Fungal Genomics

at Utrecht University

General Properties

Protein IDOphauB2|7278
Gene name
LocationContig_76:48704..50051
Strand-
Gene length (bp)1347
Transcript length (bp)1185
Coding sequence length (bp)1185
Protein length (aa) 395

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF04366 Ysc84 Las17-binding protein actin regulator 6.0E-41 89 213
PF00018 SH3_1 SH3 domain 1.7E-13 340 387
PF07653 SH3_2 Variant SH3 domain 3.0E-12 340 391
PF14604 SH3_9 Variant SH3 domain 5.1E-11 341 391

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q9URW6|YIE2_SCHPO SH3 domain-containing protein PJ696.02 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAPJ696.02 PE=1 SV=1 1 392 1.0E-129
sp|P32793|YSC84_YEAST Protein YSC84 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=YSC84 PE=1 SV=2 1 392 3.0E-98
sp|Q3SZ01|SH3Y1_BOVIN SH3 domain-containing YSC84-like protein 1 OS=Bos taurus GN=SH3YL1 PE=2 SV=1 3 392 2.0E-81
sp|Q96HL8|SH3Y1_HUMAN SH3 domain-containing YSC84-like protein 1 OS=Homo sapiens GN=SH3YL1 PE=1 SV=1 3 392 1.0E-80
sp|O08641|SH3Y1_MOUSE SH3 domain-containing YSC84-like protein 1 OS=Mus musculus GN=Sh3yl1 PE=1 SV=1 3 392 3.0E-78
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q9URW6|YIE2_SCHPO SH3 domain-containing protein PJ696.02 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAPJ696.02 PE=1 SV=1 1 392 1.0E-129
sp|P32793|YSC84_YEAST Protein YSC84 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=YSC84 PE=1 SV=2 1 392 3.0E-98
sp|Q3SZ01|SH3Y1_BOVIN SH3 domain-containing YSC84-like protein 1 OS=Bos taurus GN=SH3YL1 PE=2 SV=1 3 392 2.0E-81
sp|Q96HL8|SH3Y1_HUMAN SH3 domain-containing YSC84-like protein 1 OS=Homo sapiens GN=SH3YL1 PE=1 SV=1 3 392 1.0E-80
sp|O08641|SH3Y1_MOUSE SH3 domain-containing YSC84-like protein 1 OS=Mus musculus GN=Sh3yl1 PE=1 SV=1 3 392 3.0E-78
sp|B0BNA1|SH3Y1_RAT SH3 domain-containing YSC84-like protein 1 OS=Rattus norvegicus GN=Sh3yl1 PE=2 SV=1 3 392 7.0E-78
sp|Q5RAQ2|SH3Y1_PONAB SH3 domain-containing YSC84-like protein 1 OS=Pongo abelii GN=SH3YL1 PE=2 SV=1 3 392 3.0E-77
sp|P43603|LSB3_YEAST LAS seventeen-binding protein 3 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=LSB3 PE=1 SV=3 1 217 4.0E-75
sp|A7A261|LSB3_YEAS7 LAS seventeen-binding protein 3 OS=Saccharomyces cerevisiae (strain YJM789) GN=LSB3 PE=3 SV=2 1 217 4.0E-75
sp|Q6DFH5|SH3Y1_XENLA SH3 domain-containing YSC84-like protein 1 OS=Xenopus laevis GN=sh3yl1 PE=2 SV=1 3 213 5.0E-60
sp|Q9Z0R4|ITSN1_MOUSE Intersectin-1 OS=Mus musculus GN=Itsn1 PE=1 SV=2 304 394 6.0E-16
sp|P43603|LSB3_YEAST LAS seventeen-binding protein 3 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=LSB3 PE=1 SV=3 318 392 9.0E-16
sp|A7A261|LSB3_YEAS7 LAS seventeen-binding protein 3 OS=Saccharomyces cerevisiae (strain YJM789) GN=LSB3 PE=3 SV=2 318 392 9.0E-16
sp|Q15811|ITSN1_HUMAN Intersectin-1 OS=Homo sapiens GN=ITSN1 PE=1 SV=3 304 394 3.0E-15
sp|O42287|ITSN1_XENLA Intersectin-1 OS=Xenopus laevis GN=itsn1 PE=1 SV=1 306 394 2.0E-13
sp|Q9WVE9|ITSN1_RAT Intersectin-1 OS=Rattus norvegicus GN=Itsn1 PE=1 SV=1 304 394 4.0E-13
sp|Q9NZM3|ITSN2_HUMAN Intersectin-2 OS=Homo sapiens GN=ITSN2 PE=1 SV=3 313 394 1.0E-10
sp|Q6DFH5|SH3Y1_XENLA SH3 domain-containing YSC84-like protein 1 OS=Xenopus laevis GN=sh3yl1 PE=2 SV=1 339 392 4.0E-10
sp|Q9Z0R6|ITSN2_MOUSE Intersectin-2 OS=Mus musculus GN=Itsn2 PE=1 SV=2 340 394 6.0E-10
sp|Q59LF3|RV167_CANAL Regulator of cytoskeleton and endocytosis RVS167 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=RVS167 PE=3 SV=1 308 392 2.0E-09
sp|P29355|SEM5_CAEEL Sex muscle abnormal protein 5 OS=Caenorhabditis elegans GN=sem-5 PE=1 SV=1 341 390 3.0E-09
sp|O43125|CSH3_SCHPO Protein csh3 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=csh3 PE=2 SV=1 340 392 3.0E-09
sp|Q75DS3|HSE1_ASHGO Class E vacuolar protein-sorting machinery protein HSE1 OS=Ashbya gossypii (strain ATCC 10895 / CBS 109.51 / FGSC 9923 / NRRL Y-1056) GN=HSE1 PE=3 SV=1 304 390 5.0E-09
sp|Q0U6X7|HSE1_PHANO Class E vacuolar protein-sorting machinery protein HSE1 OS=Phaeosphaeria nodorum (strain SN15 / ATCC MYA-4574 / FGSC 10173) GN=HSE1 PE=3 SV=1 341 394 6.0E-09
sp|Q7S6J4|HSE1_NEUCR Class E vacuolar protein-sorting machinery protein hse1 OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=hse1 PE=3 SV=1 341 391 7.0E-09
sp|Q4WHP5|HSE1_ASPFU Class E vacuolar protein-sorting machinery protein hse1 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=hse1 PE=3 SV=1 341 391 9.0E-09
sp|A1DFN5|HSE1_NEOFI Class E vacuolar protein-sorting machinery protein hse1 OS=Neosartorya fischeri (strain ATCC 1020 / DSM 3700 / FGSC A1164 / NRRL 181) GN=hse1 PE=3 SV=1 341 391 1.0E-08
sp|A1CEK6|HSE1_ASPCL Class E vacuolar protein-sorting machinery protein hse1 OS=Aspergillus clavatus (strain ATCC 1007 / CBS 513.65 / DSM 816 / NCTC 3887 / NRRL 1) GN=hse1 PE=3 SV=1 341 391 1.0E-08
sp|Q6NRD3|SH3R1_XENLA E3 ubiquitin-protein ligase SH3RF1 OS=Xenopus laevis GN=sh3rf1 PE=1 SV=1 329 392 1.0E-08
sp|Q28E95|SH3R1_XENTR E3 ubiquitin-protein ligase SH3RF1 OS=Xenopus tropicalis GN=sh3rf1 PE=2 SV=1 329 392 1.0E-08
sp|A2QW93|HSE1_ASPNC Class E vacuolar protein-sorting machinery protein hse1 OS=Aspergillus niger (strain CBS 513.88 / FGSC A1513) GN=hse1 PE=3 SV=1 341 391 1.0E-08
sp|A5D7F8|SH3R1_BOVIN E3 ubiquitin-protein ligase SH3RF1 OS=Bos taurus GN=SH3RF1 PE=2 SV=1 331 392 2.0E-08
sp|Q0CJU8|HSE1_ASPTN Class E vacuolar protein-sorting machinery protein hse1 OS=Aspergillus terreus (strain NIH 2624 / FGSC A1156) GN=hse1 PE=3 SV=1 341 391 2.0E-08
sp|Q2GT05|HSE1_CHAGB Class E vacuolar protein-sorting machinery protein HSE1 OS=Chaetomium globosum (strain ATCC 6205 / CBS 148.51 / DSM 1962 / NBRC 6347 / NRRL 1970) GN=HSE1 PE=3 SV=1 341 391 2.0E-08
sp|Q8AXV0|SH3G1_CHICK Endophilin-A2 OS=Gallus gallus GN=SH3GL1 PE=1 SV=1 304 392 3.0E-08
sp|Q62420|SH3G2_MOUSE Endophilin-A1 OS=Mus musculus GN=Sh3gl2 PE=1 SV=2 305 392 3.0E-08
sp|Q8AXU9|SH3G3_CHICK Endophilin-A3 OS=Gallus gallus GN=SH3GL3 PE=1 SV=1 341 392 4.0E-08
sp|P53281|LSB1_YEAST LAS seventeen-binding protein 1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=LSB1 PE=1 SV=1 341 391 4.0E-08
sp|Q5BBL4|HSE1_EMENI Class E vacuolar protein-sorting machinery protein hse1 OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=hse1 PE=3 SV=1 341 391 4.0E-08
sp|O35179|SH3G2_RAT Endophilin-A1 OS=Rattus norvegicus GN=Sh3gl2 PE=1 SV=2 341 392 5.0E-08
sp|Q1E878|HSE1_COCIM Class E vacuolar protein-sorting machinery protein HSE1 OS=Coccidioides immitis (strain RS) GN=HSE1 PE=3 SV=1 341 391 5.0E-08
sp|A5D8S5|SH3R1_DANRE E3 ubiquitin-protein ligase SH3RF1 OS=Danio rerio GN=sh3rf1 PE=2 SV=2 339 392 6.0E-08
sp|Q15811|ITSN1_HUMAN Intersectin-1 OS=Homo sapiens GN=ITSN1 PE=1 SV=3 309 392 8.0E-08
sp|Q7TSG5|SH321_MOUSE SH3 domain-containing protein 21 OS=Mus musculus GN=Sh3d21 PE=1 SV=1 342 390 8.0E-08
sp|Q99962|SH3G2_HUMAN Endophilin-A1 OS=Homo sapiens GN=SH3GL2 PE=1 SV=1 341 392 8.0E-08
sp|Q6C2N2|HSE1_YARLI Class E vacuolar protein-sorting machinery protein HSE1 OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=HSE1 PE=3 SV=1 341 390 9.0E-08
sp|Q8AXV1|SH3G2_CHICK Endophilin-A1 OS=Gallus gallus GN=SH3GL2 PE=1 SV=1 341 390 1.0E-07
sp|Q69ZI1|SH3R1_MOUSE E3 ubiquitin-protein ligase SH3RF1 OS=Mus musculus GN=Sh3rf1 PE=1 SV=2 331 392 1.0E-07
sp|O01498|STAM1_CAEEL Signal transducing adapter molecule 1 OS=Caenorhabditis elegans GN=stam-1 PE=1 SV=2 341 390 1.0E-07
sp|Q71F54|SH3R1_RAT E3 ubiquitin-protein ligase SH3RF1 OS=Rattus norvegicus GN=Sh3rf1 PE=1 SV=1 331 392 1.0E-07
sp|O74352|HOB1_SCHPO Protein hob1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=hob1 PE=1 SV=1 340 393 1.0E-07
sp|Q5RBR0|SH3R1_PONAB E3 ubiquitin-protein ligase SH3RF1 OS=Pongo abelii GN=SH3RF1 PE=2 SV=1 331 392 1.0E-07
sp|Q7Z6J0|SH3R1_HUMAN E3 ubiquitin-protein ligase SH3RF1 OS=Homo sapiens GN=SH3RF1 PE=1 SV=2 331 392 1.0E-07
sp|Q6YKA8|DRK_DROSI Protein E(sev)2B OS=Drosophila simulans GN=drk PE=3 SV=1 341 390 1.0E-07
sp|Q08012|DRK_DROME Protein enhancer of sevenless 2B OS=Drosophila melanogaster GN=drk PE=1 SV=1 341 390 1.0E-07
sp|P39743|RV167_YEAST Reduced viability upon starvation protein 167 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=RVS167 PE=1 SV=1 341 392 2.0E-07
sp|Q2KJA1|SH3G1_BOVIN Endophilin-A2 OS=Bos taurus GN=SH3GL1 PE=2 SV=1 319 392 2.0E-07
sp|A4FU49|SH321_HUMAN SH3 domain-containing protein 21 OS=Homo sapiens GN=SH3D21 PE=2 SV=2 342 390 2.0E-07
sp|P38753|HSE1_YEAST Class E vacuolar protein-sorting machinery protein HSE1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=HSE1 PE=1 SV=1 341 390 2.0E-07
sp|O35180|SH3G3_RAT Endophilin-A3 OS=Rattus norvegicus GN=Sh3gl3 PE=1 SV=2 342 392 2.0E-07
sp|Q62421|SH3G3_MOUSE Endophilin-A3 OS=Mus musculus GN=Sh3gl3 PE=1 SV=1 342 392 2.0E-07
sp|Q4R729|SH321_MACFA SH3 domain-containing protein 21 OS=Macaca fascicularis GN=SH3D21 PE=2 SV=1 342 390 3.0E-07
sp|O35964|SH3G1_RAT Endophilin-A2 OS=Rattus norvegicus GN=Sh3gl1 PE=1 SV=1 319 392 3.0E-07
sp|O74749|HSE1_SCHPO Class E vacuolar protein-sorting machinery protein hse1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=hse1 PE=3 SV=1 341 391 3.0E-07
sp|Q99961|SH3G1_HUMAN Endophilin-A2 OS=Homo sapiens GN=SH3GL1 PE=1 SV=1 319 392 3.0E-07
sp|Q557J6|DBNL_DICDI Drebrin-like protein OS=Dictyostelium discoideum GN=abpE-1 PE=2 SV=1 338 392 4.0E-07
sp|Q8I190|SH3G3_DROVI Endophilin-A OS=Drosophila virilis GN=EndoA PE=3 SV=1 341 393 4.0E-07
sp|Q8I1C0|SH3G3_DROPS Endophilin-A OS=Drosophila pseudoobscura pseudoobscura GN=EndoA PE=3 SV=1 341 393 4.0E-07
sp|Q62419|SH3G1_MOUSE Endophilin-A2 OS=Mus musculus GN=Sh3gl1 PE=1 SV=1 316 392 4.0E-07
sp|Q99963|SH3G3_HUMAN Endophilin-A3 OS=Homo sapiens GN=SH3GL3 PE=1 SV=1 342 392 5.0E-07
sp|Q8I1A6|SH3G3_DROWI Endophilin-A OS=Drosophila willistoni GN=EndoA PE=3 SV=1 341 393 6.0E-07
sp|O42287|ITSN1_XENLA Intersectin-1 OS=Xenopus laevis GN=itsn1 PE=1 SV=1 320 392 7.0E-07
sp|A4RF61|HSE1_MAGO7 Class E vacuolar protein-sorting machinery protein HSE1 OS=Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958) GN=HSE1 PE=3 SV=2 341 391 7.0E-07
sp|Q9NZM3|ITSN2_HUMAN Intersectin-2 OS=Homo sapiens GN=ITSN2 PE=1 SV=3 338 392 8.0E-07
sp|Q07883|GRB2_CHICK Growth factor receptor-bound protein 2 OS=Gallus gallus GN=GRB2 PE=1 SV=1 341 390 9.0E-07
sp|P62994|GRB2_RAT Growth factor receptor-bound protein 2 OS=Rattus norvegicus GN=Grb2 PE=1 SV=1 338 393 1.0E-06
sp|Q5R4J7|GRB2_PONAB Growth factor receptor-bound protein 2 OS=Pongo abelii GN=GRB2 PE=2 SV=1 338 393 1.0E-06
sp|P62993|GRB2_HUMAN Growth factor receptor-bound protein 2 OS=Homo sapiens GN=GRB2 PE=1 SV=1 338 393 1.0E-06
sp|Q60631|GRB2_MOUSE Growth factor receptor-bound protein 2 OS=Mus musculus GN=Grb2 PE=1 SV=1 338 393 1.0E-06
sp|P42522|MYOC_DICDI Myosin IC heavy chain OS=Dictyostelium discoideum GN=myoC PE=3 SV=2 337 391 1.0E-06
sp|O89100|GRAP2_MOUSE GRB2-related adaptor protein 2 OS=Mus musculus GN=Grap2 PE=1 SV=1 339 390 1.0E-06
sp|Q8T390|SH3G3_DROME Endophilin-A OS=Drosophila melanogaster GN=EndoA PE=1 SV=1 341 393 1.0E-06
sp|Q8I1I3|SH3G3_DROER Endophilin-A OS=Drosophila erecta GN=EndoA PE=3 SV=1 341 393 1.0E-06
sp|Q6FN49|HSE1_CANGA Class E vacuolar protein-sorting machinery protein HSE1 OS=Candida glabrata (strain ATCC 2001 / CBS 138 / JCM 3761 / NBRC 0622 / NRRL Y-65) GN=HSE1 PE=3 SV=1 341 390 1.0E-06
sp|Q925Q9|SH3K1_RAT SH3 domain-containing kinase-binding protein 1 OS=Rattus norvegicus GN=Sh3kbp1 PE=1 SV=2 303 392 1.0E-06
sp|Q07883|GRB2_CHICK Growth factor receptor-bound protein 2 OS=Gallus gallus GN=GRB2 PE=1 SV=1 338 393 2.0E-06
sp|P87379|GRB2A_XENLA Growth factor receptor-bound protein 2-A OS=Xenopus laevis GN=grb2-a PE=1 SV=2 338 393 2.0E-06
sp|P87379|GRB2A_XENLA Growth factor receptor-bound protein 2-A OS=Xenopus laevis GN=grb2-a PE=1 SV=2 341 390 2.0E-06
sp|Q8R550|SH3K1_MOUSE SH3 domain-containing kinase-binding protein 1 OS=Mus musculus GN=Sh3kbp1 PE=1 SV=1 303 392 2.0E-06
sp|Q96B97|SH3K1_HUMAN SH3 domain-containing kinase-binding protein 1 OS=Homo sapiens GN=SH3KBP1 PE=1 SV=2 336 392 2.0E-06
sp|Q66II3|GRB2_XENTR Growth factor receptor-bound protein 2 OS=Xenopus tropicalis GN=grb2 PE=2 SV=1 338 393 2.0E-06
sp|Q6GPJ9|GRB2B_XENLA Growth factor receptor-bound protein 2-B OS=Xenopus laevis GN=grb2-b PE=1 SV=1 338 393 2.0E-06
sp|P10569|MYSC_ACACA Myosin IC heavy chain OS=Acanthamoeba castellanii GN=MIC PE=1 SV=1 338 392 2.0E-06
sp|Q9Z0R6|ITSN2_MOUSE Intersectin-2 OS=Mus musculus GN=Itsn2 PE=1 SV=2 338 392 3.0E-06
sp|P62994|GRB2_RAT Growth factor receptor-bound protein 2 OS=Rattus norvegicus GN=Grb2 PE=1 SV=1 341 390 3.0E-06
sp|Q5R4J7|GRB2_PONAB Growth factor receptor-bound protein 2 OS=Pongo abelii GN=GRB2 PE=2 SV=1 341 390 3.0E-06
sp|P62993|GRB2_HUMAN Growth factor receptor-bound protein 2 OS=Homo sapiens GN=GRB2 PE=1 SV=1 341 390 3.0E-06
sp|Q60631|GRB2_MOUSE Growth factor receptor-bound protein 2 OS=Mus musculus GN=Grb2 PE=1 SV=1 341 390 3.0E-06
sp|O75791|GRAP2_HUMAN GRB2-related adapter protein 2 OS=Homo sapiens GN=GRAP2 PE=1 SV=1 339 390 3.0E-06
sp|Q06449|PIN3_YEAST [PSI+] inducibility protein 3 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=PIN3 PE=1 SV=1 341 391 3.0E-06
sp|Q5I0D6|NOSTN_RAT Nostrin OS=Rattus norvegicus GN=Nostrin PE=1 SV=1 275 391 3.0E-06
sp|Q9Z0R4|ITSN1_MOUSE Intersectin-1 OS=Mus musculus GN=Itsn1 PE=1 SV=2 338 392 4.0E-06
sp|Q99469|STAC_HUMAN SH3 and cysteine-rich domain-containing protein OS=Homo sapiens GN=STAC PE=1 SV=1 334 391 4.0E-06
sp|Q66II3|GRB2_XENTR Growth factor receptor-bound protein 2 OS=Xenopus tropicalis GN=grb2 PE=2 SV=1 341 390 6.0E-06
sp|Q6GPJ9|GRB2B_XENLA Growth factor receptor-bound protein 2-B OS=Xenopus laevis GN=grb2-b PE=1 SV=1 328 390 6.0E-06
sp|Q91X43|SH319_MOUSE SH3 domain-containing protein 19 OS=Mus musculus GN=Sh3d19 PE=1 SV=2 316 392 6.0E-06
sp|A0JNJ1|STAC_BOVIN SH3 and cysteine-rich domain-containing protein OS=Bos taurus GN=STAC PE=2 SV=1 317 391 7.0E-06
sp|P34109|MYOD_DICDI Myosin ID heavy chain OS=Dictyostelium discoideum GN=myoD PE=1 SV=2 336 392 7.0E-06
sp|Q5ZJJ9|OSTF1_CHICK Osteoclast-stimulating factor 1 OS=Gallus gallus GN=OSTF1 PE=2 SV=1 341 390 9.0E-06
[Show less]

GO

GO Term Description Terminal node
GO:0005515 protein binding Yes
GO:0003674 molecular_function No
GO:0005488 binding No

Deeploc

Deeploc data not available for this genome

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

No expression data available for this genome

Orthologs

Orthofinder run ID4
Orthogroup2570
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|3532
Ophiocordyceps australis map64 (Brazil) OphauB2|7278 (this protein)
Ophiocordyceps camponoti-floridani Ophcf2|01444
Ophiocordyceps camponoti-rufipedis Ophun1|5701
Ophiocordyceps kimflemingae Ophio5|1405
Ophiocordyceps subramaniannii Hirsu2|3831

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >OphauB2|7278
MGLNNPIPSSVKSECKKCARILASFVNPRQSFGPDKVIPPSILSNAKGLAVITILKAGFLGSGRIGSGVVVARLA
DGSWSAPSAIVLGGAGFGGQIGFELADFVFVLNDASAVKTFAQAGSLTLGGNVSLAAGPVGRNAEAAGAASLKSV
AGIFSYSKTRGLFAGVSLEGSAIIERRDANETLYATRYTAQQILTGSVRPPAEAQALMAVLNSRAFSGLRAGAVP
DDAMYNDMPVYSNDHDDVVWEGRRGSALGEGVHHNRTGAALSRSSTWQDDIYDRPSPAARSNTFSPDDSDYVYRD
HPLPSQKTGASSIAPGRPSAPKPNFGAPRKPPLLGKNEAIALFTFEADQPGDLGFKKGDIITVLKKTESDNDWWT
GMLGTKHGIFPSNYVKMKD*
Coding >OphauB2|7278
ATGGGCCTCAACAACCCCATCCCCTCATCCGTCAAATCCGAGTGCAAGAAATGCGCCCGCATCCTCGCCTCCTTT
GTCAATCCTCGACAATCCTTTGGCCCCGACAAGGTCATCCCTCCCTCCATCCTCTCCAACGCAAAGGGCCTCGCC
GTAATCACCATTCTCAAGGCCGGCTTCCTCGGCTCCGGCCGCATCGGCTCCGGCGTCGTTGTTGCGCGCCTCGCC
GACGGCTCGTGGAGCGCCCCCAGCGCCATTGTCCTGGGCGGCGCCGGCTTTGGCGGCCAAATCGGCTTCGAGCTG
GCAGACTTTGTCTTTGTGCTTAATGACGCCAGCGCCGTAAAGACATTTGCCCAGGCCGGCTCCCTCACCCTCGGC
GGCAACGTGTCGCTTGCCGCCGGGCCCGTTGGCCGCAACGCTGAAGCTGCCGGCGCCGCGTCGCTAAAGAGCGTC
GCCGGCATCTTTAGCTACTCAAAGACGCGCGGCCTCTTTGCCGGCGTCTCCCTCGAGGGCTCCGCCATTATCGAA
CGCCGCGACGCCAACGAAACCCTCTACGCCACGCGCTACACCGCCCAGCAAATCCTTACCGGCTCCGTCCGCCCT
CCCGCCGAAGCCCAAGCCCTCATGGCCGTCCTCAACTCGCGCGCCTTTAGCGGCCTCCGCGCCGGCGCCGTTCCA
GACGACGCAATGTACAACGACATGCCCGTCTACTCAAACGACCACGACGACGTGGTTTGGGAGGGCCGCCGCGGC
AGTGCCCTCGGCGAAGGCGTCCACCACAACCGCACCGGCGCCGCCCTCTCCCGCTCCTCCACCTGGCAAGACGAC
ATTTACGATCGCCCTTCTCCCGCCGCCCGCTCAAACACTTTTTCCCCAGACGACTCGGATTACGTCTACCGCGAC
CATCCCTTGCCCTCGCAAAAGACTGGCGCCTCGTCCATCGCCCCCGGCCGCCCCTCGGCCCCAAAGCCAAACTTT
GGCGCCCCCAGGAAGCCGCCTCTGCTCGGCAAGAATGAGGCCATTGCCCTCTTTACCTTTGAAGCCGACCAGCCC
GGCGACTTGGGCTTCAAAAAGGGCGACATTATTACCGTGCTGAAGAAGACGGAGAGCGATAATGACTGGTGGACA
GGCATGCTTGGCACCAAGCACGGCATCTTTCCCAGCAACTACGTCAAAATGAAAGACTAG
Transcript >OphauB2|7278
ATGGGCCTCAACAACCCCATCCCCTCATCCGTCAAATCCGAGTGCAAGAAATGCGCCCGCATCCTCGCCTCCTTT
GTCAATCCTCGACAATCCTTTGGCCCCGACAAGGTCATCCCTCCCTCCATCCTCTCCAACGCAAAGGGCCTCGCC
GTAATCACCATTCTCAAGGCCGGCTTCCTCGGCTCCGGCCGCATCGGCTCCGGCGTCGTTGTTGCGCGCCTCGCC
GACGGCTCGTGGAGCGCCCCCAGCGCCATTGTCCTGGGCGGCGCCGGCTTTGGCGGCCAAATCGGCTTCGAGCTG
GCAGACTTTGTCTTTGTGCTTAATGACGCCAGCGCCGTAAAGACATTTGCCCAGGCCGGCTCCCTCACCCTCGGC
GGCAACGTGTCGCTTGCCGCCGGGCCCGTTGGCCGCAACGCTGAAGCTGCCGGCGCCGCGTCGCTAAAGAGCGTC
GCCGGCATCTTTAGCTACTCAAAGACGCGCGGCCTCTTTGCCGGCGTCTCCCTCGAGGGCTCCGCCATTATCGAA
CGCCGCGACGCCAACGAAACCCTCTACGCCACGCGCTACACCGCCCAGCAAATCCTTACCGGCTCCGTCCGCCCT
CCCGCCGAAGCCCAAGCCCTCATGGCCGTCCTCAACTCGCGCGCCTTTAGCGGCCTCCGCGCCGGCGCCGTTCCA
GACGACGCAATGTACAACGACATGCCCGTCTACTCAAACGACCACGACGACGTGGTTTGGGAGGGCCGCCGCGGC
AGTGCCCTCGGCGAAGGCGTCCACCACAACCGCACCGGCGCCGCCCTCTCCCGCTCCTCCACCTGGCAAGACGAC
ATTTACGATCGCCCTTCTCCCGCCGCCCGCTCAAACACTTTTTCCCCAGACGACTCGGATTACGTCTACCGCGAC
CATCCCTTGCCCTCGCAAAAGACTGGCGCCTCGTCCATCGCCCCCGGCCGCCCCTCGGCCCCAAAGCCAAACTTT
GGCGCCCCCAGGAAGCCGCCTCTGCTCGGCAAGAATGAGGCCATTGCCCTCTTTACCTTTGAAGCCGACCAGCCC
GGCGACTTGGGCTTCAAAAAGGGCGACATTATTACCGTGCTGAAGAAGACGGAGAGCGATAATGACTGGTGGACA
GGCATGCTTGGCACCAAGCACGGCATCTTTCCCAGCAACTACGTCAAAATGAAAGACTAG
Gene >OphauB2|7278
ATGGGCCTCAACAACCCCATCCCCTCATCCGTCAAATGTTCGCCCCCCCTTCTCTCCCTCTCCCTCTCTAGCTGA
CGCGTCCCTCCCTTCCTAGCCGAGTGCAAGAAATGCGCCCGCATCCTCGCCTCCTTTGTCAATCCTCGACAATCC
TTTGGCCCCGACAAGGTCATCCCTCCCTCCATCCTCTCCAACGCAAAGGGCCTCGCCGTAATCACCATTCTCAAG
GCCGGCTTCCTCGGCTCCGGCCGCATCGGCTCCGGCGTCGTTGTTGCGCGCCTCGCCGACGGCTCGTGGAGCGCC
CCCAGCGCCATTGTCCTGGGCGGCGCCGGCTTTGGCGGCCAAATCGGCTTCGAGCTGGCAGACTTTGTCTTTGTG
CTTAATGACGCCAGCGCCGTAAAGACATTTGCCCAGGCCGGCTCCCTCACCCTCGGCGGCAACGTGTCGCTTGCC
GCCGGGCCCGTTGGCCGCAACGCTGAAGCTGCCGGCGCCGCGTCGCTAAAGAGCGTCGCCGGCATCTTTAGCTAC
TCAAAGACGCGCGGCCTCTTTGCCGGCGTCTCCCTCGAGGGCTCCGCCATTATCGAACGCCGCGACGCCAACGAA
ACCCTCTACGCCACGCGCTACACCGCCCAGCAAATCCTTACCGGCTCCGTCCGCCCTCCCGCCGAAGCCCAAGCC
CTCATGGCCGTCCTCAACTCGCGCGCCTTTAGCGGCCTCCGCGCCGGCGCCGTTCCAGACGACGCAATGTACAAC
GACATGCCCGTCTACTCAAACGACCACGACGACGTGGTTTGGGAGGGCCGCCGCGGCAGTGCCCTCGGCGAAGGC
GTCCACCACAACCGCACCGGCGCCGCCCTCTCCCGCTCCTCCACCTGGCAAGACGACATTTACGATCGCCCTTCT
CCCGCCGCCCGCTCAAACACTTTTTCCCCAGACGACTCGGATTACGTCTACCGCGACCATCCCTTGCCCTCGCAA
AAGACTGGCGCCTCGTCCATCGCCCCCGGCCGCCCCTCGGCCCCAAAGCCAAACTTTGGCGCCCCCAGGAAGCCG
CCTCTGCTCGGCAAGAATGAGGCCATTGCCCTCTTTACCTTTGAAGCCGACCAGCCCGGCGACTTGGGCTTCAAA
AAGGGCGACATTATTACCGTGCTGAAGAAGACGGAGAGCGATAATGACTGGTGGTGTGTAGCCTCGTCTCTTGCT
TTTATAATCAAGTCTCGTATTCTTTGAGCAATGATTTACCCCCAAAACCTAGCCTTTTAGTCCCTGCTGACTCTT
TACAACAGGACAGGCATGCTTGGCACCAAGCACGGCATCTTTCCCAGCAACTACGTCAAAATGAAAGACTAG

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail