Fungal Genomics

at Utrecht University

General Properties

Protein IDOphauB2|7283
Gene name
LocationContig_76:56856..59602
Strand+
Gene length (bp)2746
Transcript length (bp)2571
Coding sequence length (bp)2571
Protein length (aa) 857

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF05346 DUF747 Eukaryotic membrane protein family 1.9E-117 373 773

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|O60067|TAPT1_SCHPO Endoplasmic reticulum membrane protein 65 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPBC13G1.05 PE=1 SV=1 377 856 3.0E-81
sp|P40085|TAPT1_YEAST Endoplasmic reticulum membrane protein 65 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=EMP65 PE=1 SV=1 239 663 6.0E-56
sp|Q550C1|TAPT1_DICDI Protein TAPT1 homolog OS=Dictyostelium discoideum GN=DDB_G0277313 PE=3 SV=2 366 674 2.0E-51
sp|Q5EAY8|TAPT1_XENLA Transmembrane anterior posterior transformation protein 1 homolog OS=Xenopus laevis GN=tapt1 PE=2 SV=1 372 665 7.0E-50
sp|Q5ZLG8|TAPT1_CHICK Transmembrane anterior posterior transformation protein 1 homolog OS=Gallus gallus GN=TAPT1 PE=2 SV=2 372 665 4.0E-49
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|O60067|TAPT1_SCHPO Endoplasmic reticulum membrane protein 65 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPBC13G1.05 PE=1 SV=1 377 856 3.0E-81
sp|P40085|TAPT1_YEAST Endoplasmic reticulum membrane protein 65 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=EMP65 PE=1 SV=1 239 663 6.0E-56
sp|Q550C1|TAPT1_DICDI Protein TAPT1 homolog OS=Dictyostelium discoideum GN=DDB_G0277313 PE=3 SV=2 366 674 2.0E-51
sp|Q5EAY8|TAPT1_XENLA Transmembrane anterior posterior transformation protein 1 homolog OS=Xenopus laevis GN=tapt1 PE=2 SV=1 372 665 7.0E-50
sp|Q5ZLG8|TAPT1_CHICK Transmembrane anterior posterior transformation protein 1 homolog OS=Gallus gallus GN=TAPT1 PE=2 SV=2 372 665 4.0E-49
sp|Q4VBD2|TAPT1_MOUSE Transmembrane anterior posterior transformation protein 1 OS=Mus musculus GN=Tapt1 PE=1 SV=2 372 665 1.0E-48
sp|Q6NXT6|TAPT1_HUMAN Transmembrane anterior posterior transformation protein 1 homolog OS=Homo sapiens GN=TAPT1 PE=1 SV=1 372 665 2.0E-48
sp|Q9VED0|TAPT1_DROME Protein TAPT1 homolog OS=Drosophila melanogaster GN=CG7218 PE=2 SV=2 372 665 2.0E-47
sp|Q9U3H8|TAPT1_CAEEL Protein TAPT1 homolog OS=Caenorhabditis elegans GN=F26F2.7 PE=3 SV=1 373 672 6.0E-46
sp|A2BIE7|TAPT1_DANRE Transmembrane anterior posterior transformation protein 1 homolog OS=Danio rerio GN=tapt1 PE=3 SV=1 372 653 7.0E-46
sp|F4HVJ3|POD1_ARATH Protein POLLEN DEFECTIVE IN GUIDANCE 1 OS=Arabidopsis thaliana GN=POD1 PE=1 SV=1 352 670 2.0E-36
[Show less]

GO

(None)

Deeploc

Deeploc data not available for this genome

SignalP

(None)

Transmembrane Domains

Domain # Start End Length
1 747 769 22

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

No expression data available for this genome

Orthologs

Orthofinder run ID4
Orthogroup3681
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|963
Ophiocordyceps australis map64 (Brazil) OphauB2|7283 (this protein)
Ophiocordyceps camponoti-floridani Ophcf2|01295
Ophiocordyceps camponoti-rufipedis Ophun1|2649
Ophiocordyceps kimflemingae Ophio5|5541
Ophiocordyceps subramaniannii Hirsu2|7118

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >OphauB2|7283
MDSALAKRVNGCHKQPEEGAEQHANGALRHKNKRRSGSAAAASSTFAADMVPRLSVSEMQELTSAPDSLPVAPAP
QRRLVDQYQMGHVGIHAELRGGRGYRNAVDGAPRPPRSPRTASTPPTTRAAAPTDASPLASSPRRFSFNQAASRP
RPLNLSLNGFPARHVPSPAVQTGPAVLSSRQCSRHSTRPSSPIPPTSIPLPPMSLPTHLQLELAAQRPSPLYIFH
PQPTDVPYESSSVKLARLKNILFLPPYLERTLYFGALACLDAWLYTFTILPVRFSFALGLLVRWWCRVIGHEINW
LLSFVWRGTARSWRRIKRGPSPRFNDHDHQQQGPEAKPKSHRSSRASSRDAKARQAKKPSSNEAASPFASDLTPF
HKADLLQGAVIICSSLALMSLDASRMYHFIRAQSAIKLYVIFNILEVGDRLLSALGQDILECLFSAETLSRDSDG
RSRVALPLAMFVLSLIYSCLHSISLYYQVITLNVAVNSYSNALLTLLLSNQFVEIKSTVFKRFDKDNLFQLTCAD
IVERFQLWVMLLIIGMRNVVEVGGLSVPGAGVGVDSTLDAAVSGPLHSPSILPHSFTVLPSWLMSGEVLSPFLIV
VGSEMVVDTIKHAYVTKFNNIKPTFYSRTLDILCKDYYINAFVTPSLTRRLGLAVIPLSCLFIRASVQTYHMFLS
TQVSMPVPPSTQTSLTNESASPSSPAMTAALSRFDALIRDSLGRATYGYSRARPWYAWTSDDVIAALTMVIVFFS
AFLILLTLKLLLGMALLHYSRRRFAAMKRAECLVQTGKLEIPSYDVPSVRTGGRPEVEVGEERRRWINADASEGL
PGVKQQRPRESKPEGDFQGVFRYDMVAKRIW*
Coding >OphauB2|7283
ATGGACAGCGCGTTGGCGAAGCGTGTCAATGGGTGCCACAAGCAGCCTGAAGAGGGGGCCGAGCAGCATGCAAAC
GGGGCTCTTCGGCACAAGAATAAGCGGCGGAGCGGCAGCGCGGCAGCGGCGTCGTCGACGTTTGCTGCGGATATG
GTGCCGCGGCTTTCGGTTTCTGAAATGCAAGAGCTGACGAGCGCTCCCGACTCGCTGCCCGTGGCGCCGGCGCCG
CAGCGTCGACTGGTTGATCAGTATCAGATGGGCCATGTTGGGATTCATGCGGAGCTTCGTGGGGGGCGAGGATAT
CGGAATGCGGTTGATGGTGCGCCTCGGCCACCACGCTCGCCGAGAACGGCTTCGACGCCGCCCACGACTCGTGCT
GCTGCTCCGACGGATGCATCGCCTCTTGCTTCATCGCCTCGGCGTTTCTCCTTTAACCAAGCTGCGTCTCGGCCG
CGGCCCTTGAACTTGAGTCTGAATGGCTTCCCCGCCCGCCATGTACCTTCACCTGCAGTCCAGACTGGACCTGCC
GTCCTGTCGTCTCGGCAGTGCTCGCGCCACAGCACGCGACCCTCGTCTCCTATACCGCCGACGAGTATTCCGCTT
CCTCCAATGTCCCTGCCGACCCATCTCCAGCTCGAGCTGGCTGCTCAACGGCCGAGTCCTCTGTACATTTTCCAC
CCGCAACCCACTGATGTTCCATACGAGTCTAGCAGCGTCAAGCTGGCGCGGCTCAAGAACATCTTGTTTCTGCCT
CCCTACCTCGAGCGAACCTTGTATTTTGGCGCCCTCGCCTGTCTCGATGCCTGGCTCTATACCTTTACCATTTTG
CCCGTGCGCTTTTCCTTTGCCCTGGGTCTCCTGGTGAGATGGTGGTGCCGCGTTATAGGACACGAGATCAACTGG
CTCTTGTCCTTTGTCTGGCGCGGAACAGCAAGATCGTGGCGCCGCATAAAAAGAGGGCCGTCGCCTCGGTTCAAC
GACCATGACCATCAACAACAGGGCCCGGAAGCAAAGCCCAAGTCACACAGAAGCTCGCGCGCAAGTAGCCGCGAC
GCAAAAGCCCGCCAAGCCAAGAAGCCATCCAGCAATGAGGCCGCTTCCCCCTTTGCTTCGGATCTTACGCCCTTT
CACAAGGCGGATTTGCTGCAAGGCGCAGTCATTATTTGCAGCTCGCTAGCGCTCATGTCGCTTGATGCCAGTCGC
ATGTATCATTTTATACGCGCCCAGTCTGCCATTAAACTATACGTCATCTTCAATATCCTCGAGGTTGGAGACAGG
CTTCTCTCAGCCCTTGGCCAAGACATTCTCGAGTGTCTCTTCAGCGCAGAGACGCTGTCTCGCGACTCGGACGGC
CGCTCAAGAGTTGCCCTTCCGCTTGCCATGTTTGTCCTGTCCCTTATTTATAGCTGTCTCCACTCCATTTCCCTC
TACTACCAGGTCATTACACTCAACGTTGCTGTCAATTCATACTCGAATGCCCTTCTCACACTGCTCCTGTCGAAC
CAGTTTGTCGAAATCAAGAGCACAGTCTTTAAGCGCTTTGACAAGGACAATCTCTTTCAGCTCACCTGCGCCGAC
ATTGTCGAGCGCTTCCAGCTCTGGGTCATGCTTCTCATTATTGGCATGCGCAATGTCGTCGAGGTGGGCGGCTTG
TCGGTGCCGGGCGCCGGAGTGGGCGTCGACTCGACGCTTGATGCTGCTGTAAGCGGGCCGCTGCACTCACCCTCT
ATTCTGCCTCACAGCTTCACCGTGCTGCCGTCGTGGCTCATGTCTGGTGAAGTGCTCTCTCCCTTCTTGATTGTT
GTCGGTAGCGAAATGGTTGTCGATACCATCAAGCACGCCTACGTGACCAAGTTCAACAATATCAAGCCTACCTTT
TATAGTAGAACGCTCGACATTCTTTGCAAGGACTACTACATCAATGCATTCGTCACCCCGTCTCTTACCCGCCGG
CTTGGCCTCGCCGTAATCCCCCTCTCATGTCTCTTTATCCGCGCATCCGTCCAGACCTACCACATGTTTCTCTCC
ACCCAAGTCTCCATGCCCGTCCCGCCATCTACCCAAACCTCGCTCACCAATGAATCCGCCTCGCCCTCCTCCCCG
GCCATGACTGCCGCTCTGTCGCGCTTCGACGCCCTCATTCGTGACTCGCTCGGCCGCGCCACATATGGCTACTCG
CGCGCCCGCCCCTGGTACGCCTGGACCTCGGACGACGTGATTGCAGCGCTCACCATGGTGATTGTCTTTTTCTCT
GCCTTTCTCATCCTCTTGACGCTCAAGCTCCTCCTCGGCATGGCCCTCTTGCATTACTCGCGCAGGCGCTTTGCT
GCCATGAAGCGTGCCGAATGTCTGGTGCAGACGGGAAAGCTCGAGATACCATCCTATGATGTCCCTAGCGTGCGC
ACCGGCGGTCGTCCAGAAGTCGAGGTGGGCGAGGAGCGTCGCCGCTGGATAAATGCAGATGCGTCAGAGGGCTTG
CCGGGAGTCAAGCAACAGCGGCCTAGAGAGTCCAAGCCAGAAGGCGATTTTCAAGGCGTCTTTCGCTACGACATG
GTTGCCAAACGGATTTGGTGA
Transcript >OphauB2|7283
ATGGACAGCGCGTTGGCGAAGCGTGTCAATGGGTGCCACAAGCAGCCTGAAGAGGGGGCCGAGCAGCATGCAAAC
GGGGCTCTTCGGCACAAGAATAAGCGGCGGAGCGGCAGCGCGGCAGCGGCGTCGTCGACGTTTGCTGCGGATATG
GTGCCGCGGCTTTCGGTTTCTGAAATGCAAGAGCTGACGAGCGCTCCCGACTCGCTGCCCGTGGCGCCGGCGCCG
CAGCGTCGACTGGTTGATCAGTATCAGATGGGCCATGTTGGGATTCATGCGGAGCTTCGTGGGGGGCGAGGATAT
CGGAATGCGGTTGATGGTGCGCCTCGGCCACCACGCTCGCCGAGAACGGCTTCGACGCCGCCCACGACTCGTGCT
GCTGCTCCGACGGATGCATCGCCTCTTGCTTCATCGCCTCGGCGTTTCTCCTTTAACCAAGCTGCGTCTCGGCCG
CGGCCCTTGAACTTGAGTCTGAATGGCTTCCCCGCCCGCCATGTACCTTCACCTGCAGTCCAGACTGGACCTGCC
GTCCTGTCGTCTCGGCAGTGCTCGCGCCACAGCACGCGACCCTCGTCTCCTATACCGCCGACGAGTATTCCGCTT
CCTCCAATGTCCCTGCCGACCCATCTCCAGCTCGAGCTGGCTGCTCAACGGCCGAGTCCTCTGTACATTTTCCAC
CCGCAACCCACTGATGTTCCATACGAGTCTAGCAGCGTCAAGCTGGCGCGGCTCAAGAACATCTTGTTTCTGCCT
CCCTACCTCGAGCGAACCTTGTATTTTGGCGCCCTCGCCTGTCTCGATGCCTGGCTCTATACCTTTACCATTTTG
CCCGTGCGCTTTTCCTTTGCCCTGGGTCTCCTGGTGAGATGGTGGTGCCGCGTTATAGGACACGAGATCAACTGG
CTCTTGTCCTTTGTCTGGCGCGGAACAGCAAGATCGTGGCGCCGCATAAAAAGAGGGCCGTCGCCTCGGTTCAAC
GACCATGACCATCAACAACAGGGCCCGGAAGCAAAGCCCAAGTCACACAGAAGCTCGCGCGCAAGTAGCCGCGAC
GCAAAAGCCCGCCAAGCCAAGAAGCCATCCAGCAATGAGGCCGCTTCCCCCTTTGCTTCGGATCTTACGCCCTTT
CACAAGGCGGATTTGCTGCAAGGCGCAGTCATTATTTGCAGCTCGCTAGCGCTCATGTCGCTTGATGCCAGTCGC
ATGTATCATTTTATACGCGCCCAGTCTGCCATTAAACTATACGTCATCTTCAATATCCTCGAGGTTGGAGACAGG
CTTCTCTCAGCCCTTGGCCAAGACATTCTCGAGTGTCTCTTCAGCGCAGAGACGCTGTCTCGCGACTCGGACGGC
CGCTCAAGAGTTGCCCTTCCGCTTGCCATGTTTGTCCTGTCCCTTATTTATAGCTGTCTCCACTCCATTTCCCTC
TACTACCAGGTCATTACACTCAACGTTGCTGTCAATTCATACTCGAATGCCCTTCTCACACTGCTCCTGTCGAAC
CAGTTTGTCGAAATCAAGAGCACAGTCTTTAAGCGCTTTGACAAGGACAATCTCTTTCAGCTCACCTGCGCCGAC
ATTGTCGAGCGCTTCCAGCTCTGGGTCATGCTTCTCATTATTGGCATGCGCAATGTCGTCGAGGTGGGCGGCTTG
TCGGTGCCGGGCGCCGGAGTGGGCGTCGACTCGACGCTTGATGCTGCTGTAAGCGGGCCGCTGCACTCACCCTCT
ATTCTGCCTCACAGCTTCACCGTGCTGCCGTCGTGGCTCATGTCTGGTGAAGTGCTCTCTCCCTTCTTGATTGTT
GTCGGTAGCGAAATGGTTGTCGATACCATCAAGCACGCCTACGTGACCAAGTTCAACAATATCAAGCCTACCTTT
TATAGTAGAACGCTCGACATTCTTTGCAAGGACTACTACATCAATGCATTCGTCACCCCGTCTCTTACCCGCCGG
CTTGGCCTCGCCGTAATCCCCCTCTCATGTCTCTTTATCCGCGCATCCGTCCAGACCTACCACATGTTTCTCTCC
ACCCAAGTCTCCATGCCCGTCCCGCCATCTACCCAAACCTCGCTCACCAATGAATCCGCCTCGCCCTCCTCCCCG
GCCATGACTGCCGCTCTGTCGCGCTTCGACGCCCTCATTCGTGACTCGCTCGGCCGCGCCACATATGGCTACTCG
CGCGCCCGCCCCTGGTACGCCTGGACCTCGGACGACGTGATTGCAGCGCTCACCATGGTGATTGTCTTTTTCTCT
GCCTTTCTCATCCTCTTGACGCTCAAGCTCCTCCTCGGCATGGCCCTCTTGCATTACTCGCGCAGGCGCTTTGCT
GCCATGAAGCGTGCCGAATGTCTGGTGCAGACGGGAAAGCTCGAGATACCATCCTATGATGTCCCTAGCGTGCGC
ACCGGCGGTCGTCCAGAAGTCGAGGTGGGCGAGGAGCGTCGCCGCTGGATAAATGCAGATGCGTCAGAGGGCTTG
CCGGGAGTCAAGCAACAGCGGCCTAGAGAGTCCAAGCCAGAAGGCGATTTTCAAGGCGTCTTTCGCTACGACATG
GTTGCCAAACGGATTTGGTGA
Gene >OphauB2|7283
ATGGACAGCGCGTTGGCGAAGCGTGTCAATGGGTGCCACAAGCAGCCTGAAGAGGGGGCCGAGCAGCATGCAAAC
GGGGCTCTTCGGCACAAGAATAAGCGGCGGAGCGGCAGCGCGGCAGCGGCGTCGTCGACGTTTGCTGCGGATATG
GTGCCGCGGCTTTCGGTTTCTGAAATGCAAGAGCTGACGAGCGCTCCCGACTCGCTGCCCGTGGCGCCGGCGCCG
CAGCGTCGACTGGTTGATCAGTATCAGATGGGCCATGTTGGGATTCATGCGGAGCTTCGTGGGGGGCGAGGATAT
CGGAATGCGGTTGATGGTGCGCCTCGGCCACCACGCTCGCCGAGAACGGCTTCGACGCCGCCCACGACTCGTGCT
GCTGCTCCGACGGATGCATCGCCTCTTGCTTCATCGCCTCGGCGTTTCTCCTTTAACCAAGCTGCGTCTCGGCCG
CGGCCCTTGAACTTGAGTCTGAATGGCTTCCCCGCCCGCCATGTACCTTCACCTGCAGTCCAGACTGGACCTGCC
GTCCTGTCGTCTCGGCAGTGCTCGCGCCACAGCACGCGACCCTCGTCTCCTATACCGCCGACGAGTATTCCGCTT
CCTCCAATGTCCCTGCCGACCCATCTCCAGCTCGAGCTGGCTGCTCAACGGCCGAGTCCTCTGTACATTTTCCAC
CCGCAACCCACTGATGTTCCATACGAGTCTAGCAGCGTCAAGCTGGCGCGGCTCAAGAACATCTTGTTTCTGCCT
CCCTACCTCGAGCGAACCTTGTATTTTGGCGCCCTCGCCTGTCTCGATGCCTGGCTCTATACCTTTACCATTTTG
CCCGTGCGCTTTTCCTTTGCCCTGGGTCTCCTGGTGAGATGGTGGTGCCGCGTTATAGGACACGAGATCAACTGG
CTCTTGTCCTTTGTCTGGCGCGGAACAGCAAGATCGTGGCGCCGCATAAAAAGAGGGCCGTCGCCTCGGTTCAAC
GACCATGACCATCAACAACAGGGCCCGGAAGCAAAGCCCAAGTCACACAGAAGCTCGCGCGCAAGTAGCCGCGAC
GCAAAAGCCCGCCAAGCCAAGAAGCCATCCAGCAATGAGGCCGCTTCCCCCTTTGCTTCGGATCTTACGCCCTTT
CACAAGGCGGATTTGCTGCAAGGCGCAGTCATTATTTGCAGCTCGCTAGCGCTCATGTCGCTTGATGCCAGTCGC
ATGTATCATTTTATACGCGCCCAGTCTGCCATTAAACTATACGTCATCTTCAATATCCTCGAGGTTGGAGACAGG
CTTCTCTCAGCCCTTGGCCAAGACATTCTCGAGTGTCTCTTCAGCGCAGAGACGCTGTCTCGCGACTCGGACGGC
CGCTCAAGAGTTGCCCTTCCGCTTGCCATGTTTGTCCTGTCCCTTATTTATAGCTGTCTCCACTCCATTTCCCTC
TACTACCAGGTCATTACACTCAACGTTGCTGTCAATTCATACTCGAATGCCCTTCTCACACTGCTCCTGTCGAAC
CAGTTTGTCGAAATCAAGAGCACAGTCTTTAAGCGCTTTGACAAGGACAATCTCTTTCAGCTCACCTGCGCCGAC
ATTGTCGAGCGCTTCCAGCTCTGGGTCATGCTTCTCATTATTGGCATGCGCAATGTCGTCGAGGTGGGCGGCTTG
TCGGTGCCGGGCGCCGGAGTGGGCGTCGACTCGACGCTTGATGCTGCTGTAAGCGGGCCGCTGCACTCACCCTCT
ATTCTGCCTCACAGCTTCACCGTGCTGCCGTCGTGGCTCATGTCTGGTGAAGTGCTCTCTCCCTTCTTGATTGTT
GTCGGTAGCGAAATGGTTGTCGATACCATCAAGCACGCCTACGTGACCAAGTTCAACAATATCAAGCCTACCTTT
TATAGTAGAACGCTCGACATTCTTTGCAAGGACTACTACATCAATGTGAGCCAACTCTTTGCTCGCCATGCACTC
TTTTTAGCCAATTGCAGCAAGCAAGCTTCTCTTCTTCTTGATACTCTTTTTTTCCCTCCTTTTTTCCCCCTTTTT
CCCCCTGTTCCCTTCCCCCCTCTTTCTTTATTTCCTTGCTTCTTCCCAAAAAAAACTAACTCTTCTCCAGGCATT
CGTCACCCCGTCTCTTACCCGCCGGCTTGGCCTCGCCGTAATCCCCCTCTCATGTCTCTTTATCCGCGCATCCGT
CCAGACCTACCACATGTTTCTCTCCACCCAAGTCTCCATGCCCGTCCCGCCATCTACCCAAACCTCGCTCACCAA
TGAATCCGCCTCGCCCTCCTCCCCGGCCATGACTGCCGCTCTGTCGCGCTTCGACGCCCTCATTCGTGACTCGCT
CGGCCGCGCCACATATGGCTACTCGCGCGCCCGCCCCTGGTACGCCTGGACCTCGGACGACGTGATTGCAGCGCT
CACCATGGTGATTGTCTTTTTCTCTGCCTTTCTCATCCTCTTGACGCTCAAGCTCCTCCTCGGCATGGCCCTCTT
GCATTACTCGCGCAGGCGCTTTGCTGCCATGAAGCGTGCCGAATGTCTGGTGCAGACGGGAAAGCTCGAGATACC
ATCCTATGATGTCCCTAGCGTGCGCACCGGCGGTCGTCCAGAAGTCGAGGTGGGCGAGGAGCGTCGCCGCTGGAT
AAATGCAGATGCGTCAGAGGGCTTGCCGGGAGTCAAGCAACAGCGGCCTAGAGAGTCCAAGCCAGAAGGCGATTT
TCAAGGCGTCTTTCGCTACGACATGGTTGCCAAACGGATTTGGTGA

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail