Fungal Genomics

at Utrecht University

General Properties

Protein IDOphauB2|729
Gene name
LocationContig_114:42130..43336
Strand-
Gene length (bp)1206
Transcript length (bp)1206
Coding sequence length (bp)1206
Protein length (aa) 402

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF05721 PhyH Phytanoyl-CoA dioxygenase (PhyH) 4.6E-23 121 290

Swissprot hits

(None)

GO

(None)

Deeploc

Deeploc data not available for this genome

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

No expression data available for this genome

Orthologs

Orthofinder run ID4
Orthogroup2386
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|4242
Ophiocordyceps australis map64 (Brazil) OphauB2|729 (this protein)
Ophiocordyceps camponoti-floridani Ophcf2|03017
Ophiocordyceps camponoti-rufipedis Ophun1|3921
Ophiocordyceps kimflemingae Ophio5|2679
Ophiocordyceps subramaniannii Hirsu2|3353

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >OphauB2|729
MTSFNQDSNKSDNFLAHPDTRNRLFPPCRVSDLAALCSQQALPQDYPLASSISKSIPIYSLPPFDSLSDSQRAAL
QDEWYRVLLSGPGVLVIKALYPCSLIHRVSSVFRSIMQSQQPTGDHFAPAASNDRIWDALSKHCLADPASFTLYY
SNPLLGLVASSWLGPVYRITAQVNNVRPGGAAQSCHRDYHLGFSSPSACVQVPAAAQVASQCLTLQAGVAHGPVP
LQSGPTRVLPFSQGYAPGYLAYRQPDFAQFFQDNHVALPLEAGDAIFFNPALFHAAGSNESQKNRLVNLLQIGSA
WSKTMEAGDAIPLIDSCWDDMKKLYAERGMLDVTRLMAAVAEGYPFPTNLDQNPPKADGMAPMSEQDVVMDSLKN
DETKGQVVHKINSLRQASKALGRVKP*
Coding >OphauB2|729
ATGACTTCCTTCAACCAAGACAGCAACAAGTCAGACAATTTCCTTGCCCATCCGGATACTCGTAATCGTCTCTTC
CCCCCGTGTCGCGTCTCTGACCTTGCCGCTCTGTGCTCCCAGCAAGCTCTACCACAAGACTACCCCCTTGCCTCT
AGCATTTCAAAAAGTATCCCCATTTACTCTCTGCCGCCATTCGACTCTCTGTCCGACTCGCAGCGCGCCGCCCTC
CAAGATGAATGGTATCGTGTCCTTCTCTCCGGGCCCGGCGTCTTGGTCATAAAGGCTCTCTACCCTTGCTCTCTC
ATTCATCGCGTATCCTCCGTCTTTCGCTCCATCATGCAGTCCCAGCAGCCCACGGGCGACCACTTTGCTCCCGCC
GCCTCAAATGACCGCATCTGGGACGCGCTGTCAAAGCATTGCCTCGCCGACCCGGCCTCCTTTACCCTCTACTAC
TCCAACCCGCTCCTCGGTCTCGTCGCTTCCAGTTGGCTAGGGCCGGTCTACCGCATCACTGCTCAGGTCAACAAT
GTCCGTCCCGGTGGTGCCGCTCAGTCCTGTCACCGTGACTACCACTTGGGCTTTTCTTCGCCCAGTGCCTGTGTT
CAAGTGCCCGCCGCAGCACAGGTCGCCAGCCAGTGTCTTACCCTCCAGGCTGGCGTTGCTCATGGCCCGGTCCCC
CTACAAAGTGGACCAACACGGGTGCTGCCTTTTAGCCAGGGCTATGCGCCCGGCTACCTGGCCTATAGACAGCCT
GACTTTGCACAATTCTTCCAAGACAACCATGTCGCGTTACCGCTTGAGGCGGGAGACGCAATCTTTTTCAATCCA
GCTCTCTTTCATGCTGCCGGAAGCAATGAGTCCCAAAAAAACCGATTGGTCAATCTGCTGCAAATTGGCAGTGCT
TGGAGCAAGACAATGGAAGCAGGCGATGCGATACCTTTGATTGACTCTTGTTGGGACGACATGAAGAAGCTCTAT
GCCGAGAGGGGCATGCTAGACGTGACACGGCTCATGGCAGCCGTTGCAGAGGGGTATCCCTTTCCAACAAACCTT
GATCAGAATCCACCCAAAGCAGATGGAATGGCGCCCATGTCAGAGCAGGACGTGGTGATGGACTCACTCAAAAAC
GACGAAACCAAAGGCCAAGTCGTTCACAAAATCAATAGTCTTAGGCAGGCTTCCAAGGCCCTTGGACGAGTCAAG
CCATGA
Transcript >OphauB2|729
ATGACTTCCTTCAACCAAGACAGCAACAAGTCAGACAATTTCCTTGCCCATCCGGATACTCGTAATCGTCTCTTC
CCCCCGTGTCGCGTCTCTGACCTTGCCGCTCTGTGCTCCCAGCAAGCTCTACCACAAGACTACCCCCTTGCCTCT
AGCATTTCAAAAAGTATCCCCATTTACTCTCTGCCGCCATTCGACTCTCTGTCCGACTCGCAGCGCGCCGCCCTC
CAAGATGAATGGTATCGTGTCCTTCTCTCCGGGCCCGGCGTCTTGGTCATAAAGGCTCTCTACCCTTGCTCTCTC
ATTCATCGCGTATCCTCCGTCTTTCGCTCCATCATGCAGTCCCAGCAGCCCACGGGCGACCACTTTGCTCCCGCC
GCCTCAAATGACCGCATCTGGGACGCGCTGTCAAAGCATTGCCTCGCCGACCCGGCCTCCTTTACCCTCTACTAC
TCCAACCCGCTCCTCGGTCTCGTCGCTTCCAGTTGGCTAGGGCCGGTCTACCGCATCACTGCTCAGGTCAACAAT
GTCCGTCCCGGTGGTGCCGCTCAGTCCTGTCACCGTGACTACCACTTGGGCTTTTCTTCGCCCAGTGCCTGTGTT
CAAGTGCCCGCCGCAGCACAGGTCGCCAGCCAGTGTCTTACCCTCCAGGCTGGCGTTGCTCATGGCCCGGTCCCC
CTACAAAGTGGACCAACACGGGTGCTGCCTTTTAGCCAGGGCTATGCGCCCGGCTACCTGGCCTATAGACAGCCT
GACTTTGCACAATTCTTCCAAGACAACCATGTCGCGTTACCGCTTGAGGCGGGAGACGCAATCTTTTTCAATCCA
GCTCTCTTTCATGCTGCCGGAAGCAATGAGTCCCAAAAAAACCGATTGGTCAATCTGCTGCAAATTGGCAGTGCT
TGGAGCAAGACAATGGAAGCAGGCGATGCGATACCTTTGATTGACTCTTGTTGGGACGACATGAAGAAGCTCTAT
GCCGAGAGGGGCATGCTAGACGTGACACGGCTCATGGCAGCCGTTGCAGAGGGGTATCCCTTTCCAACAAACCTT
GATCAGAATCCACCCAAAGCAGATGGAATGGCGCCCATGTCAGAGCAGGACGTGGTGATGGACTCACTCAAAAAC
GACGAAACCAAAGGCCAAGTCGTTCACAAAATCAATAGTCTTAGGCAGGCTTCCAAGGCCCTTGGACGAGTCAAG
CCATGA
Gene >OphauB2|729
ATGACTTCCTTCAACCAAGACAGCAACAAGTCAGACAATTTCCTTGCCCATCCGGATACTCGTAATCGTCTCTTC
CCCCCGTGTCGCGTCTCTGACCTTGCCGCTCTGTGCTCCCAGCAAGCTCTACCACAAGACTACCCCCTTGCCTCT
AGCATTTCAAAAAGTATCCCCATTTACTCTCTGCCGCCATTCGACTCTCTGTCCGACTCGCAGCGCGCCGCCCTC
CAAGATGAATGGTATCGTGTCCTTCTCTCCGGGCCCGGCGTCTTGGTCATAAAGGCTCTCTACCCTTGCTCTCTC
ATTCATCGCGTATCCTCCGTCTTTCGCTCCATCATGCAGTCCCAGCAGCCCACGGGCGACCACTTTGCTCCCGCC
GCCTCAAATGACCGCATCTGGGACGCGCTGTCAAAGCATTGCCTCGCCGACCCGGCCTCCTTTACCCTCTACTAC
TCCAACCCGCTCCTCGGTCTCGTCGCTTCCAGTTGGCTAGGGCCGGTCTACCGCATCACTGCTCAGGTCAACAAT
GTCCGTCCCGGTGGTGCCGCTCAGTCCTGTCACCGTGACTACCACTTGGGCTTTTCTTCGCCCAGTGCCTGTGTT
CAAGTGCCCGCCGCAGCACAGGTCGCCAGCCAGTGTCTTACCCTCCAGGCTGGCGTTGCTCATGGCCCGGTCCCC
CTACAAAGTGGACCAACACGGGTGCTGCCTTTTAGCCAGGGCTATGCGCCCGGCTACCTGGCCTATAGACAGCCT
GACTTTGCACAATTCTTCCAAGACAACCATGTCGCGTTACCGCTTGAGGCGGGAGACGCAATCTTTTTCAATCCA
GCTCTCTTTCATGCTGCCGGAAGCAATGAGTCCCAAAAAAACCGATTGGTCAATCTGCTGCAAATTGGCAGTGCT
TGGAGCAAGACAATGGAAGCAGGCGATGCGATACCTTTGATTGACTCTTGTTGGGACGACATGAAGAAGCTCTAT
GCCGAGAGGGGCATGCTAGACGTGACACGGCTCATGGCAGCCGTTGCAGAGGGGTATCCCTTTCCAACAAACCTT
GATCAGAATCCACCCAAAGCAGATGGAATGGCGCCCATGTCAGAGCAGGACGTGGTGATGGACTCACTCAAAAAC
GACGAAACCAAAGGCCAAGTCGTTCACAAAATCAATAGTCTTAGGCAGGCTTCCAAGGCCCTTGGACGAGTCAAG
CCATGA

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail