Fungal Genomics

at Utrecht University

General Properties

Protein IDOphauB2|7295
Gene name
LocationContig_76:89959..90586
Strand-
Gene length (bp)627
Transcript length (bp)555
Coding sequence length (bp)555
Protein length (aa) 185

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

(None)

Swissprot hits

(None)

GO

(None)

Deeploc

Deeploc data not available for this genome

SignalP

SignalP signal predicted Location Score
Yes 1 - 27 0.999744

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

No expression data available for this genome

Orthologs

Orthofinder run ID4
Orthogroup5146
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|455
Ophiocordyceps australis map64 (Brazil) OphauB2|264
Ophiocordyceps australis map64 (Brazil) OphauB2|7295 (this protein)
Ophiocordyceps camponoti-rufipedis Ophun1|2525
Ophiocordyceps kimflemingae Ophio5|7787
Ophiocordyceps subramaniannii Hirsu2|3556

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >OphauB2|7295
MKLSAVIISYIGIAAAIPLPITELSRRAPAQAEHIPSFAEKFAAGLALPGPSLATGTFGSLWSATGASAGAAAGA
GAASVGRVVGGAPSVGRVLGGGSVRAPDLGPGPVKPLRFPSTNPPGSAPHSNGGGGLAGNGPVGGGSIQRNVDAG
ALGRNVAPGAGLLPQDSISFGRLRFPLLRDSWFL*
Coding >OphauB2|7295
ATGAAGCTCTCTGCAGTCATCATTTCTTACATTGGCATAGCTGCGGCTATCCCACTACCAATCACAGAGCTATCT
AGACGAGCGCCCGCACAAGCTGAGCATATACCTAGTTTTGCTGAAAAGTTTGCTGCGGGACTTGCGCTCCCTGGT
CCTAGCCTTGCTACTGGCACTTTTGGTAGCCTGTGGAGCGCTACTGGTGCTAGCGCTGGTGCTGCTGCTGGTGCT
GGTGCTGCTAGTGTCGGCCGTGTCGTCGGTGGTGCTCCTAGTGTCGGCCGTGTCCTCGGTGGTGGTTCGGTTCGT
GCCCCAGATCTGGGTCCTGGACCTGTCAAACCGTTGCGGTTCCCAAGTACGAATCCACCGGGATCGGCGCCGCAC
TCGAATGGGGGGGGAGGTCTTGCTGGTAATGGACCTGTTGGAGGAGGTTCGATACAAAGGAATGTGGATGCTGGA
GCGCTGGGGAGAAACGTTGCGCCAGGTGCAGGACTTTTACCACAAGACTCTATTAGTTTCGGACGCCTTCGTTTC
CCATTATTGAGAGATTCTTGGTTTTTATAG
Transcript >OphauB2|7295
ATGAAGCTCTCTGCAGTCATCATTTCTTACATTGGCATAGCTGCGGCTATCCCACTACCAATCACAGAGCTATCT
AGACGAGCGCCCGCACAAGCTGAGCATATACCTAGTTTTGCTGAAAAGTTTGCTGCGGGACTTGCGCTCCCTGGT
CCTAGCCTTGCTACTGGCACTTTTGGTAGCCTGTGGAGCGCTACTGGTGCTAGCGCTGGTGCTGCTGCTGGTGCT
GGTGCTGCTAGTGTCGGCCGTGTCGTCGGTGGTGCTCCTAGTGTCGGCCGTGTCCTCGGTGGTGGTTCGGTTCGT
GCCCCAGATCTGGGTCCTGGACCTGTCAAACCGTTGCGGTTCCCAAGTACGAATCCACCGGGATCGGCGCCGCAC
TCGAATGGGGGGGGAGGTCTTGCTGGTAATGGACCTGTTGGAGGAGGTTCGATACAAAGGAATGTGGATGCTGGA
GCGCTGGGGAGAAACGTTGCGCCAGGTGCAGGACTTTTACCACAAGACTCTATTAGTTTCGGACGCCTTCGTTTC
CCATTATTGAGAGATTCTTGGTTTTTATAG
Gene >OphauB2|7295
ATGAAGCTCTCTGCAGTCATCATTTCTTACATTGGCATAGCTGCGGCTATCCCACTACCAATCACAGAGCTATCT
AGACGAGCGCCCGCACAAGCTGAGCATATACCTAGTTTTGCTGAAAAGTTTGCTGCGGGACTTGCGGTAAATAGC
CACGACTCAAAGCGCCTCAACTTGCAAGCAACAGGCTAATACATAAAGATATTAACTCGTTAGCTCCCTGGTCCT
AGCCTTGCTACTGGCACTTTTGGTAGCCTGTGGAGCGCTACTGGTGCTAGCGCTGGTGCTGCTGCTGGTGCTGGT
GCTGCTAGTGTCGGCCGTGTCGTCGGTGGTGCTCCTAGTGTCGGCCGTGTCCTCGGTGGTGGTTCGGTTCGTGCC
CCAGATCTGGGTCCTGGACCTGTCAAACCGTTGCGGTTCCCAAGTACGAATCCACCGGGATCGGCGCCGCACTCG
AATGGGGGGGGAGGTCTTGCTGGTAATGGACCTGTTGGAGGAGGTTCGATACAAAGGAATGTGGATGCTGGAGCG
CTGGGGAGAAACGTTGCGCCAGGTGCAGGACTTTTACCACAAGACTCTATTAGTTTCGGACGCCTTCGTTTCCCA
TTATTGAGAGATTCTTGGTTTTTATAG

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail