSTQRLTQKGPEKRQIEIRLPTGMTYKAGDYLAVLPLNNRDNVSRVFRRFGLSWDATLMIKSDRPT
TLPTDLPVSALNVVGAYVELAQPATKRNIQALAESTENKADVSELQRLASDGYASEISEKRISVLDLLERFPSVD
LPLGAYLDMLPPMRVRQYSISSSPLHDASTLTLTYSVLESPALSGHGTYVGVTTHFLSSLQPGEKLHVAVRPSEK
FHLPHDAEKTPLICAAAGSGVAPFIGFMQERATMVRAGRKVAPAMLFFGCRAPDSDDIYAEQLAEWEKLGVVDVR
RAYSDAPEHSYGCRFIQHRITHDADDLNALYKQGARVYLCGSRMVGQAVEEAVFNLVKERGPEKTDEETRAILAS
MLKDRYVSDVFG*
Coding >OphauB2|7305
ATGGCGGAAAACGTGCCTATTCCCGAGCCTCCTGGGCTGCCACTTATAGGCAACCTGGGCGAATTCACGACGAGT
ATGACCAAGGACCTTTCTCGGCTGGCCGACACTTATGGCGCCATTTTTAGACTGCACAAGGGCTCGCAGCCGCAG
GTATATGTGTCGAGCTATGAGCTCCTCAATGAAATCTGCAATGAGAAGCGCTTCCACAAGTCTATTGGCGGTTCG
CTCCTGCAAGTCCGAGAGGGTGTTCACGATGGCCTTTTTACGGCCTATGACGATGAACCCAACTGGGAAAAGGCA
CACCGAATCCTGGTGCCTGCCTTTGGCCCGCTGACGATCCGGGCCATGTTTGACGACATGTACGACATTTCGACG
CAGCTAGCCCTCAAGATTGCACGCTACGGCCCTCAGACGCCCATTCCCGTCTCTGACACCTTCACGCGGCTGGCC
CTGGACACTCTGGCTCTCTGTGCCATGGACTACCGCTTCAACTCGTTTTACAGCGATGAAATGCATCCCTTTGTC
GGTGCCATGTGCGATTTCCTGGATGAGTGCGGAAGACGCGGCAGACGGCCTGCCTTTGCTCCAAACTTTCTCTAT
CGGGCAGCGAATGAAAAGTTTTACAAGGACATTGGCATTATGCGCAAGACGGCCGAAGATGTCATTGAGGCTCGC
AAGGCGAATCCGTCTGACCGCAAGGACCTGCTCAATGCCATGCTCAACGGCACTGATAGCAAGACTGGAGAGAAG
CTGAGCGACGACAACGTGGCCAGCCAGCTCATCACCTTTCTCACTGCCGGCCACGAGACGACGTCGGGCCTGCTT
TCCTTTGCCTTTTACAATTTGCTCAAGACGCCGAGCGCCTACCAGGCGGTGCAGCGCGAGGTGGACACTGTCATT
GGCCGCGACAAGGTGGCTGTTGAGCACACCACCAAGTTGCCCTATATTACAGCTGTGCTGCGAGAGACGCTCCGA
GTGACGGCCACCATTTTCGCCATTGGCGTCGAGCCGTACGAGGACACTTTACTTGCTGGCAAGTATCTGGTGCAC
AAGGGCGAAACAATCACGGCCCTTCTCAGCAAGGCCCATCTTGATCCCGCCGTCTATGGCGAGGATGCCAACGAC
TTCAAGCCGGAGCGCATGCTTGACGAAAACTTTGCCCGCCTCAACAAGGAGTTTCCCAACTGCTGGAAGCCCTTT
GGCAACGGCAAGCGAGCCTGTATTGGCCGGCCCTTTGCCTGGCAAGAGGCCATTATTTCCATGGCTGTCTTGTTC
CAAAACTTCAACTTTAGCCTGGATGACCCAAACTACCATCTCGAGACGCAGGAGACGCTGACTCTCAAGCCCAAA
AACTTCAACATTAGGGCCAGTCTTCGGCACAACATGACGCCCACCCAGCTCGAGCTGCAGCTCACGGGCAAGCGG
CCCAAGGTGGAGCAAGAGGCACCAGACGCAGCGCAGCAAGACGGCTCGAGCGCCTCGGCCGGCTCGGGCAAGCCG
CTGGCAATCTTTTACGGCTCCAACAGCGGCACCTGTGAGGCCTTTGCCCAACGGGTGGCGGCGAATGCCTCTCGG
CATGGCTTCAAGGCCACCACGGTGGCGCCTCTGGATGATGCAAACCAAAAGATGCCCAAGGACCGTCCAGTCGTC
ATTGTCACGGCCTCGTACGAGGGCCAGCCGCCTTCGAATGCGGCCCTGTTTGTCGGCTGGATCGAGGGTCTCAAG
GGCCAGGAGATGCAAGGCGTGTCGTATGCCGTCTTTGGCTGCGGCCACCATGACTGGCCGGCAACATATCAGCGC
ATCCCCAAGCTGGTCGACTCGACTCTGGAGAAGCTGGGCGGCCAACGCCTGCTGCCCATTGGCGCGGCGGATGCT
GGAGCGGGCGACATGTTTGAAGACTTTGAAACCTGGGAGGAAAAGTCGCTGTGGCCGGGCCTGCAGGCCAAGTAT
GGCGCCGAGGACAACGAAGCCAACGCGGGCAGTGGCATCAGCGTCGAGGTTTCCGTGGCGCGCAAAAAGAAGCTC
CGGCAAGAGGTTGAGGAGGCCATGGTTGTCTCGACGCAGCGGCTGACGCAAAAGGGCCCGGAGAAGAGACAGATT
GAGATTAGGCTCCCAACAGGCATGACTTACAAGGCGGGCGACTATCTGGCCGTTTTGCCCTTGAACAATAGAGAC
AACGTCTCGCGCGTCTTTCGCCGCTTTGGGCTGTCGTGGGACGCGACTCTAATGATTAAGTCGGACCGTCCGACG
ACGCTGCCAACAGACTTGCCCGTGTCGGCGCTTAATGTGGTGGGCGCCTATGTCGAGCTCGCCCAGCCGGCTACA
AAGAGGAATATACAAGCCTTGGCCGAGTCGACAGAGAACAAGGCAGACGTTTCGGAGCTGCAGCGACTGGCGAGT
GACGGCTATGCATCTGAAATTTCCGAAAAGCGGATATCGGTGCTGGATCTGCTTGAGCGCTTCCCGTCTGTGGAC
CTCCCCCTGGGTGCCTATCTCGACATGCTGCCGCCCATGAGAGTCCGCCAATACTCCATCTCATCGTCGCCGCTG
CACGACGCCTCGACCCTGACGCTAACGTACTCTGTCCTCGAGTCACCAGCCCTGTCCGGCCACGGAACCTACGTG
GGAGTCACGACGCACTTTTTATCCTCCCTCCAGCCGGGAGAAAAGCTACACGTGGCAGTGCGGCCATCGGAAAAG
TTTCACCTACCGCACGACGCTGAAAAGACGCCCCTGATTTGCGCAGCGGCCGGATCCGGAGTGGCGCCCTTTATA
GGCTTCATGCAAGAGCGCGCAACCATGGTGCGTGCCGGGCGCAAGGTGGCTCCCGCCATGCTCTTTTTTGGCTGC
CGCGCACCCGACTCGGACGACATTTATGCAGAGCAGCTGGCCGAGTGGGAAAAGCTGGGCGTGGTTGATGTGCGG
CGGGCGTATTCGGATGCGCCGGAGCATTCGTACGGGTGCCGCTTCATTCAGCACCGCATCACGCACGACGCTGAC
GACTTGAATGCGCTGTACAAGCAGGGCGCGCGGGTTTATCTCTGCGGGAGCCGCATGGTGGGCCAGGCGGTTGAG
GAGGCTGTGTTTAACTTGGTCAAGGAGCGGGGGCCGGAAAAGACGGATGAGGAGACGCGGGCCATTTTGGCAAGC
ATGTTGAAGGATCGCTATGTTAGTGATGTCTTTGGCTAG
Transcript >OphauB2|7305
ATGGCGGAAAACGTGCCTATTCCCGAGCCTCCTGGGCTGCCACTTATAGGCAACCTGGGCGAATTCACGACGAGT
ATGACCAAGGACCTTTCTCGGCTGGCCGACACTTATGGCGCCATTTTTAGACTGCACAAGGGCTCGCAGCCGCAG
GTATATGTGTCGAGCTATGAGCTCCTCAATGAAATCTGCAATGAGAAGCGCTTCCACAAGTCTATTGGCGGTTCG
CTCCTGCAAGTCCGAGAGGGTGTTCACGATGGCCTTTTTACGGCCTATGACGATGAACCCAACTGGGAAAAGGCA
CACCGAATCCTGGTGCCTGCCTTTGGCCCGCTGACGATCCGGGCCATGTTTGACGACATGTACGACATTTCGACG
CAGCTAGCCCTCAAGATTGCACGCTACGGCCCTCAGACGCCCATTCCCGTCTCTGACACCTTCACGCGGCTGGCC
CTGGACACTCTGGCTCTCTGTGCCATGGACTACCGCTTCAACTCGTTTTACAGCGATGAAATGCATCCCTTTGTC
GGTGCCATGTGCGATTTCCTGGATGAGTGCGGAAGACGCGGCAGACGGCCTGCCTTTGCTCCAAACTTTCTCTAT
CGGGCAGCGAATGAAAAGTTTTACAAGGACATTGGCATTATGCGCAAGACGGCCGAAGATGTCATTGAGGCTCGC
AAGGCGAATCCGTCTGACCGCAAGGACCTGCTCAATGCCATGCTCAACGGCACTGATAGCAAGACTGGAGAGAAG
CTGAGCGACGACAACGTGGCCAGCCAGCTCATCACCTTTCTCACTGCCGGCCACGAGACGACGTCGGGCCTGCTT
TCCTTTGCCTTTTACAATTTGCTCAAGACGCCGAGCGCCTACCAGGCGGTGCAGCGCGAGGTGGACACTGTCATT
GGCCGCGACAAGGTGGCTGTTGAGCACACCACCAAGTTGCCCTATATTACAGCTGTGCTGCGAGAGACGCTCCGA
GTGACGGCCACCATTTTCGCCATTGGCGTCGAGCCGTACGAGGACACTTTACTTGCTGGCAAGTATCTGGTGCAC
AAGGGCGAAACAATCACGGCCCTTCTCAGCAAGGCCCATCTTGATCCCGCCGTCTATGGCGAGGATGCCAACGAC
TTCAAGCCGGAGCGCATGCTTGACGAAAACTTTGCCCGCCTCAACAAGGAGTTTCCCAACTGCTGGAAGCCCTTT
GGCAACGGCAAGCGAGCCTGTATTGGCCGGCCCTTTGCCTGGCAAGAGGCCATTATTTCCATGGCTGTCTTGTTC
CAAAACTTCAACTTTAGCCTGGATGACCCAAACTACCATCTCGAGACGCAGGAGACGCTGACTCTCAAGCCCAAA
AACTTCAACATTAGGGCCAGTCTTCGGCACAACATGACGCCCACCCAGCTCGAGCTGCAGCTCACGGGCAAGCGG
CCCAAGGTGGAGCAAGAGGCACCAGACGCAGCGCAGCAAGACGGCTCGAGCGCCTCGGCCGGCTCGGGCAAGCCG
CTGGCAATCTTTTACGGCTCCAACAGCGGCACCTGTGAGGCCTTTGCCCAACGGGTGGCGGCGAATGCCTCTCGG
CATGGCTTCAAGGCCACCACGGTGGCGCCTCTGGATGATGCAAACCAAAAGATGCCCAAGGACCGTCCAGTCGTC
ATTGTCACGGCCTCGTACGAGGGCCAGCCGCCTTCGAATGCGGCCCTGTTTGTCGGCTGGATCGAGGGTCTCAAG
GGCCAGGAGATGCAAGGCGTGTCGTATGCCGTCTTTGGCTGCGGCCACCATGACTGGCCGGCAACATATCAGCGC
ATCCCCAAGCTGGTCGACTCGACTCTGGAGAAGCTGGGCGGCCAACGCCTGCTGCCCATTGGCGCGGCGGATGCT
GGAGCGGGCGACATGTTTGAAGACTTTGAAACCTGGGAGGAAAAGTCGCTGTGGCCGGGCCTGCAGGCCAAGTAT
GGCGCCGAGGACAACGAAGCCAACGCGGGCAGTGGCATCAGCGTCGAGGTTTCCGTGGCGCGCAAAAAGAAGCTC
CGGCAAGAGGTTGAGGAGGCCATGGTTGTCTCGACGCAGCGGCTGACGCAAAAGGGCCCGGAGAAGAGACAGATT
GAGATTAGGCTCCCAACAGGCATGACTTACAAGGCGGGCGACTATCTGGCCGTTTTGCCCTTGAACAATAGAGAC
AACGTCTCGCGCGTCTTTCGCCGCTTTGGGCTGTCGTGGGACGCGACTCTAATGATTAAGTCGGACCGTCCGACG
ACGCTGCCAACAGACTTGCCCGTGTCGGCGCTTAATGTGGTGGGCGCCTATGTCGAGCTCGCCCAGCCGGCTACA
AAGAGGAATATACAAGCCTTGGCCGAGTCGACAGAGAACAAGGCAGACGTTTCGGAGCTGCAGCGACTGGCGAGT
GACGGCTATGCATCTGAAATTTCCGAAAAGCGGATATCGGTGCTGGATCTGCTTGAGCGCTTCCCGTCTGTGGAC
CTCCCCCTGGGTGCCTATCTCGACATGCTGCCGCCCATGAGAGTCCGCCAATACTCCATCTCATCGTCGCCGCTG
CACGACGCCTCGACCCTGACGCTAACGTACTCTGTCCTCGAGTCACCAGCCCTGTCCGGCCACGGAACCTACGTG
GGAGTCACGACGCACTTTTTATCCTCCCTCCAGCCGGGAGAAAAGCTACACGTGGCAGTGCGGCCATCGGAAAAG
TTTCACCTACCGCACGACGCTGAAAAGACGCCCCTGATTTGCGCAGCGGCCGGATCCGGAGTGGCGCCCTTTATA
GGCTTCATGCAAGAGCGCGCAACCATGGTGCGTGCCGGGCGCAAGGTGGCTCCCGCCATGCTCTTTTTTGGCTGC
CGCGCACCCGACTCGGACGACATTTATGCAGAGCAGCTGGCCGAGTGGGAAAAGCTGGGCGTGGTTGATGTGCGG
CGGGCGTATTCGGATGCGCCGGAGCATTCGTACGGGTGCCGCTTCATTCAGCACCGCATCACGCACGACGCTGAC
GACTTGAATGCGCTGTACAAGCAGGGCGCGCGGGTTTATCTCTGCGGGAGCCGCATGGTGGGCCAGGCGGTTGAG
GAGGCTGTGTTTAACTTGGTCAAGGAGCGGGGGCCGGAAAAGACGGATGAGGAGACGCGGGCCATTTTGGCAAGC
ATGTTGAAGGATCGCTATGTTAGTGATGTCTTTGGCTAG
Gene >OphauB2|7305
ATGGCGGAAAACGTGCCTATTCCCGAGCCTCCTGGGCTGCCACTTATAGGCAACCTGGGCGAATTCACGACGAGT
ATGACCAAGGACCTTTCTCGGCTGGCCGACACTTATGGCAAGTCAAATGGCCCTTGTCGTATAGCTTGCCATGCT
GACCGGGAGGGGGAGGAAACACGCAGGCGCCATTTTTAGACTGCACAAGGGCTCGCAGCCGCAGGTATATGTGTC
GAGCTATGAGCTCCTCAATGAAATCTGCAATGAGAAGCGCTTCCACAAGTCTATTGGCGGTTCGCTCCTGGTGAG
CTCCAAGAGCATTGATGTGGGCAGGAGAGTGCAGTGAGGAGCTAACGAGGGCGCAGCAAGTCCGAGAGGGTGTTC
ACGATGGCCTTTTTACGGTAAGCCCAAGCCTAGACTGCAAGCCTCGGCCTTGACACCATTGTGGGAACATCATGA
TGGTGCAGGTTGACTGTGCAAACTCTTGCTCACCATGGACACACGGCCACAGGCCTATGACGATGAACCCAACTG
GGAAAAGGCACACCGAATCCTGGTGCCTGCCTTTGGCCCGCTGACGATCCGGGCCATGTTTGACGACATGTACGA
CATTTCGACGCAGCTAGCCCTCAAGATTGCACGCTACGGCCCTCAGACGCCCATTCCCGTCTCTGACACCTTCAC
GCGGCTGGCCCTGGACACTCTGGCTCTCTGTGCCATGGACTACCGCTTCAACTCGTTTTACAGCGATGAAATGCA
TCCCTTTGTCGGTGCCATGTGCGATTTCCTGGATGAGTGCGGAAGACGCGGCAGACGGCCTGCCTTTGCTCCAAA
CTTTCTCTATCGGGCAGCGAATGAAAAGTTTTACAAGGACATTGGCATTATGCGCAAGACGGCCGAAGATGTCAT
TGAGGCTCGCAAGGCGAATCCGTCTGACCGCAAGGACCTGCTCAATGCCATGCTCAACGGCACTGATAGCAAGAC
TGGAGAGAAGCTGAGCGACGACAACGTGGCCAGCCAGCTCATCACCTTTCTCACTGCCGGCCACGAGACGACGTC
GGGCCTGCTTTCCTTTGCCTTTTACAATTTGCTCAAGACGCCGAGCGCCTACCAGGCGGTGCAGCGCGAGGTGGA
CACTGTCATTGGCCGCGACAAGGTGGCTGTTGAGCACACCACCAAGTTGCCCTATATTACAGCTGTGCTGCGAGA
GACGCTCCGAGTGACGGCCACCATTTTCGCCATTGGCGTCGAGCCGTACGAGGACACTTTACTTGCTGGCAAGTA
TCTGGTGCACAAGGGCGAAACAATCACGGCCCTTCTCAGCAAGGCCCATCTTGATCCCGCCGTCTATGGCGAGGA
TGCCAACGACTTCAAGCCGGAGCGCATGCTTGACGAAAACTTTGCCCGCCTCAACAAGGAGTTTCCCAACTGCTG
GAAGCCCTTTGGCAACGGCAAGCGAGCCTGTATTGGCCGGCCCTTTGCCTGGCAAGAGGCCATTATTTCCATGGC
TGTCTTGTTCCAAAACTTCAACTTTAGCCTGGATGACCCAAACTACCATCTCGAGACGCAGGAGACGCTGACTCT
CAAGCCCAAAAACTTCAACATTAGGGCCAGTCTTCGGCACAACATGACGCCCACCCAGCTCGAGCTGCAGCTCAC
GGGCAAGCGGCCCAAGGTGGAGCAAGAGGCACCAGACGCAGCGCAGCAAGACGGCTCGAGCGCCTCGGCCGGCTC
GGGCAAGCCGCTGGCAATCTTTTACGGCTCCAACAGCGGCACCTGTGAGGCCTTTGCCCAACGGGTGGCGGCGAA
TGCCTCTCGGCATGGCTTCAAGGCCACCACGGTGGCGCCTCTGGATGATGCAAACCAAAAGATGCCCAAGGACCG
TCCAGTCGTCATTGTCACGGCCTCGTACGAGGGCCAGCCGCCTTCGAATGCGGCCCTGTTTGTCGGCTGGATCGA
GGGTCTCAAGGGCCAGGAGATGCAAGGCGTGTCGTATGCCGTCTTTGGCTGCGGCCACCATGACTGGCCGGCAAC
ATATCAGCGCATCCCCAAGCTGGTCGACTCGACTCTGGAGAAGCTGGGCGGCCAACGCCTGCTGCCCATTGGCGC
GGCGGATGCTGGAGCGGGCGACATGTTTGAAGACTTTGAAACCTGGGAGGAAAAGTCGCTGTGGCCGGGCCTGCA
GGCCAAGTATGGCGCCGAGGACAACGAAGCCAACGCGGGCAGTGGCATCAGCGTCGAGGTTTCCGTGGCGCGCAA
AAAGAAGCTCCGGCAAGAGGTTGAGGAGGCCATGGTTGTCTCGACGCAGCGGCTGACGCAAAAGGGCCCGGAGAA
GAGACAGATTGAGATTAGGCTCCCAACAGGCATGACTTACAAGGCGGGCGACTATCTGGCCGTTTTGCCCTTGAA
CAATAGAGACAACGTCTCGCGCGTCTTTCGCCGCTTTGGGCTGTCGTGGGACGCGACTCTAATGATTAAGTCGGA
CCGTCCGACGACGCTGCCAACAGACTTGCCCGTGTCGGCGCTTAATGTGGTGGGCGCCTATGTCGAGCTCGCCCA
GCCGGCTACAAAGAGGGTGAGTGCTGCGAGGGCTGATTTTTCTTTTTTTTTCTCTTTTTTTTTCCTTTTTTTCTC
TTTTTTTTTCTCTTTTTTTTTTTGTGACCGCAAGACGGGGCCACTGACATGAGCCCTAGAATATACAAGCCTTGG
CCGAGTCGACAGAGAACAAGGCAGACGTTTCGGAGCTGCAGCGACTGGCGAGTGACGGCTATGCATCTGAAATTT
CCGAAAAGCGGATATCGGTGCTGGATCTGCTTGAGCGCTTCCCGTCTGTGGACCTCCCCCTGGGTGCCTATCTCG
ACATGCTGCCGCCCATGAGAGTCCGCCAATAGTAAGCATGCCGCAGCCCATTTCTCATATACACGAGGCACAGGC
TAACAAGCACACACCAGCTCCATCTCATCGTCGCCGCTGCACGACGCCTCGACCCTGACGCTAACGTACTCTGTC
CTCGAGTCACCAGCCCTGTCCGGCCACGGAACCTACGTGGGAGTCACGACGCACTTTTTATCCTCCCTCCAGCCG
GGAGAAAAGCTACACGTGGCAGTGCGGCCATCGGAAAAGTTTCACCTACCGCACGACGCTGAAAAGACGCCCCTG
ATTTGCGCAGCGGCCGGATCCGGAGTGGCGCCCTTTATAGGCTTCATGCAAGAGCGCGCAACCATGGTGCGTGCC
GGGCGCAAGGTGGCTCCCGCCATGCTCTTTTTTGGCTGCCGCGCACCCGACTCGGACGACATTTATGCAGAGCAG
CTGGCCGAGTGGGAAAAGCTGGGCGTGGTTGATGTGCGGCGGGCGTATTCGGATGCGCCGGAGCATTCGTACGGG
TGCCGCTTCATTCAGCACCGCATCACGCACGACGCTGACGACTTGAATGCGCTGTACAAGCAGGGCGCGCGGGTT
TATCTCTGCGGGAGCCGCATGGTGGGCCAGGCGGTTGAGGAGGCTGTGTTTAACTTGGTCAAGGAGCGGGGGCCG
GAAAAGACGGATGAGGAGACGCGGGCCATTTTGGCAAGCATGTTGAAGGATCGCTATGTTAGTGATGTCTTTGGC
TAG

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail