Fungal Genomics

at Utrecht University

General Properties

Protein IDOphauB2|7289
Gene name
LocationContig_76:72624..73712
Strand+
Gene length (bp)1088
Transcript length (bp)957
Coding sequence length (bp)957
Protein length (aa) 319

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF04488 Gly_transf_sug Glycosyltransferase sugar-binding region containing DXD motif 6.9E-09 87 160

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|P38287|CSH1_YEAST Mannosyl phosphorylinositol ceramide synthase CSH1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=CSH1 PE=1 SV=1 40 295 1.0E-31
sp|Q10323|IMT3_SCHPO Inositol phosphoceramide mannosyltransferase 3 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC17G8.11c PE=1 SV=1 69 292 1.0E-30
sp|Q9UT67|IMT2_SCHPO Inositol phosphoceramide mannosyltransferase 2 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPCC4F11.04c PE=3 SV=1 69 298 2.0E-30
sp|P33300|SUR1_YEAST Mannosyl phosphorylinositol ceramide synthase SUR1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=SUR1 PE=1 SV=1 60 295 2.0E-30
sp|O14084|IMT1_SCHPO Inositol phosphoceramide mannosyltransferase 1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=imt1 PE=3 SV=2 1 298 4.0E-19
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|P38287|CSH1_YEAST Mannosyl phosphorylinositol ceramide synthase CSH1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=CSH1 PE=1 SV=1 40 295 1.0E-31
sp|Q10323|IMT3_SCHPO Inositol phosphoceramide mannosyltransferase 3 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC17G8.11c PE=1 SV=1 69 292 1.0E-30
sp|Q9UT67|IMT2_SCHPO Inositol phosphoceramide mannosyltransferase 2 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPCC4F11.04c PE=3 SV=1 69 298 2.0E-30
sp|P33300|SUR1_YEAST Mannosyl phosphorylinositol ceramide synthase SUR1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=SUR1 PE=1 SV=1 60 295 2.0E-30
sp|O14084|IMT1_SCHPO Inositol phosphoceramide mannosyltransferase 1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=imt1 PE=3 SV=2 1 298 4.0E-19
sp|Q5UQW4|YL373_MIMIV Uncharacterized glycosyltransferase L373 OS=Acanthamoeba polyphaga mimivirus GN=MIMI_L373 PE=3 SV=1 69 193 3.0E-08
[Show less]

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 29 0.5

Transmembrane Domains

Domain # Start End Length
1 7 29 22
2 283 305 22

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >OphauB2|7289
MNSRLRRSLLGAVLALPLLVFLLLGVSGVSRLYGIHAGLALTEHQIQSEYSNSHSALRPLDEPAPPRPVPRILHF
IPSPDETPAQVAARDSCLRLHPTWEHKIWNDDAGRFLIATEFPWFLSTYDSLSHTVYRADALRYFVLRHAGGVVL
DSNTGCRTILEPLLYYPAWLPDHGSGRLLDTSVLGGEPEHPLWLLATSKFTAPSRFRAPLPSRYRESGPMFATHI
WQAYHASKDSSMPNLVRITSEGPEANNVFFFATEEGSKQRKLDEKVLGWAGSHSTEAAFLVIFGYAVAAGICLVI
FHAFWRHRRTQKGYRVVE*
Coding >OphauB2|7289
ATGAATTCAAGATTGCGCAGATCGTTGCTCGGAGCCGTCCTTGCCCTACCGCTGCTGGTGTTCTTGCTGCTGGGA
GTGTCCGGCGTCAGCCGCCTGTACGGTATTCACGCCGGCCTGGCGCTTACTGAGCATCAAATCCAATCCGAATAC
TCCAACTCGCATTCCGCCTTGCGGCCTCTGGACGAACCTGCTCCGCCTCGCCCAGTGCCTCGAATATTGCACTTC
ATTCCATCTCCTGATGAGACGCCTGCTCAGGTGGCGGCGCGGGATAGCTGCCTAAGACTACATCCAACGTGGGAG
CACAAGATATGGAATGACGACGCTGGCCGCTTTCTTATCGCCACAGAGTTCCCCTGGTTTTTGAGTACATACGAC
TCCCTTTCACATACCGTCTATCGAGCCGATGCCCTGCGTTACTTTGTCCTCCGACACGCGGGCGGCGTGGTGCTT
GATTCAAATACAGGTTGCCGTACCATCCTGGAACCACTTCTCTACTACCCTGCCTGGTTACCCGACCATGGCTCT
GGGCGTCTCCTAGATACTTCTGTCCTTGGCGGCGAGCCCGAGCACCCTCTATGGCTTCTCGCAACATCCAAATTT
ACAGCCCCATCGCGCTTTCGTGCCCCCTTACCCAGTAGATATCGCGAATCAGGGCCCATGTTTGCGACGCATATT
TGGCAGGCCTACCATGCATCCAAGGATTCTTCAATGCCGAATCTCGTGCGCATAACTTCCGAGGGCCCAGAAGCA
AACAATGTCTTCTTTTTTGCTACCGAAGAAGGAAGCAAACAAAGGAAACTTGATGAGAAAGTGCTAGGATGGGCC
GGAAGTCACAGTACAGAAGCGGCTTTCCTCGTCATTTTTGGTTACGCAGTTGCGGCTGGCATATGCCTTGTCATT
TTCCATGCATTCTGGCGGCATCGGAGGACCCAAAAGGGATACCGGGTCGTCGAGTAG
Transcript >OphauB2|7289
ATGAATTCAAGATTGCGCAGATCGTTGCTCGGAGCCGTCCTTGCCCTACCGCTGCTGGTGTTCTTGCTGCTGGGA
GTGTCCGGCGTCAGCCGCCTGTACGGTATTCACGCCGGCCTGGCGCTTACTGAGCATCAAATCCAATCCGAATAC
TCCAACTCGCATTCCGCCTTGCGGCCTCTGGACGAACCTGCTCCGCCTCGCCCAGTGCCTCGAATATTGCACTTC
ATTCCATCTCCTGATGAGACGCCTGCTCAGGTGGCGGCGCGGGATAGCTGCCTAAGACTACATCCAACGTGGGAG
CACAAGATATGGAATGACGACGCTGGCCGCTTTCTTATCGCCACAGAGTTCCCCTGGTTTTTGAGTACATACGAC
TCCCTTTCACATACCGTCTATCGAGCCGATGCCCTGCGTTACTTTGTCCTCCGACACGCGGGCGGCGTGGTGCTT
GATTCAAATACAGGTTGCCGTACCATCCTGGAACCACTTCTCTACTACCCTGCCTGGTTACCCGACCATGGCTCT
GGGCGTCTCCTAGATACTTCTGTCCTTGGCGGCGAGCCCGAGCACCCTCTATGGCTTCTCGCAACATCCAAATTT
ACAGCCCCATCGCGCTTTCGTGCCCCCTTACCCAGTAGATATCGCGAATCAGGGCCCATGTTTGCGACGCATATT
TGGCAGGCCTACCATGCATCCAAGGATTCTTCAATGCCGAATCTCGTGCGCATAACTTCCGAGGGCCCAGAAGCA
AACAATGTCTTCTTTTTTGCTACCGAAGAAGGAAGCAAACAAAGGAAACTTGATGAGAAAGTGCTAGGATGGGCC
GGAAGTCACAGTACAGAAGCGGCTTTCCTCGTCATTTTTGGTTACGCAGTTGCGGCTGGCATATGCCTTGTCATT
TTCCATGCATTCTGGCGGCATCGGAGGACCCAAAAGGGATACCGGGTCGTCGAGTAG
Gene >OphauB2|7289
ATGAATTCAAGATTGCGCAGATCGTTGCTCGGAGCCGTCCTTGCCCTACCGCTGCTGGTGTTCTTGCTGCTGGGA
GTGTCCGGCGTCAGCCGCCTGTACGGTATTCACGCCGGCCTGGCGCTTACTGAGCATCAAATCCAATCCGAATAC
TCCAACTCGCATTCCGCCTTGCGGCCTCTGGACGAACCTGCTCCGCCTCGCCCAGTGCCTCGAATATTGCACTTC
ATTCCATCTCCTGATGAGACGCCTGCTCAGGTGGCGGCGCGGGATAGCTGCCTAAGACTACATCCAACGTGGGAG
CACAAGGTGAGCCAATACATGGCTGCTCGATGGTGGCAATAGGAAAGAGATACAGTTTGTATGCTGACTCGAGGC
GACACAGATATGGAATGACGACGCTGGCCGCTTTCTTATCGCCACAGAGTTCCCCTGGTTTTTGAGTACATACGA
CTCCCTTTCACATACCGTCTATCGAGCCGATGCCCTGCGTTACTTTGTCCTCCGACACGCGGGCGGCGTGGTGCT
TGATTCAAATACAGTCAGTTGAATTGTCTCCGAGAAAATCCGACCGAGGCTCACCTTTTTGACTATAGGGTTGCC
GTACCATCCTGGAACCACTTCTCTACTACCCTGCCTGGTTACCCGACCATGGCTCTGGGCGTCTCCTAGATACTT
CTGTCCTTGGCGGCGAGCCCGAGCACCCTCTATGGCTTCTCGCAACATCCAAATTTACAGCCCCATCGCGCTTTC
GTGCCCCCTTACCCAGTAGATATCGCGAATCAGGGCCCATGTTTGCGACGCATATTTGGCAGGCCTACCATGCAT
CCAAGGATTCTTCAATGCCGAATCTCGTGCGCATAACTTCCGAGGGCCCAGAAGCAAACAATGTCTTCTTTTTTG
CTACCGAAGAAGGAAGCAAACAAAGGAAACTTGATGAGAAAGTGCTAGGATGGGCCGGAAGTCACAGTACAGAAG
CGGCTTTCCTCGTCATTTTTGGTTACGCAGTTGCGGCTGGCATATGCCTTGTCATTTTCCATGCATTCTGGCGGC
ATCGGAGGACCCAAAAGGGATACCGGGTCGTCGAGTAG

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail