Fungal Genomics

at Utrecht University

General Properties

Protein IDOphauB2|7292
Gene name
LocationContig_76:80148..81168
Strand+
Gene length (bp)1020
Transcript length (bp)969
Coding sequence length (bp)969
Protein length (aa) 323

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF13622 4HBT_3 Thioesterase-like superfamily 3.5E-46 24 303

Swissprot hits

(None)

GO

(None)

Deeploc

Deeploc data not available for this genome

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

No expression data available for this genome

Orthologs

Orthofinder run ID4
Orthogroup752
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|971
Ophiocordyceps australis map64 (Brazil) OphauB2|7292 (this protein)
Ophiocordyceps camponoti-floridani Ophcf2|01300
Ophiocordyceps camponoti-rufipedis Ophun1|2654
Ophiocordyceps kimflemingae Ophio5|2780
Ophiocordyceps kimflemingae Ophio5|6509
Ophiocordyceps subramaniannii Hirsu2|2211
Ophiocordyceps subramaniannii Hirsu2|7132

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >OphauB2|7292
MEASLEEKTRVERLDQYTYAAELSEAFCVGMVPHGGYVASIFLRAAREHATSFGQPDAIAVHWQFLSKTAAGRAV
LRIDEVRKGRAMSVLHVSLFQGKLPSEAPWVSPSTEPCVVAYITCRDIASESGISLPTNWSLPLPPPPANLSSLP
RRLAGDKWSPFWARIMDVLPPFRSLEYYCPADADPLRPHLHLDFWLRLSQPNARFSETDLGFLADAVAPLILESY
RPGKHDTAAPYFPRSKAFWYPTITMSLDVKKKLPPGGAEWLRIHTEAKVIRNGRLDSEVIMFDSEGDVVALSHHV
AMIVDVERNFGPRDSAKSKSKM*
Coding >OphauB2|7292
ATGGAGGCCTCTCTCGAGGAAAAGACGCGCGTTGAGCGGCTTGATCAATATACATACGCGGCAGAGCTATCAGAG
GCATTCTGCGTAGGAATGGTGCCTCATGGTGGTTATGTTGCCTCTATTTTTCTGCGCGCAGCTAGAGAACATGCG
ACATCCTTTGGGCAGCCTGACGCTATAGCTGTGCACTGGCAATTTTTATCGAAAACAGCGGCTGGCAGGGCCGTG
TTGCGGATCGACGAGGTTCGCAAAGGCAGGGCCATGTCGGTTCTACATGTTTCTTTATTTCAAGGCAAGCTGCCG
TCAGAAGCGCCCTGGGTCTCCCCGTCGACTGAGCCTTGCGTGGTGGCCTACATTACTTGCCGCGACATTGCTTCA
GAATCTGGAATCTCGCTGCCTACAAACTGGTCGCTACCTCTTCCGCCTCCGCCAGCAAATCTTTCCTCTCTGCCA
AGAAGACTTGCTGGCGACAAATGGTCTCCGTTTTGGGCGCGCATCATGGACGTTTTACCCCCCTTTAGGAGCCTA
GAGTATTATTGTCCTGCTGATGCCGATCCTCTTCGTCCTCACCTGCACCTCGACTTTTGGCTGCGTCTTTCCCAA
CCGAATGCTCGCTTCTCGGAAACCGACTTGGGATTTCTTGCCGATGCTGTCGCACCACTTATCCTCGAGTCATAT
CGTCCGGGGAAGCATGATACGGCTGCGCCTTACTTTCCTCGCAGCAAGGCCTTTTGGTATCCGACGATTACCATG
AGTCTTGATGTTAAGAAGAAACTGCCGCCTGGTGGGGCTGAGTGGCTGCGAATTCACACGGAGGCAAAAGTGATT
CGCAACGGGCGGCTCGACTCAGAAGTCATCATGTTTGACAGCGAGGGGGATGTGGTTGCCTTGAGCCACCACGTT
GCCATGATTGTCGATGTGGAGCGCAATTTTGGTCCGCGGGATAGCGCAAAGAGCAAAAGCAAGATGTAG
Transcript >OphauB2|7292
ATGGAGGCCTCTCTCGAGGAAAAGACGCGCGTTGAGCGGCTTGATCAATATACATACGCGGCAGAGCTATCAGAG
GCATTCTGCGTAGGAATGGTGCCTCATGGTGGTTATGTTGCCTCTATTTTTCTGCGCGCAGCTAGAGAACATGCG
ACATCCTTTGGGCAGCCTGACGCTATAGCTGTGCACTGGCAATTTTTATCGAAAACAGCGGCTGGCAGGGCCGTG
TTGCGGATCGACGAGGTTCGCAAAGGCAGGGCCATGTCGGTTCTACATGTTTCTTTATTTCAAGGCAAGCTGCCG
TCAGAAGCGCCCTGGGTCTCCCCGTCGACTGAGCCTTGCGTGGTGGCCTACATTACTTGCCGCGACATTGCTTCA
GAATCTGGAATCTCGCTGCCTACAAACTGGTCGCTACCTCTTCCGCCTCCGCCAGCAAATCTTTCCTCTCTGCCA
AGAAGACTTGCTGGCGACAAATGGTCTCCGTTTTGGGCGCGCATCATGGACGTTTTACCCCCCTTTAGGAGCCTA
GAGTATTATTGTCCTGCTGATGCCGATCCTCTTCGTCCTCACCTGCACCTCGACTTTTGGCTGCGTCTTTCCCAA
CCGAATGCTCGCTTCTCGGAAACCGACTTGGGATTTCTTGCCGATGCTGTCGCACCACTTATCCTCGAGTCATAT
CGTCCGGGGAAGCATGATACGGCTGCGCCTTACTTTCCTCGCAGCAAGGCCTTTTGGTATCCGACGATTACCATG
AGTCTTGATGTTAAGAAGAAACTGCCGCCTGGTGGGGCTGAGTGGCTGCGAATTCACACGGAGGCAAAAGTGATT
CGCAACGGGCGGCTCGACTCAGAAGTCATCATGTTTGACAGCGAGGGGGATGTGGTTGCCTTGAGCCACCACGTT
GCCATGATTGTCGATGTGGAGCGCAATTTTGGTCCGCGGGATAGCGCAAAGAGCAAAAGCAAGATGTAG
Gene >OphauB2|7292
ATGGAGGCCTCTCTCGAGGAAAAGACGCGCGTTGAGCGGCTTGATCAATATACATACGCGGCAGAGCTATCAGAG
GCATTCTGCGTAGGAATGGGTATGTCACTGCATCTTTGGGAGCCGAGCTCTTGAGCTAATTGACGTCTAGTGCCT
CATGGTGGTTATGTTGCCTCTATTTTTCTGCGCGCAGCTAGAGAACATGCGACATCCTTTGGGCAGCCTGACGCT
ATAGCTGTGCACTGGCAATTTTTATCGAAAACAGCGGCTGGCAGGGCCGTGTTGCGGATCGACGAGGTTCGCAAA
GGCAGGGCCATGTCGGTTCTACATGTTTCTTTATTTCAAGGCAAGCTGCCGTCAGAAGCGCCCTGGGTCTCCCCG
TCGACTGAGCCTTGCGTGGTGGCCTACATTACTTGCCGCGACATTGCTTCAGAATCTGGAATCTCGCTGCCTACA
AACTGGTCGCTACCTCTTCCGCCTCCGCCAGCAAATCTTTCCTCTCTGCCAAGAAGACTTGCTGGCGACAAATGG
TCTCCGTTTTGGGCGCGCATCATGGACGTTTTACCCCCCTTTAGGAGCCTAGAGTATTATTGTCCTGCTGATGCC
GATCCTCTTCGTCCTCACCTGCACCTCGACTTTTGGCTGCGTCTTTCCCAACCGAATGCTCGCTTCTCGGAAACC
GACTTGGGATTTCTTGCCGATGCTGTCGCACCACTTATCCTCGAGTCATATCGTCCGGGGAAGCATGATACGGCT
GCGCCTTACTTTCCTCGCAGCAAGGCCTTTTGGTATCCGACGATTACCATGAGTCTTGATGTTAAGAAGAAACTG
CCGCCTGGTGGGGCTGAGTGGCTGCGAATTCACACGGAGGCAAAAGTGATTCGCAACGGGCGGCTCGACTCAGAA
GTCATCATGTTTGACAGCGAGGGGGATGTGGTTGCCTTGAGCCACCACGTTGCCATGATTGTCGATGTGGAGCGC
AATTTTGGTCCGCGGGATAGCGCAAAGAGCAAAAGCAAGATGTAG

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail