Fungal Genomics

at Utrecht University

General Properties

Protein IDOphauB2|7299
Gene name
LocationContig_77:6548..7760
Strand-
Gene length (bp)1212
Transcript length (bp)1023
Coding sequence length (bp)1023
Protein length (aa) 341

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00891 Methyltransf_2 O-methyltransferase domain 1.3E-15 148 318

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q12120|OMTA_ASPPA Sterigmatocystin 8-O-methyltransferase OS=Aspergillus parasiticus GN=omtA PE=1 SV=1 8 332 9.0E-28
sp|P55790|OMTA_ASPFL Sterigmatocystin 8-O-methyltransferase OS=Aspergillus flavus GN=omtA PE=3 SV=1 8 332 4.0E-26
sp|Q9UQY0|OMTB_ASPPA Demethylsterigmatocystin 6-O-methyltransferase OS=Aspergillus parasiticus GN=omtB PE=1 SV=2 17 321 2.0E-17
sp|Q9P900|OMTB_ASPFL Demethylsterigmatocystin 6-O-methyltransferase OS=Aspergillus flavus GN=omtB PE=3 SV=1 20 321 8.0E-17
sp|B9WZX2|FTMD_ASPFM 6-hydroxytryprostatin B O-methyltransferase OS=Neosartorya fumigata GN=ftmMT PE=1 SV=1 149 340 2.0E-12
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q12120|OMTA_ASPPA Sterigmatocystin 8-O-methyltransferase OS=Aspergillus parasiticus GN=omtA PE=1 SV=1 8 332 9.0E-28
sp|P55790|OMTA_ASPFL Sterigmatocystin 8-O-methyltransferase OS=Aspergillus flavus GN=omtA PE=3 SV=1 8 332 4.0E-26
sp|Q9UQY0|OMTB_ASPPA Demethylsterigmatocystin 6-O-methyltransferase OS=Aspergillus parasiticus GN=omtB PE=1 SV=2 17 321 2.0E-17
sp|Q9P900|OMTB_ASPFL Demethylsterigmatocystin 6-O-methyltransferase OS=Aspergillus flavus GN=omtB PE=3 SV=1 20 321 8.0E-17
sp|B9WZX2|FTMD_ASPFM 6-hydroxytryprostatin B O-methyltransferase OS=Neosartorya fumigata GN=ftmMT PE=1 SV=1 149 340 2.0E-12
sp|P42712|DMPM_STRAD O-demethylpuromycin-O-methyltransferase OS=Streptomyces alboniger GN=dmpM PE=3 SV=1 1 324 9.0E-12
sp|A1DA61|FTMD_NEOFI 6-hydroxytryprostatin B O-methyltransferase OS=Neosartorya fischeri (strain ATCC 1020 / DSM 3700 / FGSC A1164 / NRRL 181) GN=ftmMT PE=3 SV=1 149 340 1.0E-11
sp|Q4WAW6|FTMD_ASPFU 6-hydroxytryprostatin B O-methyltransferase OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=ftmMT PE=1 SV=1 149 340 3.0E-11
sp|B0CN39|SFMM3_STRLA O-methyltransferase SfmM3 OS=Streptomyces lavendulae GN=sfmM3 PE=3 SV=1 4 324 3.0E-11
sp|Q00763|COMT1_POPTM Caffeic acid 3-O-methyltransferase 1 OS=Populus tremuloides GN=OMT1 PE=1 SV=1 149 337 2.0E-10
sp|Q8GU25|COMT1_ROSCH Caffeic acid 3-O-methyltransferase OS=Rosa chinensis GN=COMT1 PE=2 SV=1 149 335 2.0E-10
sp|Q43046|COMT1_POPKI Caffeic acid 3-O-methyltransferase 1 OS=Populus kitakamiensis GN=HOMT1 PE=3 SV=1 149 337 2.0E-10
sp|P28002|COMT1_MEDSA Caffeic acid 3-O-methyltransferase OS=Medicago sativa PE=1 SV=1 149 335 4.0E-10
sp|Q54GZ0|OMT9_DICDI O-methyltransferase 9 OS=Dictyostelium discoideum GN=omt9 PE=3 SV=1 1 334 4.0E-10
sp|Q54527|RDMB_STREF Aclacinomycin 10-hydroxylase RdmB OS=Streptomyces purpurascens GN=rdmB PE=1 SV=1 17 321 5.0E-10
sp|Q84KK5|D7OMT_GLYEC Isoflavone 7-O-methyltransferase OS=Glycyrrhiza echinata GN=D7OMT PE=1 SV=1 149 335 7.0E-10
sp|Q41086|COMT2_POPTM Caffeic acid 3-O-methyltransferase 2 OS=Populus tremuloides GN=OMT2 PE=3 SV=1 147 337 2.0E-09
sp|Q8LL87|COMT1_COFCA Caffeic acid 3-O-methyltransferase OS=Coffea canephora PE=2 SV=1 149 323 2.0E-09
sp|C7SDN9|N7OMT_PAPSO Norreticuline-7-O-methyltransferase OS=Papaver somniferum PE=1 SV=1 59 319 2.0E-09
sp|Q43609|COMT1_PRUDU Caffeic acid 3-O-methyltransferase OS=Prunus dulcis GN=COMT1 PE=2 SV=1 149 335 3.0E-09
sp|O23760|COMT1_CLABR Caffeic acid 3-O-methyltransferase OS=Clarkia breweri GN=COMT PE=1 SV=1 149 324 4.0E-09
sp|Q6T1F6|BMT_AMMMJ Bergaptol O-methyltransferase OS=Ammi majus GN=BMT PE=1 SV=1 80 319 4.0E-09
sp|P10950|ASMT_BOVIN Acetylserotonin O-methyltransferase OS=Bos taurus GN=ASMT PE=1 SV=2 148 330 4.0E-09
sp|Q8W013|COMT1_CATRO Caffeic acid 3-O-methyltransferase OS=Catharanthus roseus GN=COMT1 PE=2 SV=1 149 319 8.0E-09
sp|Q8T638|DMTA_DICDI Des-methyl DIF-1 methyltransferase A OS=Dictyostelium discoideum GN=dmtA PE=1 SV=1 23 309 9.0E-09
sp|Q43047|COMT3_POPKI Caffeic acid 3-O-methyltransferase 3 OS=Populus kitakamiensis GN=HOMT3 PE=3 SV=1 147 337 1.0E-08
sp|Q6WUC1|6OMT_PAPSO (RS)-norcoclaurine 6-O-methyltransferase OS=Papaver somniferum GN=6OMT PE=1 SV=1 91 335 1.0E-08
sp|Q6T1F5|COMT1_AMMMJ Caffeic acid 3-O-methyltransferase OS=Ammi majus GN=COMT PE=1 SV=1 149 313 1.0E-08
sp|Q54S95|OMT7_DICDI O-methyltransferase 7 OS=Dictyostelium discoideum GN=omt7 PE=3 SV=1 149 263 3.0E-08
sp|Q38J50|FOMT2_WHEAT Tricetin 3',4',5'-O-trimethyltransferase OS=Triticum aestivum GN=OMT2 PE=1 SV=1 149 324 3.0E-08
sp|Q9FQY8|COMT1_CAPAN Caffeic acid 3-O-methyltransferase OS=Capsicum annuum GN=COMT PE=2 SV=2 149 323 3.0E-08
sp|B0EXJ8|HTOMT_CATRO Tabersonine 16-O-methyltransferase OS=Catharanthus roseus GN=16OMT PE=1 SV=1 147 335 4.0E-08
sp|B3GSH5|ASMT_RAT Acetylserotonin O-methyltransferase OS=Rattus norvegicus GN=Asmt PE=1 SV=1 148 258 5.0E-08
sp|Q9XGV9|COMT2_OCIBA Caffeic acid 3-O-methyltransferase 2 OS=Ocimum basilicum GN=COMT2 PE=2 SV=1 149 319 7.0E-08
sp|Q6VMW0|Q8OMT_MENPI 8-hydroxyquercetin 8-O-methyltransferase OS=Mentha piperita GN=OMT2 PE=1 SV=1 191 335 9.0E-08
sp|O04385|IEMT_CLABR (Iso)eugenol O-methyltransferase OS=Clarkia breweri GN=IEMT1 PE=1 SV=2 149 324 9.0E-08
sp|Q43239|COMT1_ZINVI Caffeic acid 3-O-methyltransferase OS=Zinnia violacea PE=2 SV=1 91 319 1.0E-07
sp|A8J6X1|BMT_GLELI Bergaptol O-methyltransferase OS=Glehnia littoralis GN=BMT PE=1 SV=1 80 323 2.0E-07
sp|Q55216|DNRK_STRS5 Carminomycin 4-O-methyltransferase DauK OS=Streptomyces sp. (strain C5) GN=dauK PE=1 SV=1 16 324 4.0E-07
sp|O22308|7OMT6_MEDSA Isoflavone-7-O-methyltransferase 6 OS=Medicago sativa PE=2 SV=1 149 335 5.0E-07
sp|D3KU67|ASMT_MUSMM Acetylserotonin O-methyltransferase OS=Mus musculus molossinus GN=Asmt PE=2 SV=1 148 260 5.0E-07
sp|D3KU66|ASMT_MOUSE Acetylserotonin O-methyltransferase OS=Mus musculus GN=Asmt PE=2 SV=1 148 260 6.0E-07
sp|P59049|OMT1_CHRAE Quercetin 3-O-methyltransferase 1 OS=Chrysosplenium americanum GN=OMT1 PE=1 SV=1 149 335 6.0E-07
sp|Q42653|OMT2_CHRAE Quercetin 3-O-methyltransferase 2 OS=Chrysosplenium americanum GN=OMT2 PE=1 SV=1 149 335 7.0E-07
sp|Q9FK25|OMT1_ARATH Flavone 3'-O-methyltransferase 1 OS=Arabidopsis thaliana GN=OMT1 PE=1 SV=1 149 319 8.0E-07
sp|Q06528|DNRK_STRPE Carminomycin 4-O-methyltransferase DnrK OS=Streptomyces peucetius GN=dnrK PE=1 SV=2 16 324 1.0E-06
sp|O95671|ASML_HUMAN N-acetylserotonin O-methyltransferase-like protein OS=Homo sapiens GN=ASMTL PE=1 SV=3 150 258 2.0E-06
[Show less]

GO

GO Term Description Terminal node
GO:0008171 O-methyltransferase activity Yes
GO:0003824 catalytic activity No
GO:0003674 molecular_function No
GO:0008168 methyltransferase activity No
GO:0016740 transferase activity No
GO:0016741 transferase activity, transferring one-carbon groups No

Deeploc

Deeploc data not available for this genome

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

No expression data available for this genome

Orthologs

Orthofinder run ID4
Orthogroup30
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|7767
Ophiocordyceps australis 1348a (Ghana) OphauG2|7346
Ophiocordyceps australis 1348a (Ghana) OphauG2|7110
Ophiocordyceps australis 1348a (Ghana) OphauG2|4885
Ophiocordyceps australis 1348a (Ghana) OphauG2|4306
Ophiocordyceps australis 1348a (Ghana) OphauG2|3956
Ophiocordyceps australis 1348a (Ghana) OphauG2|1539
Ophiocordyceps australis 1348a (Ghana) OphauG2|1895
Ophiocordyceps australis 1348a (Ghana) OphauG2|266
Ophiocordyceps australis map64 (Brazil) OphauB2|758
Ophiocordyceps australis map64 (Brazil) OphauB2|1462
Ophiocordyceps australis map64 (Brazil) OphauB2|2012
Ophiocordyceps australis map64 (Brazil) OphauB2|4017
Ophiocordyceps australis map64 (Brazil) OphauB2|4564
Ophiocordyceps australis map64 (Brazil) OphauB2|7299 (this protein)
Ophiocordyceps camponoti-rufipedis Ophun1|2861
Ophiocordyceps camponoti-rufipedis Ophun1|2000
Ophiocordyceps subramaniannii Hirsu2|8115
Ophiocordyceps subramaniannii Hirsu2|7926
Ophiocordyceps subramaniannii Hirsu2|6259
Ophiocordyceps subramaniannii Hirsu2|2878
Ophiocordyceps subramaniannii Hirsu2|1201
Ophiocordyceps subramaniannii Hirsu2|11082

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >OphauB2|7299
MDAANILGQAALDAHAIAAKTDMEADAIARHLRALSNVHIFNEVSPNVFKNNEASLLLQQESAKALVGLGAEEGR
MSCYKQWEALSGKRSGQTGFNLAYQTDLSVYDYWKQVRPDWGQRAARAFSSNVGNLEQYLALYPWAKEPDGALVV
DVGGGIGGATLPIIKRFTNLKLQVQDREENGLEFIKHLENDFPTVAASHRASFIEQDFFQPNKTPRADVYFMRHI
LHNWPDASAKALLGKLSAAMSPSSKLLLCEHVVYPAYRDVEGRGEMDEAVAPEPLLANWGDVYTSRMDVMMLAAL
GARERSRREVEALVGGVGLVVWRVWRNMGTEAIVECRLCE*
Coding >OphauB2|7299
ATGGACGCTGCGAATATCCTGGGCCAAGCCGCGCTCGACGCACACGCCATTGCCGCCAAGACGGACATGGAAGCC
GATGCTATAGCGCGACATTTGCGAGCGCTGAGCAATGTGCACATTTTTAACGAGGTGTCGCCCAATGTGTTTAAA
AACAATGAGGCTTCTCTCCTGCTGCAGCAAGAATCAGCCAAGGCTCTGGTTGGACTGGGCGCAGAAGAAGGCCGC
ATGTCTTGCTACAAGCAATGGGAGGCGCTGAGTGGGAAAAGGAGTGGGCAAACGGGCTTCAACTTGGCTTATCAG
ACTGACTTGAGCGTCTATGATTACTGGAAACAGGTCCGTCCCGACTGGGGCCAGCGAGCAGCTCGAGCGTTTTCC
AGTAATGTTGGTAATCTGGAGCAGTACTTGGCGTTGTATCCTTGGGCAAAAGAGCCAGATGGGGCGTTGGTGGTG
GATGTAGGGGGGGGGATTGGAGGAGCAACGTTGCCCATTATAAAGAGATTTACCAACCTGAAGCTTCAAGTACAG
GACCGAGAGGAAAATGGACTCGAGTTTATCAAGCACCTCGAAAACGATTTCCCCACCGTGGCAGCATCGCATCGG
GCAAGTTTTATCGAGCAAGACTTTTTCCAACCCAACAAGACACCCCGGGCAGACGTCTACTTTATGCGGCACATT
CTACACAACTGGCCCGACGCCAGTGCAAAAGCCCTGCTGGGCAAGCTCTCTGCCGCCATGTCGCCGAGCAGCAAG
CTCTTGCTTTGCGAGCACGTGGTGTATCCAGCGTACCGCGACGTGGAGGGGCGGGGGGAGATGGACGAGGCTGTG
GCGCCGGAGCCGTTGCTGGCGAATTGGGGGGATGTGTATACGAGTCGCATGGACGTGATGATGCTGGCGGCGCTG
GGGGCGAGGGAGCGAAGTAGAAGAGAGGTGGAGGCCTTGGTGGGTGGAGTGGGCTTGGTGGTGTGGCGGGTGTGG
AGGAATATGGGAACAGAGGCGATTGTCGAGTGTAGGCTTTGTGAGTGA
Transcript >OphauB2|7299
ATGGACGCTGCGAATATCCTGGGCCAAGCCGCGCTCGACGCACACGCCATTGCCGCCAAGACGGACATGGAAGCC
GATGCTATAGCGCGACATTTGCGAGCGCTGAGCAATGTGCACATTTTTAACGAGGTGTCGCCCAATGTGTTTAAA
AACAATGAGGCTTCTCTCCTGCTGCAGCAAGAATCAGCCAAGGCTCTGGTTGGACTGGGCGCAGAAGAAGGCCGC
ATGTCTTGCTACAAGCAATGGGAGGCGCTGAGTGGGAAAAGGAGTGGGCAAACGGGCTTCAACTTGGCTTATCAG
ACTGACTTGAGCGTCTATGATTACTGGAAACAGGTCCGTCCCGACTGGGGCCAGCGAGCAGCTCGAGCGTTTTCC
AGTAATGTTGGTAATCTGGAGCAGTACTTGGCGTTGTATCCTTGGGCAAAAGAGCCAGATGGGGCGTTGGTGGTG
GATGTAGGGGGGGGGATTGGAGGAGCAACGTTGCCCATTATAAAGAGATTTACCAACCTGAAGCTTCAAGTACAG
GACCGAGAGGAAAATGGACTCGAGTTTATCAAGCACCTCGAAAACGATTTCCCCACCGTGGCAGCATCGCATCGG
GCAAGTTTTATCGAGCAAGACTTTTTCCAACCCAACAAGACACCCCGGGCAGACGTCTACTTTATGCGGCACATT
CTACACAACTGGCCCGACGCCAGTGCAAAAGCCCTGCTGGGCAAGCTCTCTGCCGCCATGTCGCCGAGCAGCAAG
CTCTTGCTTTGCGAGCACGTGGTGTATCCAGCGTACCGCGACGTGGAGGGGCGGGGGGAGATGGACGAGGCTGTG
GCGCCGGAGCCGTTGCTGGCGAATTGGGGGGATGTGTATACGAGTCGCATGGACGTGATGATGCTGGCGGCGCTG
GGGGCGAGGGAGCGAAGTAGAAGAGAGGTGGAGGCCTTGGTGGGTGGAGTGGGCTTGGTGGTGTGGCGGGTGTGG
AGGAATATGGGAACAGAGGCGATTGTCGAGTGTAGGCTTTGTGAGTGA
Gene >OphauB2|7299
ATGGACGCTGCGAATATCCTGGGCCAAGCCGCGCTCGACGCACACGCCATTGCCGCCAAGACGGACATGGAAGCC
GATGCTATAGCGCGACATTTGCGAGCGCTGAGCAATGTGCACATTTTTAACGAGGTGTCGCCCAATGTGTTTAAA
AACAATGAGGCTTCTCTCCTGCTGCAGCAAGAATCAGCCAAGGCTCTGGTTGGACTGGGGTGAGTTGAATCCTAA
AAGAACAAGAAAAACGCACGACTAGAAATTGGGCTAAGCAGTATGCAGCGCAGAAGAAGGCCGCATGTCTTGCTA
CAAGCAATGGGAGGCGCTGAGTGGGAAAAGGAGTGGGCAAACGGGCTTCAACTTGGCTTATCAGACTGACTTGAG
CGTCTATGATTACTGGAAACAGGTCCGTCCCGACTGGGGCCAGCGAGCAGCTCGAGCGTTTTCCAGTAATGTTGG
TAATCTGGAGCAGTACTTGGCGTGTGAGTTGGAGATGCGCGGTTGAAGGTACAGGTTGGCTAATGGGTGGTAAAA
GTGTATCCTTGGGCAAAAGAGCCAGATGGGGCGTTGGTGGTGGATGTAGGGGGGGGGATTGGAGGAGCAACGTTG
CCCATTATAAAGAGATTTACCAACCTGAAGCTTCAAGTACAGGACCGAGAGGAAAATGGACTCGAGTTTATCAAG
GTATGCGACGCGTTTAAAGGAGTCACGGGGGGTAGCTAACCACGAGATTTTCCAATATCAAAAATTGGACAGCAC
CTCGAAAACGATTTCCCCACCGTGGCAGCATCGCATCGGGCAAGTTTTATCGAGCAAGACTTTTTCCAACCCAAC
AAGACACCCCGGGCAGACGTCTACTTTATGCGGCACATTCTACACAACTGGCCCGACGCCAGTGCAAAAGCCCTG
CTGGGCAAGCTCTCTGCCGCCATGTCGCCGAGCAGCAAGCTCTTGCTTTGCGAGCACGTGGTGTATCCAGCGTAC
CGCGACGTGGAGGGGCGGGGGGAGATGGACGAGGCTGTGGCGCCGGAGCCGTTGCTGGCGAATTGGGGGGATGTG
TATACGAGTCGCATGGACGTGATGATGCTGGCGGCGCTGGGGGCGAGGGAGCGAAGTAGAAGAGAGGTGGAGGCC
TTGGTGGGTGGAGTGGGCTTGGTGGTGTGGCGGGTGTGGAGGAATATGGGAACAGAGGCGATTGTCGAGTGTAGG
CTTTGTGAGTGA

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail