Fungal Genomics

at Utrecht University

General Properties

Protein IDOphauB2|7264
Gene name
LocationContig_76:5768..7424
Strand-
Gene length (bp)1656
Transcript length (bp)1656
Coding sequence length (bp)1656
Protein length (aa) 552

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF01926 MMR_HSR1 50S ribosome-binding GTPase 1.5E-11 195 354
PF00009 GTP_EFTU Elongation factor Tu GTP binding domain 1.3E-06 192 405

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q042T8|ENGB_LACGA Probable GTP-binding protein EngB OS=Lactobacillus gasseri (strain ATCC 33323 / DSM 20243 / JCM 1131 / NCIMB 11718 / AM63) GN=engB PE=3 SV=1 190 358 2.0E-15
sp|Q67SJ6|ENGB_SYMTH Probable GTP-binding protein EngB OS=Symbiobacterium thermophilum (strain T / IAM 14863) GN=engB PE=3 SV=1 189 378 8.0E-15
sp|Q9K8F7|ENGB_BACHD Probable GTP-binding protein EngB OS=Bacillus halodurans (strain ATCC BAA-125 / DSM 18197 / FERM 7344 / JCM 9153 / C-125) GN=engB PE=3 SV=1 189 363 8.0E-12
sp|B1MXT9|ENGB_LEUCK Probable GTP-binding protein EngB OS=Leuconostoc citreum (strain KM20) GN=engB PE=3 SV=1 190 365 9.0E-12
sp|Q05473|MRX8_YEAST MIOREX complex component 8 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=MRX8 PE=1 SV=1 190 358 3.0E-11
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q042T8|ENGB_LACGA Probable GTP-binding protein EngB OS=Lactobacillus gasseri (strain ATCC 33323 / DSM 20243 / JCM 1131 / NCIMB 11718 / AM63) GN=engB PE=3 SV=1 190 358 2.0E-15
sp|Q67SJ6|ENGB_SYMTH Probable GTP-binding protein EngB OS=Symbiobacterium thermophilum (strain T / IAM 14863) GN=engB PE=3 SV=1 189 378 8.0E-15
sp|Q9K8F7|ENGB_BACHD Probable GTP-binding protein EngB OS=Bacillus halodurans (strain ATCC BAA-125 / DSM 18197 / FERM 7344 / JCM 9153 / C-125) GN=engB PE=3 SV=1 189 363 8.0E-12
sp|B1MXT9|ENGB_LEUCK Probable GTP-binding protein EngB OS=Leuconostoc citreum (strain KM20) GN=engB PE=3 SV=1 190 365 9.0E-12
sp|Q05473|MRX8_YEAST MIOREX complex component 8 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=MRX8 PE=1 SV=1 190 358 3.0E-11
sp|Q8DUH9|ENGB_STRMU Probable GTP-binding protein EngB OS=Streptococcus mutans serotype c (strain ATCC 700610 / UA159) GN=engB PE=3 SV=1 190 379 3.0E-11
sp|B2GBC5|ENGB_LACF3 Probable GTP-binding protein EngB OS=Lactobacillus fermentum (strain NBRC 3956 / LMG 18251) GN=engB PE=3 SV=1 192 358 4.0E-11
sp|Q7W2C4|ENGB_BORPA Probable GTP-binding protein EngB OS=Bordetella parapertussis (strain 12822 / ATCC BAA-587 / NCTC 13253) GN=engB PE=3 SV=1 193 373 5.0E-11
sp|Q7WR92|ENGB_BORBR Probable GTP-binding protein EngB OS=Bordetella bronchiseptica (strain ATCC BAA-588 / NCTC 13252 / RB50) GN=engB PE=3 SV=1 193 373 5.0E-11
sp|Q7VTA1|ENGB_BORPE Probable GTP-binding protein EngB OS=Bordetella pertussis (strain Tohama I / ATCC BAA-589 / NCTC 13251) GN=engB PE=3 SV=1 193 373 5.0E-11
sp|Q026Q1|ENGB_SOLUE Probable GTP-binding protein EngB OS=Solibacter usitatus (strain Ellin6076) GN=engB PE=3 SV=1 189 358 9.0E-11
sp|P0DA93|ENGB_STRPQ Probable GTP-binding protein EngB OS=Streptococcus pyogenes serotype M3 (strain SSI-1) GN=engB PE=3 SV=1 190 358 1.0E-10
sp|P0DA92|ENGB_STRP3 Probable GTP-binding protein EngB OS=Streptococcus pyogenes serotype M3 (strain ATCC BAA-595 / MGAS315) GN=engB PE=3 SV=1 190 358 1.0E-10
sp|Q48U21|ENGB_STRPM Probable GTP-binding protein EngB OS=Streptococcus pyogenes serotype M28 (strain MGAS6180) GN=engB PE=3 SV=1 190 358 1.0E-10
sp|Q9A088|ENGB_STRP1 Probable GTP-binding protein EngB OS=Streptococcus pyogenes serotype M1 GN=engB PE=3 SV=1 190 358 1.0E-10
sp|Q8P1C8|ENGB_STRP8 Probable GTP-binding protein EngB OS=Streptococcus pyogenes serotype M18 (strain MGAS8232) GN=engB PE=3 SV=1 190 358 1.0E-10
sp|Q5M0S3|ENGB_STRT1 Probable GTP-binding protein EngB OS=Streptococcus thermophilus (strain CNRZ 1066) GN=engB PE=3 SV=1 190 373 1.0E-10
sp|C0MA50|ENGB_STRE4 Probable GTP-binding protein EngB OS=Streptococcus equi subsp. equi (strain 4047) GN=engB PE=3 SV=1 190 358 1.0E-10
sp|Q5XCL9|ENGB_STRP6 Probable GTP-binding protein EngB OS=Streptococcus pyogenes serotype M6 (strain ATCC BAA-946 / MGAS10394) GN=engB PE=3 SV=1 190 358 1.0E-10
sp|Q1J740|ENGB_STRPF Probable GTP-binding protein EngB OS=Streptococcus pyogenes serotype M4 (strain MGAS10750) GN=engB PE=3 SV=1 190 358 1.0E-10
sp|A2RF16|ENGB_STRPG Probable GTP-binding protein EngB OS=Streptococcus pyogenes serotype M5 (strain Manfredo) GN=engB PE=3 SV=1 190 358 1.0E-10
sp|Q8E4L9|ENGB_STRA3 Probable GTP-binding protein EngB OS=Streptococcus agalactiae serotype III (strain NEM316) GN=engB PE=3 SV=1 190 358 1.0E-10
sp|Q03LM9|ENGB_STRTD Probable GTP-binding protein EngB OS=Streptococcus thermophilus (strain ATCC BAA-491 / LMD-9) GN=engB PE=3 SV=1 190 373 1.0E-10
sp|Q5M5A9|ENGB_STRT2 Probable GTP-binding protein EngB OS=Streptococcus thermophilus (strain ATCC BAA-250 / LMG 18311) GN=engB PE=3 SV=1 190 373 1.0E-10
sp|B9DU74|ENGB_STRU0 Probable GTP-binding protein EngB OS=Streptococcus uberis (strain ATCC BAA-854 / 0140J) GN=engB PE=3 SV=1 190 358 2.0E-10
sp|Q3K0K1|ENGB_STRA1 Probable GTP-binding protein EngB OS=Streptococcus agalactiae serotype Ia (strain ATCC 27591 / A909 / CDC SS700) GN=engB PE=3 SV=1 190 358 2.0E-10
sp|Q8DZ11|ENGB_STRA5 Probable GTP-binding protein EngB OS=Streptococcus agalactiae serotype V (strain ATCC BAA-611 / 2603 V/R) GN=engB PE=3 SV=1 190 358 2.0E-10
sp|Q1JC92|ENGB_STRPB Probable GTP-binding protein EngB OS=Streptococcus pyogenes serotype M12 (strain MGAS2096) GN=engB PE=3 SV=1 190 358 2.0E-10
sp|Q1JM76|ENGB_STRPC Probable GTP-binding protein EngB OS=Streptococcus pyogenes serotype M12 (strain MGAS9429) GN=engB PE=3 SV=1 190 358 2.0E-10
sp|Q1JHC1|ENGB_STRPD Probable GTP-binding protein EngB OS=Streptococcus pyogenes serotype M2 (strain MGAS10270) GN=engB PE=3 SV=1 190 358 2.0E-10
sp|B5XL04|ENGB_STRPZ Probable GTP-binding protein EngB OS=Streptococcus pyogenes serotype M49 (strain NZ131) GN=engB PE=3 SV=1 190 358 2.0E-10
sp|C0MEW6|ENGB_STRS7 Probable GTP-binding protein EngB OS=Streptococcus equi subsp. zooepidemicus (strain H70) GN=engB PE=3 SV=1 190 358 3.0E-10
sp|Q2SSN1|ENGB_MYCCT Probable GTP-binding protein EngB OS=Mycoplasma capricolum subsp. capricolum (strain California kid / ATCC 27343 / NCTC 10154) GN=engB PE=3 SV=1 188 358 3.0E-10
sp|C5BJZ8|ENGB_TERTT Probable GTP-binding protein EngB OS=Teredinibacter turnerae (strain ATCC 39867 / T7901) GN=engB PE=3 SV=1 171 358 4.0E-10
sp|Q8EPM2|ENGB_OCEIH Probable GTP-binding protein EngB OS=Oceanobacillus iheyensis (strain DSM 14371 / JCM 11309 / KCTC 3954 / HTE831) GN=engB PE=3 SV=1 190 358 6.0E-10
sp|Q21PP0|ENGB_SACD2 Probable GTP-binding protein EngB OS=Saccharophagus degradans (strain 2-40 / ATCC 43961 / DSM 17024) GN=engB PE=3 SV=1 170 358 4.0E-09
sp|Q1LI69|ENGB_CUPMC Probable GTP-binding protein EngB OS=Cupriavidus metallidurans (strain ATCC 43123 / DSM 2839 / NBRC 102507 / CH34) GN=engB PE=3 SV=2 168 376 1.0E-08
sp|Q2GAU7|ENGB_NOVAD Probable GTP-binding protein EngB OS=Novosphingobium aromaticivorans (strain DSM 12444 / F199) GN=engB PE=3 SV=1 158 366 2.0E-08
sp|B2T719|ENGB_BURPP Probable GTP-binding protein EngB OS=Burkholderia phytofirmans (strain DSM 17436 / PsJN) GN=engB PE=3 SV=1 171 358 2.0E-08
sp|Q21TK4|ENGB_RHOFT Probable GTP-binding protein EngB OS=Rhodoferax ferrireducens (strain ATCC BAA-621 / DSM 15236 / T118) GN=engB PE=3 SV=1 168 358 3.0E-08
sp|Q0K651|ENGB_CUPNH Probable GTP-binding protein EngB OS=Cupriavidus necator (strain ATCC 17699 / H16 / DSM 428 / Stanier 337) GN=engB PE=3 SV=1 168 358 4.0E-08
sp|B9MDD6|ENGB_ACIET Probable GTP-binding protein EngB OS=Acidovorax ebreus (strain TPSY) GN=engB PE=3 SV=1 191 358 5.0E-08
sp|B3R7D7|ENGB_CUPTR Probable GTP-binding protein EngB OS=Cupriavidus taiwanensis (strain R1 / LMG 19424) GN=engB PE=3 SV=1 168 358 6.0E-08
[Show less]

GO

GO Term Description Terminal node
GO:0005525 GTP binding Yes
GO:0003924 GTPase activity Yes
GO:0017111 nucleoside-triphosphatase activity No
GO:0005488 binding No
GO:0016787 hydrolase activity No
GO:0003674 molecular_function No
GO:0035639 purine ribonucleoside triphosphate binding No
GO:0000166 nucleotide binding No
GO:0043167 ion binding No
GO:0019001 guanyl nucleotide binding No
GO:0032553 ribonucleotide binding No
GO:0097367 carbohydrate derivative binding No
GO:0016817 hydrolase activity, acting on acid anhydrides No
GO:0043168 anion binding No
GO:0003824 catalytic activity No
GO:0017076 purine nucleotide binding No
GO:0097159 organic cyclic compound binding No
GO:1901265 nucleoside phosphate binding No
GO:0016818 hydrolase activity, acting on acid anhydrides, in phosphorus-containing anhydrides No
GO:0032555 purine ribonucleotide binding No
GO:1901363 heterocyclic compound binding No
GO:0036094 small molecule binding No
GO:0016462 pyrophosphatase activity No
GO:0032561 guanyl ribonucleotide binding No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 22 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >OphauB2|7264
MPLFKTAILTGKPLLQPRLLAASLSTTTSMSARSRARTIAPARMRKPRPNLHEEMRKARYLEDNFVHTPPLPEIE
PDLERIALAERLQRNEFGATIRGAAFAEPVRPPMVSEADGSPETYRELYASVARVYAKKIELGDAQGISFSRNDF
LDVHVDNARQAEESNALMRYFKRTQFLYSAPYFRLMRVNDEVPEFIILGASNCGKSSFINALVGHHKIAITSRKA
GATQYLNSYGLGAISKDLVPPPHGCPTVGVVSLKPKSRRRGPGANLSLMVGSASPTCRGLVLVDTPGYGFRSRFA
FGDAVMQYLGRRRSLRGAILLLSMQKDNPVSEQDEWVLRALALNGTPTLVVVTKIDKIGSEWPNKCAVYGQRLLN
DLDTINRQATLGKWRKSTHDETHAVCFTAARIKSLENRSCGIAHIRTLLMEMAGLHLVNGKVSNKQETIEYNGPV
VSHEEIAAAQTSHRSKTLAPKPSRAIQPDAYEQNMQKAGPWPHTGKILPTRIGSSSTGYQTLPEPVGPKLSHEMA
FKKEVHDVRAARRAFAWAKKPRPWRR*
Coding >OphauB2|7264
ATGCCACTCTTCAAGACGGCAATCCTCACCGGCAAGCCTCTCCTCCAGCCTCGTCTGCTAGCCGCCTCGCTCTCC
ACCACGACCTCTATGAGCGCCCGCAGCCGCGCCCGCACAATCGCCCCAGCACGCATGCGCAAGCCCCGCCCCAAC
CTACACGAAGAGATGCGCAAGGCGCGCTATCTAGAAGACAACTTTGTGCATACCCCGCCGCTGCCCGAAATTGAG
CCCGACTTGGAGCGCATTGCCCTGGCCGAGCGGCTGCAGCGCAACGAGTTTGGCGCCACGATTCGCGGCGCTGCG
TTTGCTGAGCCGGTGCGTCCGCCCATGGTGTCCGAGGCAGACGGCTCGCCAGAAACATACCGCGAGCTGTACGCC
TCGGTGGCAAGAGTCTACGCCAAGAAGATCGAGCTGGGCGACGCGCAGGGCATCTCGTTTAGCCGCAACGACTTT
CTTGACGTGCATGTCGACAATGCCAGACAGGCTGAAGAGTCCAACGCGCTGATGCGCTACTTTAAGCGCACCCAG
TTTCTCTACTCGGCGCCCTACTTTCGCCTCATGCGCGTCAATGACGAGGTTCCCGAATTCATCATTCTTGGCGCC
TCAAACTGCGGCAAGTCGAGCTTCATCAACGCCCTTGTCGGCCACCACAAAATCGCAATCACGAGCAGAAAGGCT
GGCGCGACGCAGTATTTAAACTCGTACGGCCTCGGCGCCATTAGCAAGGACCTTGTGCCCCCTCCGCACGGCTGT
CCCACCGTTGGCGTCGTCTCCCTCAAGCCCAAGTCTAGGCGCCGCGGCCCCGGCGCCAATCTCAGCTTGATGGTT
GGCAGCGCGTCGCCCACCTGCCGCGGCCTCGTCCTTGTCGACACGCCCGGCTACGGCTTCCGCAGCCGCTTCGCC
TTTGGCGATGCCGTGATGCAGTACCTCGGCCGCCGCCGCAGTCTGCGCGGCGCAATCCTCCTCCTCTCCATGCAA
AAGGATAACCCCGTGAGCGAGCAGGACGAATGGGTCTTGCGCGCCCTCGCCCTCAATGGCACGCCTACCCTTGTC
GTTGTCACAAAAATCGACAAGATTGGCTCCGAGTGGCCAAACAAGTGCGCCGTCTATGGCCAGCGACTCCTCAAC
GACTTGGACACGATTAACCGCCAAGCCACGCTTGGCAAGTGGCGCAAGTCGACCCACGACGAGACTCACGCCGTT
TGCTTCACCGCCGCCCGAATAAAGTCGCTCGAGAACCGCAGCTGCGGCATCGCCCACATTCGCACCCTCTTGATG
GAAATGGCTGGCCTGCACCTCGTCAATGGCAAGGTGTCCAACAAGCAGGAAACAATTGAATACAATGGCCCCGTC
GTCTCCCACGAAGAAATTGCAGCCGCCCAGACTAGCCACCGCTCCAAGACGCTTGCTCCTAAACCAAGCCGGGCA
ATCCAGCCAGACGCCTATGAGCAAAACATGCAAAAGGCAGGGCCCTGGCCTCATACAGGCAAAATACTGCCCACT
CGCATCGGCTCCTCGTCCACCGGCTACCAAACTCTGCCCGAGCCCGTGGGGCCCAAGCTTAGTCATGAAATGGCG
TTTAAAAAGGAGGTGCACGACGTTAGGGCTGCCAGACGTGCTTTTGCATGGGCCAAGAAGCCCCGTCCGTGGCGC
AGATAG
Transcript >OphauB2|7264
ATGCCACTCTTCAAGACGGCAATCCTCACCGGCAAGCCTCTCCTCCAGCCTCGTCTGCTAGCCGCCTCGCTCTCC
ACCACGACCTCTATGAGCGCCCGCAGCCGCGCCCGCACAATCGCCCCAGCACGCATGCGCAAGCCCCGCCCCAAC
CTACACGAAGAGATGCGCAAGGCGCGCTATCTAGAAGACAACTTTGTGCATACCCCGCCGCTGCCCGAAATTGAG
CCCGACTTGGAGCGCATTGCCCTGGCCGAGCGGCTGCAGCGCAACGAGTTTGGCGCCACGATTCGCGGCGCTGCG
TTTGCTGAGCCGGTGCGTCCGCCCATGGTGTCCGAGGCAGACGGCTCGCCAGAAACATACCGCGAGCTGTACGCC
TCGGTGGCAAGAGTCTACGCCAAGAAGATCGAGCTGGGCGACGCGCAGGGCATCTCGTTTAGCCGCAACGACTTT
CTTGACGTGCATGTCGACAATGCCAGACAGGCTGAAGAGTCCAACGCGCTGATGCGCTACTTTAAGCGCACCCAG
TTTCTCTACTCGGCGCCCTACTTTCGCCTCATGCGCGTCAATGACGAGGTTCCCGAATTCATCATTCTTGGCGCC
TCAAACTGCGGCAAGTCGAGCTTCATCAACGCCCTTGTCGGCCACCACAAAATCGCAATCACGAGCAGAAAGGCT
GGCGCGACGCAGTATTTAAACTCGTACGGCCTCGGCGCCATTAGCAAGGACCTTGTGCCCCCTCCGCACGGCTGT
CCCACCGTTGGCGTCGTCTCCCTCAAGCCCAAGTCTAGGCGCCGCGGCCCCGGCGCCAATCTCAGCTTGATGGTT
GGCAGCGCGTCGCCCACCTGCCGCGGCCTCGTCCTTGTCGACACGCCCGGCTACGGCTTCCGCAGCCGCTTCGCC
TTTGGCGATGCCGTGATGCAGTACCTCGGCCGCCGCCGCAGTCTGCGCGGCGCAATCCTCCTCCTCTCCATGCAA
AAGGATAACCCCGTGAGCGAGCAGGACGAATGGGTCTTGCGCGCCCTCGCCCTCAATGGCACGCCTACCCTTGTC
GTTGTCACAAAAATCGACAAGATTGGCTCCGAGTGGCCAAACAAGTGCGCCGTCTATGGCCAGCGACTCCTCAAC
GACTTGGACACGATTAACCGCCAAGCCACGCTTGGCAAGTGGCGCAAGTCGACCCACGACGAGACTCACGCCGTT
TGCTTCACCGCCGCCCGAATAAAGTCGCTCGAGAACCGCAGCTGCGGCATCGCCCACATTCGCACCCTCTTGATG
GAAATGGCTGGCCTGCACCTCGTCAATGGCAAGGTGTCCAACAAGCAGGAAACAATTGAATACAATGGCCCCGTC
GTCTCCCACGAAGAAATTGCAGCCGCCCAGACTAGCCACCGCTCCAAGACGCTTGCTCCTAAACCAAGCCGGGCA
ATCCAGCCAGACGCCTATGAGCAAAACATGCAAAAGGCAGGGCCCTGGCCTCATACAGGCAAAATACTGCCCACT
CGCATCGGCTCCTCGTCCACCGGCTACCAAACTCTGCCCGAGCCCGTGGGGCCCAAGCTTAGTCATGAAATGGCG
TTTAAAAAGGAGGTGCACGACGTTAGGGCTGCCAGACGTGCTTTTGCATGGGCCAAGAAGCCCCGTCCGTGGCGC
AGATAG
Gene >OphauB2|7264
ATGCCACTCTTCAAGACGGCAATCCTCACCGGCAAGCCTCTCCTCCAGCCTCGTCTGCTAGCCGCCTCGCTCTCC
ACCACGACCTCTATGAGCGCCCGCAGCCGCGCCCGCACAATCGCCCCAGCACGCATGCGCAAGCCCCGCCCCAAC
CTACACGAAGAGATGCGCAAGGCGCGCTATCTAGAAGACAACTTTGTGCATACCCCGCCGCTGCCCGAAATTGAG
CCCGACTTGGAGCGCATTGCCCTGGCCGAGCGGCTGCAGCGCAACGAGTTTGGCGCCACGATTCGCGGCGCTGCG
TTTGCTGAGCCGGTGCGTCCGCCCATGGTGTCCGAGGCAGACGGCTCGCCAGAAACATACCGCGAGCTGTACGCC
TCGGTGGCAAGAGTCTACGCCAAGAAGATCGAGCTGGGCGACGCGCAGGGCATCTCGTTTAGCCGCAACGACTTT
CTTGACGTGCATGTCGACAATGCCAGACAGGCTGAAGAGTCCAACGCGCTGATGCGCTACTTTAAGCGCACCCAG
TTTCTCTACTCGGCGCCCTACTTTCGCCTCATGCGCGTCAATGACGAGGTTCCCGAATTCATCATTCTTGGCGCC
TCAAACTGCGGCAAGTCGAGCTTCATCAACGCCCTTGTCGGCCACCACAAAATCGCAATCACGAGCAGAAAGGCT
GGCGCGACGCAGTATTTAAACTCGTACGGCCTCGGCGCCATTAGCAAGGACCTTGTGCCCCCTCCGCACGGCTGT
CCCACCGTTGGCGTCGTCTCCCTCAAGCCCAAGTCTAGGCGCCGCGGCCCCGGCGCCAATCTCAGCTTGATGGTT
GGCAGCGCGTCGCCCACCTGCCGCGGCCTCGTCCTTGTCGACACGCCCGGCTACGGCTTCCGCAGCCGCTTCGCC
TTTGGCGATGCCGTGATGCAGTACCTCGGCCGCCGCCGCAGTCTGCGCGGCGCAATCCTCCTCCTCTCCATGCAA
AAGGATAACCCCGTGAGCGAGCAGGACGAATGGGTCTTGCGCGCCCTCGCCCTCAATGGCACGCCTACCCTTGTC
GTTGTCACAAAAATCGACAAGATTGGCTCCGAGTGGCCAAACAAGTGCGCCGTCTATGGCCAGCGACTCCTCAAC
GACTTGGACACGATTAACCGCCAAGCCACGCTTGGCAAGTGGCGCAAGTCGACCCACGACGAGACTCACGCCGTT
TGCTTCACCGCCGCCCGAATAAAGTCGCTCGAGAACCGCAGCTGCGGCATCGCCCACATTCGCACCCTCTTGATG
GAAATGGCTGGCCTGCACCTCGTCAATGGCAAGGTGTCCAACAAGCAGGAAACAATTGAATACAATGGCCCCGTC
GTCTCCCACGAAGAAATTGCAGCCGCCCAGACTAGCCACCGCTCCAAGACGCTTGCTCCTAAACCAAGCCGGGCA
ATCCAGCCAGACGCCTATGAGCAAAACATGCAAAAGGCAGGGCCCTGGCCTCATACAGGCAAAATACTGCCCACT
CGCATCGGCTCCTCGTCCACCGGCTACCAAACTCTGCCCGAGCCCGTGGGGCCCAAGCTTAGTCATGAAATGGCG
TTTAAAAAGGAGGTGCACGACGTTAGGGCTGCCAGACGTGCTTTTGCATGGGCCAAGAAGCCCCGTCCGTGGCGC
AGATAG

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail