Fungal Genomics

at Utrecht University

General Properties

Protein IDOphauB2|7271
Gene name
LocationContig_76:30622..33925
Strand-
Gene length (bp)3303
Transcript length (bp)3027
Coding sequence length (bp)3027
Protein length (aa) 1009

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF01388 ARID ARID/BRIGHT DNA binding domain 2.3E-17 19 106

Swissprot hits

Swissprot ID Swissprot Description Start End E-value
sp|Q9P7W8|RSC9_SCHPO Chromatin structure-remodeling complex subunit rsc9 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=rsc9 PE=1 SV=1 336 778 2.0E-37
sp|Q03124|RSC9_YEAST Chromatin structure-remodeling complex subunit RSC9 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=RSC9 PE=1 SV=1 503 752 2.0E-26
sp|Q9P7W8|RSC9_SCHPO Chromatin structure-remodeling complex subunit rsc9 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=rsc9 PE=1 SV=1 16 120 2.0E-06
sp|P29374|ARI4A_HUMAN AT-rich interactive domain-containing protein 4A OS=Homo sapiens GN=ARID4A PE=1 SV=3 22 124 3.0E-06
sp|Q8IN94|OSA_DROME Trithorax group protein osa OS=Drosophila melanogaster GN=osa PE=1 SV=1 10 107 8.0E-06

GO

GO Term Description Terminal node
GO:0003677 DNA binding Yes
GO:0003674 molecular_function No
GO:0005488 binding No
GO:1901363 heterocyclic compound binding No
GO:0097159 organic cyclic compound binding No
GO:0003676 nucleic acid binding No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 40 0.45

Transmembrane Domains

(None)

Transcription Factor Class

Transcription Factor Class
(based on PFAM domains)
ARID/BRIGHT

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >OphauB2|7271
MTTSPQEVPMHTIDRTPQYEEFMTQLRDYHVKRGTTLDPEPKVGMTHLDLFKVFNHIVANGGYDKVSEEKLAWRR
MAAELGIHSNNEASTAFALKEKFYKNLAAFEISTVHKREPPPKEILEDVTAKGASLLTRTRENFRGKRESNMNAT
DSAASGDDGTPTRERPAAESQTSSARASRGLREAPPQRVIFQPDTGPGRATRQTNSNASTTAATSATPSQQPPAT
SQQSSRITSAPPAAHPPHHNIQHHQQPTTMQPMSHGLPNYAGRGGPAIVHRPINGQNMSPMVLAYQPKHMKPLHA
RPVGAPGNTPNELQKQRLSHRPAMYDPASRQPMLPGTGFDGPNIYTRCLNSLRSSVVAEQSFALNHLVKISFERG
DKFRFDAFPALAEGLVEKALQVGSLFYDVNWTVVWDMSLEWADIGCLDGNDGTPDILERIESLVEKDVPEQLQTA
EFADQLTLVTEATLTMRNMVTLPENAHSMSDFCPLKDLLCIILQLPPKDSVTEMKHLALDIAEQLTPYMSLDADD
ALYKSLVAQLASEDRGTILTALRAIGRISMNLEATNKLEGVSTATLQRIVNWLLLNDDELTDACLDFLYQYTAVP
SNLDNLFRTASPDGLVDHLVRLLAHAAHTNVWETVLRSEQRMPSRNEIAPVPEDLLQELIKLDEPDRVHQWVRCF
FDEDEHSFITQLAAWQAYQSAFVQATKAVGKPMISPADFIRNSTSVYARTTAQVLRERGEPQQKFIIHGIRARPR
PLNRRNEKCGQFYLRAEQMWNHIMTVHLGETRSAKADGKDDEGKEEPRSQAADKDQAKSDKKQDDEGMGQEKTDG
EPKSNNGASDCPAAKFANVERELQCTWGDCCKYAKPTRIRLRDFALHVNTHIMAMLPGTDSVRLKATHPPWLIPA
LHRRIRHEETARDERPVQMGLGWDKVQAAGIPVSAVLVLRNIARNAAKTEAGEEEQQRSGAKMSLCERLFWPQRP
RLFEILTENKYMRPHVSSLLEIICTESDPNQGD*
Coding >OphauB2|7271
ATGACAACTTCGCCGCAGGAAGTGCCGATGCACACCATCGACCGCACACCGCAATATGAGGAATTTATGACGCAG
CTGCGAGACTACCATGTCAAGCGTGGCACGACTCTGGATCCTGAGCCCAAGGTGGGCATGACACACCTGGATCTC
TTCAAGGTCTTCAACCACATTGTTGCCAATGGCGGCTACGACAAGGTGTCGGAGGAGAAGCTGGCCTGGAGGCGC
ATGGCAGCCGAGCTTGGAATCCACTCCAACAATGAAGCCTCCACCGCCTTTGCCCTCAAGGAGAAGTTCTATAAG
AACCTGGCAGCATTCGAGATTAGCACTGTGCACAAGAGGGAGCCACCGCCAAAGGAAATTCTCGAAGATGTGACA
GCAAAGGGCGCCAGTCTGCTGACTCGAACGCGTGAAAACTTTCGTGGGAAGCGAGAGAGCAACATGAATGCCACC
GACTCGGCTGCATCTGGTGACGATGGCACACCTACGCGCGAACGTCCGGCCGCCGAGAGCCAGACGTCGAGCGCC
CGCGCGTCAAGGGGCTTGCGCGAGGCGCCTCCCCAAAGAGTCATTTTCCAACCAGACACTGGCCCTGGACGAGCA
ACGCGCCAGACAAACTCCAATGCATCAACTACTGCCGCCACCTCAGCCACACCATCTCAGCAACCGCCAGCCACA
AGCCAACAATCTTCACGAATTACTTCTGCACCACCAGCTGCCCACCCACCACATCACAATATCCAACATCATCAA
CAGCCCACCACCATGCAGCCCATGTCGCATGGGCTGCCGAATTATGCCGGCCGCGGCGGGCCAGCAATTGTGCAC
CGTCCCATCAATGGCCAAAACATGTCCCCCATGGTTCTGGCATATCAGCCCAAGCACATGAAGCCCTTGCATGCT
CGCCCGGTTGGCGCTCCCGGCAACACCCCCAATGAACTCCAGAAACAACGCTTGTCGCATCGTCCTGCCATGTAC
GATCCCGCTAGTCGTCAACCCATGCTACCAGGCACTGGCTTTGACGGGCCCAATATATACACTCGATGCCTCAAC
TCGCTGCGATCGAGCGTTGTCGCGGAGCAATCATTTGCCCTCAATCACCTGGTCAAGATTTCATTTGAACGCGGG
GACAAGTTCCGCTTCGACGCTTTCCCAGCTCTTGCAGAGGGCCTTGTTGAAAAGGCTTTGCAGGTTGGCAGCCTC
TTTTACGATGTCAACTGGACCGTTGTTTGGGACATGTCTCTTGAATGGGCTGACATTGGCTGCTTGGACGGCAAC
GACGGCACGCCCGACATTTTGGAGCGCATTGAAAGCCTGGTGGAAAAGGACGTGCCAGAGCAATTGCAAACGGCA
GAGTTTGCCGACCAACTGACTCTGGTGACTGAGGCTACGCTTACAATGCGCAACATGGTGACGCTGCCGGAGAAT
GCCCACAGCATGTCTGACTTTTGTCCGCTCAAAGACTTGCTCTGCATCATCTTGCAATTACCGCCCAAGGACTCG
GTCACTGAGATGAAGCATCTGGCTCTCGATATTGCCGAGCAGTTGACGCCCTACATGTCTCTGGACGCTGACGAC
GCGCTGTATAAGTCGCTTGTTGCACAGTTGGCATCCGAGGACCGTGGCACGATTCTGACGGCACTACGAGCTATT
GGGCGCATTTCGATGAATCTTGAGGCGACAAACAAACTCGAGGGCGTGTCTACAGCGACTCTGCAACGCATTGTA
AATTGGTTGCTGCTAAACGACGACGAGCTGACGGATGCCTGCCTTGACTTTCTCTACCAGTACACGGCCGTGCCG
TCCAATCTGGACAATTTGTTTAGGACGGCATCTCCCGACGGCCTGGTGGACCATCTTGTGCGGCTGCTGGCCCAT
GCAGCACACACAAATGTTTGGGAGACTGTACTGCGATCTGAGCAGCGCATGCCTTCGCGAAACGAGATTGCTCCG
GTACCCGAAGACTTGCTCCAGGAACTTATCAAGCTGGACGAGCCGGACCGCGTGCACCAATGGGTCAGGTGTTTT
TTTGACGAGGACGAGCATTCCTTTATTACGCAGCTCGCAGCCTGGCAGGCCTACCAGTCGGCCTTTGTGCAGGCC
ACCAAGGCTGTGGGCAAGCCCATGATTTCCCCGGCCGACTTTATCCGCAACAGCACATCAGTATACGCGCGGACA
ACGGCCCAAGTGCTGCGGGAGCGGGGCGAGCCGCAGCAAAAGTTTATTATTCACGGCATCCGAGCACGGCCACGG
CCACTCAATCGGCGCAACGAAAAGTGCGGCCAATTTTATCTGCGCGCAGAACAAATGTGGAATCACATCATGACG
GTTCACTTGGGCGAGACGCGCAGTGCCAAGGCTGACGGCAAGGACGACGAGGGCAAGGAGGAGCCAAGGAGCCAA
GCTGCCGACAAGGACCAAGCCAAGAGTGACAAGAAGCAAGACGACGAGGGCATGGGCCAAGAAAAGACGGACGGC
GAGCCCAAGAGCAACAATGGCGCCAGCGACTGCCCAGCCGCCAAATTTGCCAATGTCGAGCGCGAGCTGCAGTGC
ACATGGGGCGACTGCTGCAAATACGCAAAGCCCACACGCATCCGCCTGCGCGATTTCGCCCTCCACGTCAACACA
CACATCATGGCCATGCTCCCCGGCACCGACTCTGTCCGCCTCAAGGCGACGCACCCGCCCTGGCTCATTCCCGCG
CTGCACCGCCGCATCCGCCACGAGGAGACGGCGCGCGACGAGCGCCCCGTGCAAATGGGGCTCGGCTGGGACAAG
GTGCAGGCGGCGGGCATACCCGTCAGTGCGGTGCTGGTGCTGCGCAACATTGCGCGCAATGCGGCCAAGACGGAG
GCTGGCGAGGAGGAGCAGCAGAGGAGCGGCGCAAAAATGAGTCTCTGCGAGCGGCTCTTTTGGCCCCAGCGCCCA
CGCCTCTTTGAGATTTTGACTGAGAATAAGTACATGCGCCCTCACGTATCCTCCCTCTTGGAGATTATCTGCACG
GAAAGCGACCCAAACCAAGGTGATTAA
Transcript >OphauB2|7271
ATGACAACTTCGCCGCAGGAAGTGCCGATGCACACCATCGACCGCACACCGCAATATGAGGAATTTATGACGCAG
CTGCGAGACTACCATGTCAAGCGTGGCACGACTCTGGATCCTGAGCCCAAGGTGGGCATGACACACCTGGATCTC
TTCAAGGTCTTCAACCACATTGTTGCCAATGGCGGCTACGACAAGGTGTCGGAGGAGAAGCTGGCCTGGAGGCGC
ATGGCAGCCGAGCTTGGAATCCACTCCAACAATGAAGCCTCCACCGCCTTTGCCCTCAAGGAGAAGTTCTATAAG
AACCTGGCAGCATTCGAGATTAGCACTGTGCACAAGAGGGAGCCACCGCCAAAGGAAATTCTCGAAGATGTGACA
GCAAAGGGCGCCAGTCTGCTGACTCGAACGCGTGAAAACTTTCGTGGGAAGCGAGAGAGCAACATGAATGCCACC
GACTCGGCTGCATCTGGTGACGATGGCACACCTACGCGCGAACGTCCGGCCGCCGAGAGCCAGACGTCGAGCGCC
CGCGCGTCAAGGGGCTTGCGCGAGGCGCCTCCCCAAAGAGTCATTTTCCAACCAGACACTGGCCCTGGACGAGCA
ACGCGCCAGACAAACTCCAATGCATCAACTACTGCCGCCACCTCAGCCACACCATCTCAGCAACCGCCAGCCACA
AGCCAACAATCTTCACGAATTACTTCTGCACCACCAGCTGCCCACCCACCACATCACAATATCCAACATCATCAA
CAGCCCACCACCATGCAGCCCATGTCGCATGGGCTGCCGAATTATGCCGGCCGCGGCGGGCCAGCAATTGTGCAC
CGTCCCATCAATGGCCAAAACATGTCCCCCATGGTTCTGGCATATCAGCCCAAGCACATGAAGCCCTTGCATGCT
CGCCCGGTTGGCGCTCCCGGCAACACCCCCAATGAACTCCAGAAACAACGCTTGTCGCATCGTCCTGCCATGTAC
GATCCCGCTAGTCGTCAACCCATGCTACCAGGCACTGGCTTTGACGGGCCCAATATATACACTCGATGCCTCAAC
TCGCTGCGATCGAGCGTTGTCGCGGAGCAATCATTTGCCCTCAATCACCTGGTCAAGATTTCATTTGAACGCGGG
GACAAGTTCCGCTTCGACGCTTTCCCAGCTCTTGCAGAGGGCCTTGTTGAAAAGGCTTTGCAGGTTGGCAGCCTC
TTTTACGATGTCAACTGGACCGTTGTTTGGGACATGTCTCTTGAATGGGCTGACATTGGCTGCTTGGACGGCAAC
GACGGCACGCCCGACATTTTGGAGCGCATTGAAAGCCTGGTGGAAAAGGACGTGCCAGAGCAATTGCAAACGGCA
GAGTTTGCCGACCAACTGACTCTGGTGACTGAGGCTACGCTTACAATGCGCAACATGGTGACGCTGCCGGAGAAT
GCCCACAGCATGTCTGACTTTTGTCCGCTCAAAGACTTGCTCTGCATCATCTTGCAATTACCGCCCAAGGACTCG
GTCACTGAGATGAAGCATCTGGCTCTCGATATTGCCGAGCAGTTGACGCCCTACATGTCTCTGGACGCTGACGAC
GCGCTGTATAAGTCGCTTGTTGCACAGTTGGCATCCGAGGACCGTGGCACGATTCTGACGGCACTACGAGCTATT
GGGCGCATTTCGATGAATCTTGAGGCGACAAACAAACTCGAGGGCGTGTCTACAGCGACTCTGCAACGCATTGTA
AATTGGTTGCTGCTAAACGACGACGAGCTGACGGATGCCTGCCTTGACTTTCTCTACCAGTACACGGCCGTGCCG
TCCAATCTGGACAATTTGTTTAGGACGGCATCTCCCGACGGCCTGGTGGACCATCTTGTGCGGCTGCTGGCCCAT
GCAGCACACACAAATGTTTGGGAGACTGTACTGCGATCTGAGCAGCGCATGCCTTCGCGAAACGAGATTGCTCCG
GTACCCGAAGACTTGCTCCAGGAACTTATCAAGCTGGACGAGCCGGACCGCGTGCACCAATGGGTCAGGTGTTTT
TTTGACGAGGACGAGCATTCCTTTATTACGCAGCTCGCAGCCTGGCAGGCCTACCAGTCGGCCTTTGTGCAGGCC
ACCAAGGCTGTGGGCAAGCCCATGATTTCCCCGGCCGACTTTATCCGCAACAGCACATCAGTATACGCGCGGACA
ACGGCCCAAGTGCTGCGGGAGCGGGGCGAGCCGCAGCAAAAGTTTATTATTCACGGCATCCGAGCACGGCCACGG
CCACTCAATCGGCGCAACGAAAAGTGCGGCCAATTTTATCTGCGCGCAGAACAAATGTGGAATCACATCATGACG
GTTCACTTGGGCGAGACGCGCAGTGCCAAGGCTGACGGCAAGGACGACGAGGGCAAGGAGGAGCCAAGGAGCCAA
GCTGCCGACAAGGACCAAGCCAAGAGTGACAAGAAGCAAGACGACGAGGGCATGGGCCAAGAAAAGACGGACGGC
GAGCCCAAGAGCAACAATGGCGCCAGCGACTGCCCAGCCGCCAAATTTGCCAATGTCGAGCGCGAGCTGCAGTGC
ACATGGGGCGACTGCTGCAAATACGCAAAGCCCACACGCATCCGCCTGCGCGATTTCGCCCTCCACGTCAACACA
CACATCATGGCCATGCTCCCCGGCACCGACTCTGTCCGCCTCAAGGCGACGCACCCGCCCTGGCTCATTCCCGCG
CTGCACCGCCGCATCCGCCACGAGGAGACGGCGCGCGACGAGCGCCCCGTGCAAATGGGGCTCGGCTGGGACAAG
GTGCAGGCGGCGGGCATACCCGTCAGTGCGGTGCTGGTGCTGCGCAACATTGCGCGCAATGCGGCCAAGACGGAG
GCTGGCGAGGAGGAGCAGCAGAGGAGCGGCGCAAAAATGAGTCTCTGCGAGCGGCTCTTTTGGCCCCAGCGCCCA
CGCCTCTTTGAGATTTTGACTGAGAATAAGTACATGCGCCCTCACGTATCCTCCCTCTTGGAGATTATCTGCACG
GAAAGCGACCCAAACCAAGGTGATTAA
Gene >OphauB2|7271
ATGACAACTTCGCCGCAGGAAGTGCCGATGCACACCATCGACCGCACACCGCAATATGAGGAATTTATGACGCAG
CTGCGAGACTACCATGTCAAGCGTGGCACGACTCTGGATCCTGAGCCCAAGGTGGGCATGACACACCTGGATCTC
TTCAAGGTCTTCAACCACATTGTTGCCAATGGCGGCTACGACAAGGTGTCGGAGGAGAAGCTGGCCTGGAGGCGC
ATGGCAGCCGAGCTTGGAATCCACTCCAACAATGAAGCCTCCACCGCCTTTGCCCTCAAGGAGAAGTTCTATAAG
AACCTGGCAGCATTCGAGATTAGCACTGTGCACAAGAGGGAGCCACCGCCAAAGGAAATTCTCGAAGATGTGACA
GCAAAGGGCGCCAGTCTGCTGACTCGAACGCGTGAAAACTTTCGTGGGAAGCGAGAGAGCAACATGAATGCCACC
GACTCGGCTGCATCTGGTGACGATGGCACACCTACGCGCGAACGTCCGGCCGCCGAGAGCCAGACGTCGAGCGCC
CGCGCGTCAAGGGGCTTGCGCGAGGCGCCTCCCCAAAGAGTCATTTTCCAACCAGACACTGGCCCTGGACGAGCA
ACGCGCCAGACAAACTCCAATGCATCAACTACTGCCGCCACCTCAGCCACACCATCTCAGCAACCGCCAGCCACA
AGCCAACAATCTTCACGAATTACTTCTGCACCACCAGCTGCCCACCCACCACATCACAATATCCAACATCATCAA
CAGCCCACCACCATGCAGCCCATGTCGCATGGGCTGCCGAATTATGCCGGCCGCGGCGGGCCAGCAATTGTGCAC
CGTCCCATCAATGGCCAAAACATGTCCCCCATGGTTCTGGCATATCAGCCCAAGCACATGAAGCCCTTGCATGCT
CGCCCGGTTGGCGCTCCCGGCAACACCCCCAATGAACTCCAGAAACAACGCTTGTCGCATCGTCCTGCCATGTAC
GATCCCGCTAGTCGTCAACCCATGCTACCAGGCAGTAAGTTTTTAGCCGCGCCGAGACACTTGACCTGACTTGGA
ATTGACTCGTTTTTCCCCCTCACTCCTTTCTTGTAGCTGGCTTTGACGGGCCCAATATATACACTCGATGCCTCA
ACTCGCTGCGATCGAGCGTTGTCGCGGAGCAATCATTTGCCCTCAATCACCTGGTCAAGATTTCATTTGAACGCG
GGGACAAGTTCCGCTTCGACGCTTTCCCAGCTCTTGCAGAGGGCCTTGTTGAAAAGGCTTTGCAGGTTGGCAGCC
TCTTTTACGATGTCAACTGGACCGTTGTTTGGGACATGTCTCTTGAATGGGCTGACATTGGCTGCTTGGACGGCA
ACGACGGCACGCCCGACATTTTGGAGCGCATTGAAAGCCTGGTGGAAAAGGACGTGCCAGAGCAATTGCAAACGG
CAGAGTTTGCCGACCAACTGACTCTGGTGACTGAGGCTACGCTTACAATGCGCAACATGGTGACGCTGCCGGAGA
ATGCCCACAGCATGTCTGACTTTTGTCCGCTCAAAGACTTGCTCTGCATCATCTTGCAATTACCGCCCAAGGACT
CGGTCACTGAGATGAAGCATCTGGCTCTCGATATTGCCGAGCAGTTGACGCCCTACATGTCTCTGGACGCTGACG
ACGCGCTGTATAAGTCGCTTGTTGCACAGTTGGCATCCGAGGACCGTGGCACGATTCTGACGGCACTACGAGCTA
TTGGGCGCATTTCGATGAATCTTGAGGCGACAAACAAACTCGAGGGCGTGTCTACAGCGACTCTGCAACGCATTG
TAAATTGGTTGCTGCTAAACGACGACGAGCTGACGGATGCCTGCCTTGACTTTCTCTACCAGTACACGGCCGTGC
CGTCCAATCTGGACAATTTGTTTAGGACGGCATCTCCCGACGGCCTGGTGGACCATCTTGTGCGGCTGCTGGCCC
ATGCAGCACACACAAATGTTTGGGAGACTGTACTGCGATCTGAGCAGCGCATGCCTTCGCGAAACGAGATTGCTC
CGGTACCCGAAGACTTGCTCCAGGAACTTATCAAGCTGGACGAGCCGGACCGCGTGCACCAATGGGTCAGGTGTT
TTTTTGACGAGGACGAGCATTCCTTTATTACGCAGCTCGCAGCCTGGCAGGCCTACCAGTCGGCCTTTGTGCAGG
CCACCAAGGCTGTGGGCAAGCCCATGATTTCCCCGGCCGACTTTATCCGCAACAGCACATCAGTATACGCGCGGA
CAACGGCCCAAGTGCTGCGGGAGCGGGGCGAGCCGCAGCAAAAGTTTATTATTCACGGCATCCGAGCACGGCCAC
GGCCACTCAGTCTAGATGGCACCGAGTATGGACGTTGCCTTTGGGCTAACAACCCAGATCGGCGCAACGAAAAGT
GCGGCCAATTTTATCTGCGCGCAGAACAAATGTGGAATCACATCATGACGGTTCACTTGGGCGAGACGCGCAGTG
CCAAGGCTGACGGCAAGGACGACGAGGGCAAGGAGGAGCCAAGGAGCCAAGCTGCCGACAAGGACCAAGCCAAGA
GTGACAAGAAGCAAGACGACGAGGGCATGGGCCAAGAAAAGACGGACGGCGAGCCCAAGAGCAACAATGGCGCCA
GCGACTGCCCAGCCGCCAAATTTGCCAATGTCGAGCGCGAGCTGCAGTGCACATGGGGCGACTGCTGCAAATACG
CAAAGCCCACACGCATCCGCCTGCGCGATTTCGCCCTCCACGTCAACACACACATCATGGCCATGCTCCCCGGCA
CCGACTCTGTCCGCCTCAAGGCGACGCACCCGCCCTGGCTCATTCCCGCGCTGCACCGCCGCATCCGCCACGAGG
AGACGGCGCGCGACGAGCGCCCCGTGCAAATGGGGCTCGGCTGGGACAAGGTGCAGGCGGCGGGCATACCCGTCA
GTGCGGTGCTGGTGCTGCGCAACATTGCGCGCAATGCGGCCAAGACGGAGGCTGGCGAGGAGGAGCAGCAGAGGA
GCGGCGCAAAAATGAGTCTCTGCGAGCGGCTCTTTTGGCCCCAGCGCCCACGCCTCTTTGAGATTTTGACTGAGA
ATAAGTACATGGTGAGTTTTTTTTTTCTCTCTCCTTTTTTTTTCCCTCTTTTTTCTCTCCTTTTTTCTCTCTCCT
TTTCCCTCTTTCTTTATACAAACCCCGTCTGCCACCTTTGCACCATGGGTTTTTTTTATCCTCCTTGCCCGTGAC
TAACACTTGCAGCGCCCTCACGTATCCTCCCTCTTGGAGATTATCTGCACGGAAAGCGACCCAAACCAAGGTGAT
TAA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail