Fungal Genomics

at Utrecht University

General Properties

Protein IDOphauB2|7285
Gene name
LocationContig_76:64189..65310
Strand-
Gene length (bp)1121
Transcript length (bp)1062
Coding sequence length (bp)1062
Protein length (aa) 354

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00399 PIR Yeast PIR protein repeat 1.2E-06 232 246
PF00399 PIR Yeast PIR protein repeat 2.0E-05 256 268

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|B5VL27|CIS3_YEAS6 Cell wall mannoprotein CIS3 OS=Saccharomyces cerevisiae (strain AWRI1631) GN=CIS3 PE=3 SV=1 63 158 3.0E-27
sp|A6ZQH4|CIS3_YEAS7 Cell wall mannoprotein CIS3 OS=Saccharomyces cerevisiae (strain YJM789) GN=CIS3 PE=3 SV=1 63 158 3.0E-27
sp|P47001|CIS3_YEAST Cell wall mannoprotein CIS3 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=CIS3 PE=1 SV=1 63 158 8.0E-27
sp|Q03180|PIR3_YEAST Cell wall mannoprotein PIR3 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=PIR3 PE=1 SV=3 66 158 4.0E-25
sp|A6ZQH2|PIR5_YEAS7 Cell wall protein PIR5 OS=Saccharomyces cerevisiae (strain YJM789) GN=PIR5 PE=3 SV=1 57 155 4.0E-25
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|B5VL27|CIS3_YEAS6 Cell wall mannoprotein CIS3 OS=Saccharomyces cerevisiae (strain AWRI1631) GN=CIS3 PE=3 SV=1 63 158 3.0E-27
sp|A6ZQH4|CIS3_YEAS7 Cell wall mannoprotein CIS3 OS=Saccharomyces cerevisiae (strain YJM789) GN=CIS3 PE=3 SV=1 63 158 3.0E-27
sp|P47001|CIS3_YEAST Cell wall mannoprotein CIS3 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=CIS3 PE=1 SV=1 63 158 8.0E-27
sp|Q03180|PIR3_YEAST Cell wall mannoprotein PIR3 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=PIR3 PE=1 SV=3 66 158 4.0E-25
sp|A6ZQH2|PIR5_YEAS7 Cell wall protein PIR5 OS=Saccharomyces cerevisiae (strain YJM789) GN=PIR5 PE=3 SV=1 57 155 4.0E-25
sp|A6ZZG1|PIR3_YEAS7 Cell wall mannoprotein PIR3 OS=Saccharomyces cerevisiae (strain YJM789) GN=PIR3 PE=3 SV=1 66 158 4.0E-25
sp|B3LQU1|PIR3_YEAS1 Cell wall mannoprotein PIR3 OS=Saccharomyces cerevisiae (strain RM11-1a) GN=PIR3 PE=3 SV=1 66 158 8.0E-25
sp|P46999|PIR5_YEAST Cell wall protein PIR5 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=PIR5 PE=2 SV=2 57 155 1.0E-24
sp|B3LPW3|PIR5_YEAS1 Cell wall protein PIR5 OS=Saccharomyces cerevisiae (strain RM11-1a) GN=PIR5 PE=3 SV=1 57 155 1.0E-24
sp|B5VL25|PIR5_YEAS6 Cell wall protein PIR5 OS=Saccharomyces cerevisiae (strain AWRI1631) GN=PIR5 PE=3 SV=1 57 155 1.0E-24
sp|P32478|HS150_YEAST Cell wall mannoprotein HSP150 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=HSP150 PE=1 SV=2 66 158 4.0E-24
sp|A6ZQH3|HS150_YEAS7 Cell wall mannoprotein HSP150 OS=Saccharomyces cerevisiae (strain YJM789) GN=HSP150 PE=3 SV=1 66 158 6.0E-24
sp|B3LPW4|HS150_YEAS1 Cell wall mannoprotein HSP150 OS=Saccharomyces cerevisiae (strain RM11-1a) GN=HSP150 PE=3 SV=1 66 158 6.0E-24
sp|B5VL26|HS150_YEAS6 Cell wall mannoprotein HSP150 OS=Saccharomyces cerevisiae (strain AWRI1631) GN=HSP150 PE=3 SV=1 66 158 7.0E-24
sp|A6ZZG0|PIR1_YEAS7 Cell wall mannoprotein PIR1 OS=Saccharomyces cerevisiae (strain YJM789) GN=PIR1 PE=3 SV=1 66 158 1.0E-22
sp|B3LQU0|PIR1_YEAS1 Cell wall mannoprotein PIR1 OS=Saccharomyces cerevisiae (strain RM11-1a) GN=PIR1 PE=3 SV=1 66 158 1.0E-22
sp|Q03178|PIR1_YEAST Cell wall mannoprotein PIR1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=PIR1 PE=1 SV=1 66 158 1.0E-22
sp|Q59SF7|PIR1_CANAL Cell wall mannoprotein PIR1 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=PIR1 PE=1 SV=1 66 155 6.0E-21
sp|Q59PW0|PIR32_CANAL Probable cell wall mannoprotein PIR32 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=PIR32 PE=2 SV=1 66 155 2.0E-20
sp|Q03180|PIR3_YEAST Cell wall mannoprotein PIR3 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=PIR3 PE=1 SV=3 206 337 1.0E-07
sp|Q59SF7|PIR1_CANAL Cell wall mannoprotein PIR1 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=PIR1 PE=1 SV=1 181 316 2.0E-06
sp|A6ZZG1|PIR3_YEAS7 Cell wall mannoprotein PIR3 OS=Saccharomyces cerevisiae (strain YJM789) GN=PIR3 PE=3 SV=1 206 319 5.0E-06
[Show less]

GO

GO Term Description Terminal node
GO:0005618 cell wall Yes
GO:0005199 structural constituent of cell wall Yes
GO:0110165 cellular anatomical entity No
GO:0030312 external encapsulating structure No
GO:0003674 molecular_function No
GO:0005198 structural molecule activity No
GO:0005575 cellular_component No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
Yes 1 - 18 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >OphauB2|7285
MKWISVAITGLAATASATIDESGAVHGMLSPDGQPPVGCARDYNGMFQVTVYAAGDEKPNLEKRSSCDNDQTLIM
TLADGVLMDAKERTGYIASNFQFQFDNPPQSGAIYTGGFSLCGNNSVALGSSTVFSRCLSGHFYNLYDRHWAPQC
DPVEIVAMPCAADGGEIEDQDGSEPIVVGTSTESTTVVKTLDDGQPQVVPTVMPIAMCQIGDGQVQFHTTPCASV
TRSPLPAPISQIPDGQPQAPSHIVPVPHSQVSQIPDGQPQAPKVSPQPSQGLPSAPLESKTAVKTSPAPRITSSP
VVTQIPDGQPQLPTSTFAAPDAPSAITAGAAKRNSNAMAALIAALLAVAPFLR*
Coding >OphauB2|7285
ATGAAGTGGATATCAGTGGCAATTACCGGCCTTGCTGCCACTGCCAGTGCCACCATAGACGAGAGTGGTGCAGTC
CACGGCATGCTTTCTCCAGATGGCCAGCCCCCAGTTGGCTGTGCTCGTGATTACAATGGCATGTTTCAAGTCACG
GTTTACGCGGCCGGCGACGAGAAGCCGAACCTTGAGAAGCGTTCCTCTTGCGACAATGATCAGACTCTGATCATG
ACGCTTGCTGATGGTGTTCTCATGGATGCCAAGGAACGCACCGGCTACATTGCCTCCAATTTTCAATTCCAATTC
GACAATCCGCCACAATCAGGAGCCATCTATACTGGGGGCTTTTCTCTTTGCGGCAATAATTCTGTTGCTCTTGGC
TCCAGCACCGTCTTTTCGCGCTGCCTGTCGGGTCACTTTTACAACCTGTATGATCGCCATTGGGCGCCACAGTGC
GATCCGGTTGAAATTGTCGCTATGCCCTGCGCTGCAGACGGCGGTGAAATTGAGGACCAAGATGGATCTGAGCCC
ATTGTCGTTGGCACCAGCACCGAATCCACGACTGTGGTCAAGACGTTGGACGATGGACAGCCTCAGGTCGTGCCG
ACTGTGATGCCCATTGCCATGTGCCAGATTGGAGACGGCCAGGTCCAGTTTCACACAACTCCTTGCGCTTCCGTT
ACTCGCTCCCCTCTGCCAGCACCAATTTCGCAAATCCCCGACGGCCAGCCTCAGGCCCCATCCCATATCGTCCCG
GTACCTCACTCTCAGGTGAGCCAGATACCAGACGGCCAGCCTCAGGCTCCCAAAGTGTCTCCCCAGCCGTCTCAG
GGGCTTCCTTCCGCGCCTCTTGAGAGCAAGACGGCTGTCAAGACGTCGCCAGCTCCTCGAATCACTTCGTCGCCC
GTCGTGACTCAGATCCCAGACGGCCAGCCACAGCTTCCAACAAGTACATTTGCCGCTCCTGATGCGCCGAGTGCC
ATTACTGCTGGTGCTGCAAAGAGGAATTCGAATGCCATGGCCGCCCTCATTGCCGCCTTGCTTGCTGTTGCCCCC
TTTTTGCGATGA
Transcript >OphauB2|7285
ATGAAGTGGATATCAGTGGCAATTACCGGCCTTGCTGCCACTGCCAGTGCCACCATAGACGAGAGTGGTGCAGTC
CACGGCATGCTTTCTCCAGATGGCCAGCCCCCAGTTGGCTGTGCTCGTGATTACAATGGCATGTTTCAAGTCACG
GTTTACGCGGCCGGCGACGAGAAGCCGAACCTTGAGAAGCGTTCCTCTTGCGACAATGATCAGACTCTGATCATG
ACGCTTGCTGATGGTGTTCTCATGGATGCCAAGGAACGCACCGGCTACATTGCCTCCAATTTTCAATTCCAATTC
GACAATCCGCCACAATCAGGAGCCATCTATACTGGGGGCTTTTCTCTTTGCGGCAATAATTCTGTTGCTCTTGGC
TCCAGCACCGTCTTTTCGCGCTGCCTGTCGGGTCACTTTTACAACCTGTATGATCGCCATTGGGCGCCACAGTGC
GATCCGGTTGAAATTGTCGCTATGCCCTGCGCTGCAGACGGCGGTGAAATTGAGGACCAAGATGGATCTGAGCCC
ATTGTCGTTGGCACCAGCACCGAATCCACGACTGTGGTCAAGACGTTGGACGATGGACAGCCTCAGGTCGTGCCG
ACTGTGATGCCCATTGCCATGTGCCAGATTGGAGACGGCCAGGTCCAGTTTCACACAACTCCTTGCGCTTCCGTT
ACTCGCTCCCCTCTGCCAGCACCAATTTCGCAAATCCCCGACGGCCAGCCTCAGGCCCCATCCCATATCGTCCCG
GTACCTCACTCTCAGGTGAGCCAGATACCAGACGGCCAGCCTCAGGCTCCCAAAGTGTCTCCCCAGCCGTCTCAG
GGGCTTCCTTCCGCGCCTCTTGAGAGCAAGACGGCTGTCAAGACGTCGCCAGCTCCTCGAATCACTTCGTCGCCC
GTCGTGACTCAGATCCCAGACGGCCAGCCACAGCTTCCAACAAGTACATTTGCCGCTCCTGATGCGCCGAGTGCC
ATTACTGCTGGTGCTGCAAAGAGGAATTCGAATGCCATGGCCGCCCTCATTGCCGCCTTGCTTGCTGTTGCCCCC
TTTTTGCGATGA
Gene >OphauB2|7285
ATGAAGTGGATATCAGTGGCAATTACCGGCCTTGCTGCCACTGCCAGTGCCACCATAGACGAGAGTGGTGCAGTC
CACGGCATGCTTTCTCCAGATGGCCAGCCCCCAGTTGGCTGTGCTCGTGATTACAATGGCATGTTTCAAGTCACG
GTTTACGCGGCCGGCGACGAGAAGCCGAACCTTGAGGTGGGTGCAGTCTTGAGCTGGGCCCGTACTAGCTTGTAA
GCTAATGACAAGCCAAACAGAAGCGTTCCTCTTGCGACAATGATCAGACTCTGATCATGACGCTTGCTGATGGTG
TTCTCATGGATGCCAAGGAACGCACCGGCTACATTGCCTCCAATTTTCAATTCCAATTCGACAATCCGCCACAAT
CAGGAGCCATCTATACTGGGGGCTTTTCTCTTTGCGGCAATAATTCTGTTGCTCTTGGCTCCAGCACCGTCTTTT
CGCGCTGCCTGTCGGGTCACTTTTACAACCTGTATGATCGCCATTGGGCGCCACAGTGCGATCCGGTTGAAATTG
TCGCTATGCCCTGCGCTGCAGACGGCGGTGAAATTGAGGACCAAGATGGATCTGAGCCCATTGTCGTTGGCACCA
GCACCGAATCCACGACTGTGGTCAAGACGTTGGACGATGGACAGCCTCAGGTCGTGCCGACTGTGATGCCCATTG
CCATGTGCCAGATTGGAGACGGCCAGGTCCAGTTTCACACAACTCCTTGCGCTTCCGTTACTCGCTCCCCTCTGC
CAGCACCAATTTCGCAAATCCCCGACGGCCAGCCTCAGGCCCCATCCCATATCGTCCCGGTACCTCACTCTCAGG
TGAGCCAGATACCAGACGGCCAGCCTCAGGCTCCCAAAGTGTCTCCCCAGCCGTCTCAGGGGCTTCCTTCCGCGC
CTCTTGAGAGCAAGACGGCTGTCAAGACGTCGCCAGCTCCTCGAATCACTTCGTCGCCCGTCGTGACTCAGATCC
CAGACGGCCAGCCACAGCTTCCAACAAGTACATTTGCCGCTCCTGATGCGCCGAGTGCCATTACTGCTGGTGCTG
CAAAGAGGAATTCGAATGCCATGGCCGCCCTCATTGCCGCCTTGCTTGCTGTTGCCCCCTTTTTGCGATGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail