Fungal Genomics

at Utrecht University

General Properties

Protein IDOphauB2|725
Gene name
LocationContig_114:32524..34695
Strand+
Gene length (bp)2171
Transcript length (bp)1641
Coding sequence length (bp)1641
Protein length (aa) 547

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00884 Sulfatase Sulfatase 7.6E-53 18 362

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q10723|ARS_VOLCA Arylsulfatase OS=Volvox carteri PE=1 SV=1 16 511 1.0E-94
sp|P14217|ARS_CHLRE Arylsulfatase OS=Chlamydomonas reinhardtii GN=AS PE=1 SV=2 16 512 5.0E-83
sp|Q8BFR4|GNS_MOUSE N-acetylglucosamine-6-sulfatase OS=Mus musculus GN=Gns PE=1 SV=1 12 486 1.0E-51
sp|Q1LZH9|GNS_BOVIN N-acetylglucosamine-6-sulfatase OS=Bos taurus GN=GNS PE=2 SV=1 6 486 3.0E-51
sp|Q21376|SULF1_CAEEL Putative extracellular sulfatase Sulf-1 homolog OS=Caenorhabditis elegans GN=sul-1 PE=3 SV=1 2 373 3.0E-50
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q10723|ARS_VOLCA Arylsulfatase OS=Volvox carteri PE=1 SV=1 16 511 1.0E-94
sp|P14217|ARS_CHLRE Arylsulfatase OS=Chlamydomonas reinhardtii GN=AS PE=1 SV=2 16 512 5.0E-83
sp|Q8BFR4|GNS_MOUSE N-acetylglucosamine-6-sulfatase OS=Mus musculus GN=Gns PE=1 SV=1 12 486 1.0E-51
sp|Q1LZH9|GNS_BOVIN N-acetylglucosamine-6-sulfatase OS=Bos taurus GN=GNS PE=2 SV=1 6 486 3.0E-51
sp|Q21376|SULF1_CAEEL Putative extracellular sulfatase Sulf-1 homolog OS=Caenorhabditis elegans GN=sul-1 PE=3 SV=1 2 373 3.0E-50
sp|P50426|GNS_CAPHI N-acetylglucosamine-6-sulfatase OS=Capra hircus GN=GNS PE=2 SV=1 12 486 7.0E-49
sp|P15586|GNS_HUMAN N-acetylglucosamine-6-sulfatase OS=Homo sapiens GN=GNS PE=1 SV=3 11 486 6.0E-48
sp|Q9VEX0|SULF1_DROME Extracellular sulfatase SULF-1 homolog OS=Drosophila melanogaster GN=Sulf1 PE=1 SV=1 12 373 8.0E-48
sp|Q8K007|SULF1_MOUSE Extracellular sulfatase Sulf-1 OS=Mus musculus GN=Sulf1 PE=2 SV=1 17 414 1.0E-43
sp|Q8VI60|SULF1_RAT Extracellular sulfatase Sulf-1 OS=Rattus norvegicus GN=Sulf1 PE=1 SV=1 17 414 2.0E-43
sp|Q8IWU6|SULF1_HUMAN Extracellular sulfatase Sulf-1 OS=Homo sapiens GN=SULF1 PE=1 SV=1 3 373 3.0E-43
sp|Q90XB6|SULF1_COTCO Extracellular sulfatase Sulf-1 OS=Coturnix coturnix GN=SULF1 PE=1 SV=1 17 417 1.0E-42
sp|Q8IWU5|SULF2_HUMAN Extracellular sulfatase Sulf-2 OS=Homo sapiens GN=SULF2 PE=1 SV=1 17 373 7.0E-42
sp|Q8CFG0|SULF2_MOUSE Extracellular sulfatase Sulf-2 OS=Mus musculus GN=Sulf2 PE=2 SV=2 17 373 1.0E-41
sp|P31447|YIDJ_ECOLI Uncharacterized sulfatase YidJ OS=Escherichia coli (strain K12) GN=yidJ PE=3 SV=1 16 453 8.0E-18
sp|Q6UWY0|ARSK_HUMAN Arylsulfatase K OS=Homo sapiens GN=ARSK PE=1 SV=1 14 384 4.0E-11
sp|O69787|BETC_RHIME Choline-sulfatase OS=Rhizobium meliloti (strain 1021) GN=betC PE=1 SV=2 17 452 9.0E-11
sp|P22304|IDS_HUMAN Iduronate 2-sulfatase OS=Homo sapiens GN=IDS PE=1 SV=1 19 336 5.0E-10
sp|Q9C0V7|YHJ2_SCHPO Uncharacterized sulfatase PB10D8.02c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPBPB10D8.02c PE=3 SV=1 13 306 9.0E-10
sp|Q08890|IDS_MOUSE Iduronate 2-sulfatase OS=Mus musculus GN=Ids PE=2 SV=3 19 452 9.0E-10
sp|P51691|ARS_PSEAE Arylsulfatase OS=Pseudomonas aeruginosa (strain ATCC 15692 / PAO1 / 1C / PRS 101 / LMG 12228) GN=atsA PE=1 SV=3 15 306 4.0E-09
sp|P50430|ARSB_RAT Arylsulfatase B OS=Rattus norvegicus GN=Arsb PE=2 SV=2 9 361 8.0E-07
[Show less]

GO

GO Term Description Terminal node
GO:0008484 sulfuric ester hydrolase activity Yes
GO:0003824 catalytic activity No
GO:0016788 hydrolase activity, acting on ester bonds No
GO:0003674 molecular_function No
GO:0016787 hydrolase activity No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
Yes 1 - 17 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >OphauB2|725
MLPLILGLATLAAAASRPNFIFIMADDQDMHLGSLDYQPAVLKHFRDAGSWFVKHFCTVSICCPSRVSLLTGRAA
HNTNVTDVELPYGGYHKFVAEGLNDKYLPIWLQEAGYATYYTGKLLNGVSATAPEKPRGWTRSAFLVEPGLYNYF
NACMAIDHGPLQLYTGLYSTDVIANHTIDFLHDAMEADKPFFLGVAPTAPHGERVVDKTPIMFEAPVPAQRHEHL
FPDAKVARTPDFNQAADGSVSYFAVIPPLTDAQITYSDTFYQRRLQALQALDELVDSVVTKLYTRPDLASNTYLI
YTSDNGYHIGQHRLPPGKTSNIDSDLNVPFFVRGPGIPSAKIITTPTSHTDIVPSIFKFAGIPLRDEFDGEPMPW
TGEGNRQEHVNVEFWGKRFTEGTVFDMEDDEALRNTYKTLRIVGSDYDFSYTVWCTNEHELYDIKLDPWQMNNIY
TNITATSGFSIPLLITRLDTLLLTLKGCTRNVCRRPWEALFPGGGVASLRDAMDPKYDAFFDQGQSRVGFSECLD
GYETRAEGALFPVAFGVNCSV*
Coding >OphauB2|725
ATGCTGCCTCTCATCCTTGGGCTGGCCACGCTGGCTGCTGCCGCCTCGCGCCCCAACTTCATCTTCATCATGGCC
GACGACCAAGACATGCACCTCGGCTCGCTCGACTACCAGCCCGCCGTGCTCAAACACTTTCGCGACGCGGGAAGC
TGGTTCGTCAAGCACTTTTGCACCGTGTCTATTTGTTGCCCGTCCAGAGTCTCCCTCTTGACGGGCAGGGCGGCG
CATAATACCAATGTGACTGATGTCGAGCTCCCCTATGGCGGCTACCACAAGTTTGTCGCCGAGGGTCTCAACGAC
AAATATCTGCCCATATGGCTGCAAGAAGCAGGATACGCCACGTACTATACGGGCAAGTTATTAAACGGCGTGTCC
GCCACGGCTCCCGAAAAGCCCCGTGGTTGGACACGCTCAGCTTTCTTGGTTGAGCCGGGCCTATACAATTACTTC
AATGCTTGCATGGCCATTGACCATGGACCACTGCAGCTCTATACAGGCCTGTACTCGACAGACGTTATTGCCAAC
CACACCATAGATTTCTTGCACGATGCCATGGAGGCTGACAAGCCCTTTTTTCTCGGTGTTGCGCCCACGGCGCCT
CATGGCGAGCGCGTCGTCGACAAGACGCCCATTATGTTTGAGGCGCCTGTTCCCGCGCAGCGCCATGAGCATCTT
TTCCCAGACGCCAAAGTCGCTCGAACGCCAGACTTTAACCAAGCCGCAGATGGCTCTGTTAGCTACTTTGCCGTC
ATTCCCCCTCTGACCGACGCCCAAATCACATACAGCGACACCTTTTACCAGCGCCGCCTGCAAGCCCTACAAGCC
CTCGACGAGCTGGTCGACTCGGTTGTAACTAAACTCTACACTCGGCCCGACCTGGCATCCAACACTTATCTCATC
TACACAAGCGACAATGGCTACCACATTGGCCAACACCGGCTCCCCCCCGGCAAGACGAGCAATATAGACTCGGAT
CTCAACGTACCCTTTTTCGTCCGCGGGCCAGGTATCCCCTCGGCCAAGATTATCACGACACCAACCTCGCACACG
GATATTGTGCCGAGTATATTCAAGTTTGCGGGAATTCCGCTGCGCGATGAGTTTGACGGCGAGCCGATGCCGTGG
ACAGGCGAAGGGAATAGGCAGGAGCATGTGAATGTCGAGTTTTGGGGCAAGAGGTTTACCGAGGGCACCGTGTTT
GACATGGAGGATGATGAGGCGCTGAGGAATACCTACAAGACGCTGCGTATCGTGGGCTCCGACTATGACTTTTCG
TATACCGTCTGGTGCACCAACGAGCACGAGCTCTACGATATAAAGCTCGACCCCTGGCAAATGAACAATATTTAC
ACCAACATCACCGCGACTTCGGGCTTTAGCATTCCTCTTTTAATCACACGCCTCGACACCCTCCTCCTCACGCTC
AAAGGATGCACCCGAAACGTCTGCCGCCGACCATGGGAAGCCTTGTTCCCGGGCGGAGGCGTCGCCAGCCTGCGC
GACGCCATGGATCCCAAATACGACGCCTTTTTCGACCAGGGGCAGAGTAGAGTTGGCTTTTCAGAGTGTCTGGAT
GGCTATGAGACGCGAGCTGAGGGCGCATTGTTTCCCGTGGCGTTTGGGGTCAATTGTTCCGTGTGA
Transcript >OphauB2|725
ATGCTGCCTCTCATCCTTGGGCTGGCCACGCTGGCTGCTGCCGCCTCGCGCCCCAACTTCATCTTCATCATGGCC
GACGACCAAGACATGCACCTCGGCTCGCTCGACTACCAGCCCGCCGTGCTCAAACACTTTCGCGACGCGGGAAGC
TGGTTCGTCAAGCACTTTTGCACCGTGTCTATTTGTTGCCCGTCCAGAGTCTCCCTCTTGACGGGCAGGGCGGCG
CATAATACCAATGTGACTGATGTCGAGCTCCCCTATGGCGGCTACCACAAGTTTGTCGCCGAGGGTCTCAACGAC
AAATATCTGCCCATATGGCTGCAAGAAGCAGGATACGCCACGTACTATACGGGCAAGTTATTAAACGGCGTGTCC
GCCACGGCTCCCGAAAAGCCCCGTGGTTGGACACGCTCAGCTTTCTTGGTTGAGCCGGGCCTATACAATTACTTC
AATGCTTGCATGGCCATTGACCATGGACCACTGCAGCTCTATACAGGCCTGTACTCGACAGACGTTATTGCCAAC
CACACCATAGATTTCTTGCACGATGCCATGGAGGCTGACAAGCCCTTTTTTCTCGGTGTTGCGCCCACGGCGCCT
CATGGCGAGCGCGTCGTCGACAAGACGCCCATTATGTTTGAGGCGCCTGTTCCCGCGCAGCGCCATGAGCATCTT
TTCCCAGACGCCAAAGTCGCTCGAACGCCAGACTTTAACCAAGCCGCAGATGGCTCTGTTAGCTACTTTGCCGTC
ATTCCCCCTCTGACCGACGCCCAAATCACATACAGCGACACCTTTTACCAGCGCCGCCTGCAAGCCCTACAAGCC
CTCGACGAGCTGGTCGACTCGGTTGTAACTAAACTCTACACTCGGCCCGACCTGGCATCCAACACTTATCTCATC
TACACAAGCGACAATGGCTACCACATTGGCCAACACCGGCTCCCCCCCGGCAAGACGAGCAATATAGACTCGGAT
CTCAACGTACCCTTTTTCGTCCGCGGGCCAGGTATCCCCTCGGCCAAGATTATCACGACACCAACCTCGCACACG
GATATTGTGCCGAGTATATTCAAGTTTGCGGGAATTCCGCTGCGCGATGAGTTTGACGGCGAGCCGATGCCGTGG
ACAGGCGAAGGGAATAGGCAGGAGCATGTGAATGTCGAGTTTTGGGGCAAGAGGTTTACCGAGGGCACCGTGTTT
GACATGGAGGATGATGAGGCGCTGAGGAATACCTACAAGACGCTGCGTATCGTGGGCTCCGACTATGACTTTTCG
TATACCGTCTGGTGCACCAACGAGCACGAGCTCTACGATATAAAGCTCGACCCCTGGCAAATGAACAATATTTAC
ACCAACATCACCGCGACTTCGGGCTTTAGCATTCCTCTTTTAATCACACGCCTCGACACCCTCCTCCTCACGCTC
AAAGGATGCACCCGAAACGTCTGCCGCCGACCATGGGAAGCCTTGTTCCCGGGCGGAGGCGTCGCCAGCCTGCGC
GACGCCATGGATCCCAAATACGACGCCTTTTTCGACCAGGGGCAGAGTAGAGTTGGCTTTTCAGAGTGTCTGGAT
GGCTATGAGACGCGAGCTGAGGGCGCATTGTTTCCCGTGGCGTTTGGGGTCAATTGTTCCGTGTGA
Gene >OphauB2|725
ATGCTGCCTCTCATCCTTGGGCTGGCCACGCTGGCTGCTGCCGCCTCGCGCCCCAACTTCATCTTCATCATGGCC
GACGACCAAGACATGCACCTCGGCTCGCTCGACTACCAGCCCGCCGTGCTCAAACACTTTCGCGACGCGGGAAGC
TGGTTCGTCAAGCACTTTTGCACCGTGTCTATTTGTTGCCCGTCCAGAGTCTCCCTCTTGACGGGCAGGGCGGCG
CATAATACCAATGTGACTGATGTCGAGCTCGTGAGCCATTTCCTCTTGTTGTGCAACTTGATATAAATATTACTT
TTCTCATAAAGATTACACTCATCCACTGTCCATGCTTACCAACACCTTTATAAATGTCTTTATCAACACTAGTTC
TTGTCACACAAATTCTCATGTGCTTGGCACTGCAAAATCATAAAAAGTCTTTTTACAATGTATACTAACAATGAA
TAGCCCTATGGTTCGTTTCCACAAGATGCTTGAGGCCATCTATCAAGCTAACAACCCCAGGCGGCTACCACAAGT
TTGTCGCCGAGGGTCTCAACGACAAATATCTGCCCATATGGCTGCAAGAAGCAGGATACGCCACGTACTATACGG
GCAAGTTATTAAACGGCGTGTCCGCCACGGCTCCCGAAAAGCCCCGTGGTTGGACACGCTCAGCTTGTGAGCCCT
TGGTCCTTACCCTCCATAGCCCTTGTGTCCCTCTATCCTTACTCTCTACCCACCGTTGCATTTCCACATCTTGAA
TCTCTCAGCCATGAAAACTAACTCCCCTTGTAGTCTTGGTTGAGCCGGGCCTATACAATTACTTCAATGCTTGCA
TGGCCATTGACCATGGACCACTGCAGCTCTATACAGGCCTGTACTCGACAGACGTTATTGCCAACCACACCATAG
ATTTCTTGCACGATGCCATGGAGGCTGACAAGCCCTTTTTTCTCGGTGTTGCGCCCACGGCGCCTCATGGCGAGC
GCGTCGTCGACAAGACGCCCATTATGTTTGAGGCGCCTGTTCCCGCGCAGCGCCATGAGCATCTTTTCCCAGACG
CCAAAGTCGCTCGAACGCCAGACTTTAACCAAGCCGCAGTACGTACACAGCGCCAAGAGTCTACAGAAACTAATT
TTTTTTTTTGCAGGATGGCTCTGTTAGCTACTTTGCCGTCATTCCCCCTCTGACCGACGCCCAAATCACATACAG
CGACACCTTTTACCAGCGCCGCCTGCAAGCCCTACAAGCCCTCGACGAGCTGGTCGACTCGGTTGTAACTAAACT
CTACACTCGGCCCGACCTGGCATCCAACACTTATCTCATCTACACAAGCGACAATGGCTACCACATTGGCCAACA
CCGGCTCCCCCCCGGCAAGACGAGCAATATAGACTCGGATCTCAACGTACCCTTTTTCGTCCGCGGGCCAGGTAT
CCCCTCGGCCAAGATTATCACGACACCAACCTCGCACACGGATATTGTGCCGAGTATATTCAAGTTTGCGGGAAT
TCCGCTGCGCGATGAGTTTGACGGCGAGCCGATGCCGTGGACAGGCGAAGGGAATAGGCAGGAGCATGTGAATGT
CGAGTTTTGGGGCAAGAGGTTTACCGAGGGCACCGTGTTTGACATGGAGGGTGAGTTGGGCGGCAAAATTGCTTG
ACGAGGGCGCTGTTGATGAAGGAGTAGATGATGAGGCGCTGAGGAATACCTACAAGACGCTGCGTATCGTGGGCT
CCGACTATGACTTTTCGTATACCGTCTGGTGCACCAACGAGCACGAGCTCTACGATATAAAGGTATTTTCTTCTT
GCACCTCCTCCTGCCTCCCACGCCGAATATCAGCTAACCCAGTCTGCCAGCTCGACCCCTGGCAAATGAACAATA
TTTACACCAACATCACCGCGACTTCGGGCTTTAGCATTCCTCTTTTAATCACACGCCTCGACACCCTCCTCCTCA
CGCTCAAAGGATGCACCCGAAACGTCTGCCGCCGACCATGGGAAGCCTTGTTCCCGGGCGGAGGCGTCGCCAGCC
TGCGCGACGCCATGGATCCCAAATACGACGCCTTTTTCGACCAGGGGCAGAGTAGAGTTGGCTTTTCAGAGTGTC
TGGATGGCTATGAGACGCGAGCTGAGGGCGCATTGTTTCCCGTGGCGTTTGGGGTCAATTGTTCCGTGTGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail