Fungal Genomics

at Utrecht University

General Properties

Protein IDOphauB2|73
Gene name
LocationContig_1:184120..186255
Strand-
Gene length (bp)2135
Transcript length (bp)2004
Coding sequence length (bp)2004
Protein length (aa) 668

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00026 Asp Eukaryotic aspartyl protease 1.4E-13 89 280
PF00026 Asp Eukaryotic aspartyl protease 2.7E-11 428 544

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|C5FRQ0|OPSB_ARTOC Probable aspartic-type endopeptidase OPSB OS=Arthroderma otae (strain ATCC MYA-4605 / CBS 113480) GN=OPSB PE=3 SV=1 86 286 4.0E-17
sp|D4DFT3|OPSB_TRIVH Probable aspartic-type endopeptidase OPSB OS=Trichophyton verrucosum (strain HKI 0517) GN=OPSB PE=3 SV=1 79 282 3.0E-14
sp|D4AIS3|OPSB_ARTBC Probable aspartic-type endopeptidase OPSB OS=Arthroderma benhamiae (strain ATCC MYA-4681 / CBS 112371) GN=OPSB PE=3 SV=1 79 282 3.0E-14
sp|Q8NKB6|OPSB_ASPOR Probable aspartic-type endopeptidase opsB OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) GN=opsB PE=2 SV=1 79 293 2.0E-12
sp|Q4WDN4|OPSB_ASPFU Probable aspartic-type endopeptidase opsB OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=opsB PE=3 SV=1 79 281 3.0E-12
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|C5FRQ0|OPSB_ARTOC Probable aspartic-type endopeptidase OPSB OS=Arthroderma otae (strain ATCC MYA-4605 / CBS 113480) GN=OPSB PE=3 SV=1 86 286 4.0E-17
sp|D4DFT3|OPSB_TRIVH Probable aspartic-type endopeptidase OPSB OS=Trichophyton verrucosum (strain HKI 0517) GN=OPSB PE=3 SV=1 79 282 3.0E-14
sp|D4AIS3|OPSB_ARTBC Probable aspartic-type endopeptidase OPSB OS=Arthroderma benhamiae (strain ATCC MYA-4681 / CBS 112371) GN=OPSB PE=3 SV=1 79 282 3.0E-14
sp|Q8NKB6|OPSB_ASPOR Probable aspartic-type endopeptidase opsB OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) GN=opsB PE=2 SV=1 79 293 2.0E-12
sp|Q4WDN4|OPSB_ASPFU Probable aspartic-type endopeptidase opsB OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=opsB PE=3 SV=1 79 281 3.0E-12
sp|P43095|CARP6_CANAX Candidapepsin-6 OS=Candida albicans GN=SAP6 PE=3 SV=1 88 265 5.0E-09
sp|P43093|CARP4_CANAW Candidapepsin-4 OS=Candida albicans (strain WO-1) GN=SAP4 PE=3 SV=1 82 265 6.0E-09
sp|Q5A8N2|CARP4_CANAL Candidapepsin-4 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=SAP4 PE=1 SV=1 82 265 6.0E-09
sp|Q5AC08|CARP6_CANAL Candidapepsin-6 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=SAP6 PE=1 SV=1 88 265 9.0E-09
sp|Q12303|YPS3_YEAST Aspartic proteinase yapsin-3 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=YPS3 PE=1 SV=1 409 557 2.0E-07
sp|P32329|YPS1_YEAST Aspartic proteinase 3 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=YPS1 PE=1 SV=2 428 554 2.0E-07
sp|C4YMJ3|CARP2_CANAW Candidapepsin-2 OS=Candida albicans (strain WO-1) GN=SAP2 PE=1 SV=1 88 261 2.0E-07
sp|P0CS83|CARP2_CANAX Candidapepsin-2 OS=Candida albicans GN=SAP2 PE=1 SV=1 88 261 2.0E-07
sp|P0DJ06|CARP2_CANAL Candidapepsin-2 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=SAP2 PE=1 SV=1 88 261 2.0E-07
sp|P32950|CARP2_CANPA Candidapepsin-2 OS=Candida parapsilosis GN=SAPP2 PE=1 SV=1 94 257 2.0E-07
sp|P43094|CARP5_CANAL Candidapepsin-5 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=SAP5 PE=1 SV=1 88 261 3.0E-07
sp|O42778|CARP8_CANAX Candidapepsin-8 OS=Candida albicans GN=SAP8 PE=3 SV=1 56 261 4.0E-07
sp|Q5AEM6|CARP8_CANAL Candidapepsin-8 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=SAP8 PE=1 SV=1 56 261 5.0E-07
sp|P12630|BAR1_YEAST Barrierpepsin OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=BAR1 PE=1 SV=1 428 559 7.0E-07
sp|P0CY27|CARP1_CANAL Candidapepsin-1 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=SAP1 PE=1 SV=1 94 256 1.0E-06
sp|C4YSF6|CARP1_CANAW Candidapepsin-1 OS=Candida albicans (strain WO-1) GN=SAP1 PE=1 SV=1 94 256 1.0E-06
sp|P0CY26|CARP1_CANAX Candidapepsin-1 OS=Candida albicans GN=SAP1 PE=1 SV=1 94 256 3.0E-06
sp|P32951|CARP1_CANPA Candidapepsin-1 OS=Candida parapsilosis GN=SAPP1 PE=1 SV=1 89 253 3.0E-06
sp|Q12303|YPS3_YEAST Aspartic proteinase yapsin-3 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=YPS3 PE=1 SV=1 82 261 8.0E-06
[Show less]

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
Yes 1 - 21 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >OphauB2|73
MLYLLLLVLGWAVAAPPVSAPSLAPAPASRASSAPPPLATPASPASPPPPPPPVTPPEKPKVVQAELQNVHSLAS
GPFLQLIKFALGNQIMTGVFDTGSSDVVAPVTDSILCKDPLQQCDSSAASKFVAGSFDPGMASARELGISYNHSF
GHDAGVTGNYVETMAKVGDGEVSLQVAAINGGKLRQEEFLFSIFGVGPIQGEDSQPREYLNLPAKMKSAGVITSN
VFSVWTNDFRTGNGTLVFGGVDLAKFEGAKLKFLPLERTLDGVLPAFVTQMSSVKFKMAKKEAKRSETVFARDNG
RNNKDTSNHNRPNSRNNKHNSNPHNSNSRNKSSLQNANDSSHQNNDSKESGHKKSKNNEKSSNRDDFTKNDAQAM
ARDTSTNKTSNHDSKKKVGAEDNKNVSNNNNTQKTDQGNGDVLDNLVPNGGFALFETATSGMSLPKPALEAVAKM
LNTSITKEGDLGLTDCGLINSESMLIFGFDDDRVKINVPLDTLSLPRQFLNGTDKCQLFIGTDEDELTILGAAFL
QNVYVTFDMDRQAMHVAQAKVNVTESNVKEFKLQEHVEEPVFDDDKNKGGNDDKEKGRNPDDGNQKQGDQKGQSQ
GDDQGSVEGSSIKSFVIPNEEQEANQGVLKQIGRGSRRGGNSYSGSASIGRGGPQRQRMVKRAFRYR*
Coding >OphauB2|73
ATGTTATACCTGCTGCTACTTGTCCTTGGCTGGGCAGTAGCGGCACCCCCAGTATCAGCGCCCTCATTAGCCCCA
GCCCCAGCATCACGGGCTTCATCAGCACCTCCTCCTCTGGCAACGCCAGCATCTCCAGCATCTCCTCCTCCTCCA
CCGCCACCTGTGACGCCGCCAGAGAAGCCCAAAGTTGTACAAGCCGAGCTGCAAAATGTGCATAGCCTCGCCTCT
GGTCCCTTCCTCCAGCTCATCAAATTCGCCCTCGGAAACCAAATCATGACGGGCGTCTTTGACACGGGAAGCAGC
GATGTGGTAGCGCCTGTCACGGACAGTATATTATGCAAAGATCCTCTGCAGCAGTGTGACTCGAGTGCAGCATCC
AAGTTTGTTGCTGGCTCCTTTGATCCTGGCATGGCGAGTGCGCGCGAGCTTGGCATCTCCTACAATCATAGCTTT
GGCCACGATGCTGGCGTTACCGGCAACTATGTCGAGACCATGGCAAAGGTGGGCGACGGCGAGGTGTCGCTGCAA
GTTGCCGCCATTAATGGAGGAAAGTTGCGGCAAGAAGAGTTCTTGTTTTCAATCTTTGGCGTGGGGCCTATTCAA
GGAGAGGATTCACAACCAAGAGAGTACCTCAACTTGCCAGCAAAGATGAAGAGTGCGGGCGTCATCACTTCTAAT
GTGTTTAGTGTGTGGACCAATGATTTCAGGACGGGCAATGGCACCTTGGTTTTTGGCGGCGTCGACTTGGCAAAG
TTTGAGGGTGCCAAGCTAAAATTTTTACCATTGGAGCGCACACTTGATGGGGTTTTGCCAGCCTTTGTCACACAA
ATGAGCTCTGTGAAATTCAAAATGGCCAAGAAAGAAGCCAAGCGGTCCGAGACCGTGTTTGCTCGCGACAACGGC
CGCAACAACAAAGACACCTCTAATCACAATAGACCCAACTCTCGAAACAACAAGCACAACTCTAATCCCCACAAT
TCCAATTCTCGAAACAAGAGCAGCCTTCAGAATGCCAATGACTCGAGCCATCAAAATAATGATTCCAAGGAGTCG
GGACATAAAAAGAGCAAGAATAATGAGAAATCCAGCAACAGAGACGACTTTACAAAGAATGACGCTCAGGCAATG
GCAAGGGATACCTCGACCAACAAAACCAGCAATCACGACTCTAAAAAGAAAGTTGGCGCCGAGGACAACAAAAAC
GTCTCCAACAATAATAATACCCAGAAAACCGACCAGGGCAATGGGGATGTCTTAGATAACCTTGTTCCCAATGGT
GGTTTTGCCCTCTTTGAAACTGCCACCTCTGGCATGAGCCTTCCCAAACCGGCTTTGGAGGCAGTTGCCAAGATG
CTCAACACGTCCATCACCAAGGAGGGAGACTTGGGTCTAACTGACTGCGGCTTAATCAATAGCGAGTCAATGCTC
ATTTTTGGTTTTGACGACGACAGAGTCAAGATCAATGTGCCTCTTGACACGCTTTCACTACCGCGCCAGTTTCTC
AACGGCACCGACAAGTGCCAGCTGTTTATAGGCACCGATGAAGACGAGCTTACCATTCTTGGAGCAGCGTTCTTG
CAAAATGTATACGTCACGTTCGACATGGACAGACAAGCAATGCACGTGGCACAGGCAAAGGTCAATGTGACTGAG
TCAAATGTCAAGGAATTCAAACTTCAGGAGCATGTGGAAGAGCCCGTTTTCGATGATGACAAGAACAAGGGGGGC
AATGATGACAAGGAAAAGGGCAGGAACCCAGATGACGGGAACCAAAAACAAGGGGACCAGAAGGGTCAGAGCCAA
GGCGACGATCAAGGCAGTGTTGAAGGAAGCAGCATTAAGAGCTTCGTCATACCAAATGAGGAGCAAGAAGCCAAC
CAAGGAGTTTTGAAGCAAATCGGCAGAGGAAGTCGGCGAGGTGGAAATTCATATTCGGGCAGCGCAAGTATTGGC
CGGGGGGGTCCTCAGCGTCAAAGAATGGTCAAGAGAGCATTTCGATATAGATAA
Transcript >OphauB2|73
ATGTTATACCTGCTGCTACTTGTCCTTGGCTGGGCAGTAGCGGCACCCCCAGTATCAGCGCCCTCATTAGCCCCA
GCCCCAGCATCACGGGCTTCATCAGCACCTCCTCCTCTGGCAACGCCAGCATCTCCAGCATCTCCTCCTCCTCCA
CCGCCACCTGTGACGCCGCCAGAGAAGCCCAAAGTTGTACAAGCCGAGCTGCAAAATGTGCATAGCCTCGCCTCT
GGTCCCTTCCTCCAGCTCATCAAATTCGCCCTCGGAAACCAAATCATGACGGGCGTCTTTGACACGGGAAGCAGC
GATGTGGTAGCGCCTGTCACGGACAGTATATTATGCAAAGATCCTCTGCAGCAGTGTGACTCGAGTGCAGCATCC
AAGTTTGTTGCTGGCTCCTTTGATCCTGGCATGGCGAGTGCGCGCGAGCTTGGCATCTCCTACAATCATAGCTTT
GGCCACGATGCTGGCGTTACCGGCAACTATGTCGAGACCATGGCAAAGGTGGGCGACGGCGAGGTGTCGCTGCAA
GTTGCCGCCATTAATGGAGGAAAGTTGCGGCAAGAAGAGTTCTTGTTTTCAATCTTTGGCGTGGGGCCTATTCAA
GGAGAGGATTCACAACCAAGAGAGTACCTCAACTTGCCAGCAAAGATGAAGAGTGCGGGCGTCATCACTTCTAAT
GTGTTTAGTGTGTGGACCAATGATTTCAGGACGGGCAATGGCACCTTGGTTTTTGGCGGCGTCGACTTGGCAAAG
TTTGAGGGTGCCAAGCTAAAATTTTTACCATTGGAGCGCACACTTGATGGGGTTTTGCCAGCCTTTGTCACACAA
ATGAGCTCTGTGAAATTCAAAATGGCCAAGAAAGAAGCCAAGCGGTCCGAGACCGTGTTTGCTCGCGACAACGGC
CGCAACAACAAAGACACCTCTAATCACAATAGACCCAACTCTCGAAACAACAAGCACAACTCTAATCCCCACAAT
TCCAATTCTCGAAACAAGAGCAGCCTTCAGAATGCCAATGACTCGAGCCATCAAAATAATGATTCCAAGGAGTCG
GGACATAAAAAGAGCAAGAATAATGAGAAATCCAGCAACAGAGACGACTTTACAAAGAATGACGCTCAGGCAATG
GCAAGGGATACCTCGACCAACAAAACCAGCAATCACGACTCTAAAAAGAAAGTTGGCGCCGAGGACAACAAAAAC
GTCTCCAACAATAATAATACCCAGAAAACCGACCAGGGCAATGGGGATGTCTTAGATAACCTTGTTCCCAATGGT
GGTTTTGCCCTCTTTGAAACTGCCACCTCTGGCATGAGCCTTCCCAAACCGGCTTTGGAGGCAGTTGCCAAGATG
CTCAACACGTCCATCACCAAGGAGGGAGACTTGGGTCTAACTGACTGCGGCTTAATCAATAGCGAGTCAATGCTC
ATTTTTGGTTTTGACGACGACAGAGTCAAGATCAATGTGCCTCTTGACACGCTTTCACTACCGCGCCAGTTTCTC
AACGGCACCGACAAGTGCCAGCTGTTTATAGGCACCGATGAAGACGAGCTTACCATTCTTGGAGCAGCGTTCTTG
CAAAATGTATACGTCACGTTCGACATGGACAGACAAGCAATGCACGTGGCACAGGCAAAGGTCAATGTGACTGAG
TCAAATGTCAAGGAATTCAAACTTCAGGAGCATGTGGAAGAGCCCGTTTTCGATGATGACAAGAACAAGGGGGGC
AATGATGACAAGGAAAAGGGCAGGAACCCAGATGACGGGAACCAAAAACAAGGGGACCAGAAGGGTCAGAGCCAA
GGCGACGATCAAGGCAGTGTTGAAGGAAGCAGCATTAAGAGCTTCGTCATACCAAATGAGGAGCAAGAAGCCAAC
CAAGGAGTTTTGAAGCAAATCGGCAGAGGAAGTCGGCGAGGTGGAAATTCATATTCGGGCAGCGCAAGTATTGGC
CGGGGGGGTCCTCAGCGTCAAAGAATGGTCAAGAGAGCATTTCGATATAGATAA
Gene >OphauB2|73
ATGTTATACCTGCTGCTACTTGTCCTTGGCTGGGCAGTAGCGGCACCCCCAGTATCAGCGCCCTCATTAGCCCCA
GCCCCAGCATCACGGGCTTCATCAGCACCTCCTCCTCTGGCAACGCCAGCATCTCCAGCATCTCCTCCTCCTCCA
CCGCCACCTGTGACGCCGCCAGAGAAGCCCAAAGTTGTACAAGCCGAGCTGCAAAATGTGCATAGCCTCGCCTCT
GGTCCCTTCCTCCAGCTCATCAAATTCGCCCTCGGAAACCAAATCATGACGGGCGTCTTTGACACGGGAAGCAGC
GATGTGGTAGCGCCTGTCACGGACAGTATATTATGCAAAGATCCTCTGCAGCAGTGTGACTCGAGTGCAGCATCC
AAGTTTGTTGCTGGCTCCTTTGATCCTGGCATGGCGAGTGCGCGCGAGCTTGGCATCTCCTACAATCATAGCTTT
GGCCACGATGCTGGCGTTACCGGCAACTATGTCGAGACCATGGCAAAGGTGGGCGACGGCGAGGTGTCGCTGCAA
GTTGCCGCCATTAATGGAGGAAAGTTGCGGCAAGAAGAGTTCTTGTTTTCAATCTTTGGCGTGGGGCCTATTCAA
GGAGAGGATTCACAACCAAGAGAGTACCTCAACTTGCCAGCAAAGATGAAGAGTGCGGGCGTCATCACTTCTAAT
GTGTTTAGTGTGTGGACCAATGATTTCAGTGAGTTTTTTTTCTTTTTTTTCTTCTCATCATTTTCCCGTCTGTTA
TTGTTTTGGTTATTCTTGGCCTTCATCTTGAAAAGAAGGAGAGAAATCTTGTTCTAGAATCACATGGCTGACCTG
TACCATCAGGGACGGGCAATGGCACCTTGGTTTTTGGCGGCGTCGACTTGGCAAAGTTTGAGGGTGCCAAGCTAA
AATTTTTACCATTGGAGCGCACACTTGATGGGGTTTTGCCAGCCTTTGTCACACAAATGAGCTCTGTGAAATTCA
AAATGGCCAAGAAAGAAGCCAAGCGGTCCGAGACCGTGTTTGCTCGCGACAACGGCCGCAACAACAAAGACACCT
CTAATCACAATAGACCCAACTCTCGAAACAACAAGCACAACTCTAATCCCCACAATTCCAATTCTCGAAACAAGA
GCAGCCTTCAGAATGCCAATGACTCGAGCCATCAAAATAATGATTCCAAGGAGTCGGGACATAAAAAGAGCAAGA
ATAATGAGAAATCCAGCAACAGAGACGACTTTACAAAGAATGACGCTCAGGCAATGGCAAGGGATACCTCGACCA
ACAAAACCAGCAATCACGACTCTAAAAAGAAAGTTGGCGCCGAGGACAACAAAAACGTCTCCAACAATAATAATA
CCCAGAAAACCGACCAGGGCAATGGGGATGTCTTAGATAACCTTGTTCCCAATGGTGGTTTTGCCCTCTTTGAAA
CTGCCACCTCTGGCATGAGCCTTCCCAAACCGGCTTTGGAGGCAGTTGCCAAGATGCTCAACACGTCCATCACCA
AGGAGGGAGACTTGGGTCTAACTGACTGCGGCTTAATCAATAGCGAGTCAATGCTCATTTTTGGTTTTGACGACG
ACAGAGTCAAGATCAATGTGCCTCTTGACACGCTTTCACTACCGCGCCAGTTTCTCAACGGCACCGACAAGTGCC
AGCTGTTTATAGGCACCGATGAAGACGAGCTTACCATTCTTGGAGCAGCGTTCTTGCAAAATGTATACGTCACGT
TCGACATGGACAGACAAGCAATGCACGTGGCACAGGCAAAGGTCAATGTGACTGAGTCAAATGTCAAGGAATTCA
AACTTCAGGAGCATGTGGAAGAGCCCGTTTTCGATGATGACAAGAACAAGGGGGGCAATGATGACAAGGAAAAGG
GCAGGAACCCAGATGACGGGAACCAAAAACAAGGGGACCAGAAGGGTCAGAGCCAAGGCGACGATCAAGGCAGTG
TTGAAGGAAGCAGCATTAAGAGCTTCGTCATACCAAATGAGGAGCAAGAAGCCAACCAAGGAGTTTTGAAGCAAA
TCGGCAGAGGAAGTCGGCGAGGTGGAAATTCATATTCGGGCAGCGCAAGTATTGGCCGGGGGGGTCCTCAGCGTC
AAAGAATGGTCAAGAGAGCATTTCGATATAGATAA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail