Fungal Genomics

at Utrecht University

General Properties

Protein IDOphauB2|7247
Gene name
LocationContig_75:45539..48888
Strand-
Gene length (bp)3349
Transcript length (bp)3285
Coding sequence length (bp)3285
Protein length (aa) 1095

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF09416 UPF1_Zn_bind RNA helicase (UPF2 interacting domain) 3.8E-69 93 243
PF13087 AAA_12 AAA domain 3.8E-57 657 853
PF13086 AAA_11 AAA domain 5.2E-22 448 543
PF13086 AAA_11 AAA domain 1.7E-30 549 650
PF18141 UPF1_1B_dom RNA helicase UPF1, 1B domain 1.5E-31 297 391
PF13604 AAA_30 AAA domain 3.4E-11 448 646
PF13245 AAA_19 AAA domain 1.0E-10 452 644
PF04851 ResIII Type III restriction enzyme, res subunit 2.0E-06 448 516
PF05127 Helicase_RecD Helicase 4.2E-05 467 556

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q9EPU0|RENT1_MOUSE Regulator of nonsense transcripts 1 OS=Mus musculus GN=Upf1 PE=1 SV=2 93 894 0.0E+00
sp|Q92900|RENT1_HUMAN Regulator of nonsense transcripts 1 OS=Homo sapiens GN=UPF1 PE=1 SV=2 93 894 0.0E+00
sp|Q9FJR0|RENT1_ARATH Regulator of nonsense transcripts 1 homolog OS=Arabidopsis thaliana GN=UPF1 PE=1 SV=2 84 903 0.0E+00
sp|Q09820|RENT1_SCHPO ATP-dependent helicase upf1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=upf1 PE=3 SV=2 95 909 0.0E+00
sp|Q98TR3|RENT1_TAKRU Putative regulator of nonsense transcripts 1 OS=Takifugu rubripes GN=rent1 PE=3 SV=1 93 894 0.0E+00
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q9EPU0|RENT1_MOUSE Regulator of nonsense transcripts 1 OS=Mus musculus GN=Upf1 PE=1 SV=2 93 894 0.0E+00
sp|Q92900|RENT1_HUMAN Regulator of nonsense transcripts 1 OS=Homo sapiens GN=UPF1 PE=1 SV=2 93 894 0.0E+00
sp|Q9FJR0|RENT1_ARATH Regulator of nonsense transcripts 1 homolog OS=Arabidopsis thaliana GN=UPF1 PE=1 SV=2 84 903 0.0E+00
sp|Q09820|RENT1_SCHPO ATP-dependent helicase upf1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=upf1 PE=3 SV=2 95 909 0.0E+00
sp|Q98TR3|RENT1_TAKRU Putative regulator of nonsense transcripts 1 OS=Takifugu rubripes GN=rent1 PE=3 SV=1 93 894 0.0E+00
sp|Q9VYS3|RENT1_DROME Regulator of nonsense transcripts 1 homolog OS=Drosophila melanogaster GN=Upf1 PE=1 SV=2 87 902 0.0E+00
sp|P30771|NAM7_YEAST ATP-dependent helicase NAM7 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=NAM7 PE=1 SV=1 51 939 0.0E+00
sp|O76512|RENT1_CAEEL Regulator of nonsense transcripts 1 OS=Caenorhabditis elegans GN=smg-2 PE=1 SV=1 81 901 0.0E+00
sp|Q54I89|RENT1_DICDI Regulator of nonsense transcripts 1 OS=Dictyostelium discoideum GN=upf1 PE=3 SV=1 80 928 0.0E+00
sp|Q9HEH1|RENT1_NEUCR Regulator of nonsense transcripts 1 homolog OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=2E4.130 PE=3 SV=1 1 1094 0.0E+00
sp|O94247|HCS1_SCHPO DNA polymerase alpha-associated DNA helicase A OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=hcs1 PE=3 SV=1 395 876 9.0E-61
sp|P32644|ECM32_YEAST Putative ATP-dependent RNA helicase ECM32 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=ECM32 PE=1 SV=1 448 875 1.0E-58
sp|Q00416|SEN1_YEAST Helicase SEN1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=SEN1 PE=1 SV=2 383 911 2.0E-57
sp|Q92355|SEN1_SCHPO Helicase sen1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=sen1 PE=1 SV=1 404 901 3.0E-57
sp|O94387|YGSA_SCHPO Uncharacterized ATP-dependent helicase C29A10.10c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPBC29A10.10c PE=3 SV=1 386 872 7.0E-56
sp|P34243|HCS1_YEAST DNA polymerase alpha-associated DNA helicase A OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=HCS1 PE=1 SV=1 384 858 8.0E-56
sp|Q57568|Y104_METJA Uncharacterized ATP-dependent helicase MJ0104 OS=Methanocaldococcus jannaschii (strain ATCC 43067 / DSM 2661 / JAL-1 / JCM 10045 / NBRC 100440) GN=MJ0104 PE=3 SV=1 395 867 1.0E-52
sp|Q60560|SMBP2_MESAU DNA-binding protein SMUBP-2 OS=Mesocricetus auratus GN=IGHMBP2 PE=1 SV=1 370 871 5.0E-52
sp|Q8GYD9|SDE3_ARATH Probable RNA helicase SDE3 OS=Arabidopsis thaliana GN=SDE3 PE=1 SV=1 396 873 3.0E-51
sp|Q86AS0|Y4399_DICDI Probable helicase DDB_G0274399 OS=Dictyostelium discoideum GN=DDB_G0274399 PE=3 SV=1 490 884 4.0E-51
sp|Q0VGT4|ZGRF1_MOUSE Protein ZGRF1 OS=Mus musculus GN=Zgrf1 PE=1 SV=2 463 872 4.0E-50
sp|Q9BYK8|HELZ2_HUMAN Helicase with zinc finger domain 2 OS=Homo sapiens GN=HELZ2 PE=1 SV=6 448 886 4.0E-50
sp|P40694|SMBP2_MOUSE DNA-binding protein SMUBP-2 OS=Mus musculus GN=Ighmbp2 PE=1 SV=1 370 871 5.0E-50
sp|Q9EQN5|SMBP2_RAT DNA-binding protein SMUBP-2 OS=Rattus norvegicus GN=Ighmbp2 PE=1 SV=1 448 871 7.0E-50
sp|A2AKX3|SETX_MOUSE Probable helicase senataxin OS=Mus musculus GN=Setx PE=1 SV=1 445 877 9.0E-49
sp|Q86YA3|ZGRF1_HUMAN Protein ZGRF1 OS=Homo sapiens GN=ZGRF1 PE=2 SV=3 463 872 2.0E-48
sp|B6SFA4|MAA3_ARATH Probable helicase MAGATAMA 3 OS=Arabidopsis thaliana GN=MAA3 PE=2 SV=1 493 883 8.0E-48
sp|P38935|SMBP2_HUMAN DNA-binding protein SMUBP-2 OS=Homo sapiens GN=IGHMBP2 PE=1 SV=3 370 869 3.0E-47
sp|E9QAM5|HELZ2_MOUSE Helicase with zinc finger domain 2 OS=Mus musculus GN=Helz2 PE=1 SV=1 448 884 8.0E-47
sp|E1BMP7|DNA2_BOVIN DNA replication ATP-dependent helicase/nuclease DNA2 OS=Bos taurus GN=DNA2 PE=3 SV=3 445 879 2.0E-46
sp|D3ZG52|DNA2_RAT DNA replication ATP-dependent helicase/nuclease DNA2 OS=Rattus norvegicus GN=Dna2 PE=3 SV=1 421 868 2.0E-44
sp|Q9BXT6|M10L1_HUMAN Putative helicase Mov10l1 OS=Homo sapiens GN=MOV10L1 PE=2 SV=1 446 886 7.0E-44
sp|Q99MV5|M10L1_MOUSE Putative helicase Mov10l1 OS=Mus musculus GN=Mov10l1 PE=1 SV=1 446 868 1.0E-42
sp|P23249|MOV10_MOUSE Putative helicase MOV-10 OS=Mus musculus GN=Mov10 PE=1 SV=2 449 871 2.0E-42
sp|Q6ZQJ5|DNA2_MOUSE DNA replication ATP-dependent helicase/nuclease DNA2 OS=Mus musculus GN=Dna2 PE=1 SV=2 419 879 2.0E-42
sp|P51530|DNA2_HUMAN DNA replication ATP-dependent helicase/nuclease DNA2 OS=Homo sapiens GN=DNA2 PE=1 SV=3 445 879 3.0E-42
sp|Q8QHA5|DNA2_XENLA DNA replication ATP-dependent helicase/nuclease DNA2 OS=Xenopus laevis GN=dna2 PE=1 SV=1 438 879 6.0E-42
sp|Q9HCE1|MOV10_HUMAN Putative helicase MOV-10 OS=Homo sapiens GN=MOV10 PE=1 SV=2 449 871 6.0E-42
sp|Q0V8H6|MOV10_BOVIN Putative helicase MOV-10 OS=Bos taurus GN=MOV10 PE=2 SV=1 449 871 1.0E-41
sp|Q5ZKG3|DNA2_CHICK DNA replication ATP-dependent helicase/nuclease DNA2 OS=Gallus gallus GN=DNA2 PE=2 SV=2 436 879 6.0E-41
sp|Q7Z333|SETX_HUMAN Probable helicase senataxin OS=Homo sapiens GN=SETX PE=1 SV=4 541 877 9.0E-40
sp|Q1LXK4|M10B1_DANRE Putative helicase mov-10-B.1 OS=Danio rerio GN=mov10b.1 PE=2 SV=2 449 862 7.0E-39
sp|Q5ZKD7|MOV10_CHICK Putative helicase MOV-10 OS=Gallus gallus GN=MOV10 PE=2 SV=1 447 871 2.0E-38
sp|Q1LXK5|M10B2_DANRE Putative helicase mov-10-B.2 OS=Danio rerio GN=mov10b.2 PE=3 SV=1 451 862 7.0E-38
sp|Q6J5K9|ARMI_DROME Probable RNA helicase armi OS=Drosophila melanogaster GN=armi PE=1 SV=4 459 866 6.0E-33
sp|Q9URU2|DNA2_SCHPO DNA replication ATP-dependent helicase/nuclease dna2 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=dna2 PE=1 SV=2 410 867 1.0E-30
sp|Q9P2E3|ZNFX1_HUMAN NFX1-type zinc finger-containing protein 1 OS=Homo sapiens GN=ZNFX1 PE=2 SV=2 570 883 1.0E-29
sp|Q8R151|ZNFX1_MOUSE NFX1-type zinc finger-containing protein 1 OS=Mus musculus GN=Znfx1 PE=1 SV=3 570 873 4.0E-29
sp|P38859|DNA2_YEAST DNA replication ATP-dependent helicase/nuclease DNA2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=DNA2 PE=1 SV=1 448 851 5.0E-29
sp|O74465|HRR1_SCHPO Helicase required for RNAi-mediated heterochromatin assembly 1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=hrr1 PE=1 SV=2 567 864 2.0E-25
sp|F6QXW0|DNA2_XENTR DNA replication ATP-dependent helicase/nuclease DNA2 OS=Xenopus tropicalis GN=dna2 PE=3 SV=1 445 879 3.0E-25
sp|P42694|HELZ_HUMAN Probable helicase with zinc finger domain OS=Homo sapiens GN=HELZ PE=1 SV=2 398 856 1.0E-24
sp|Q09449|YQ12_CAEEL Uncharacterized ATP-dependent helicase C05C10.2 OS=Caenorhabditis elegans GN=C05C10.2 PE=3 SV=1 437 878 5.0E-24
sp|Q6DFV5|HELZ_MOUSE Probable helicase with zinc finger domain OS=Mus musculus GN=Helz PE=1 SV=2 398 856 3.0E-23
sp|Q8CFQ3|AQR_MOUSE Intron-binding protein aquarius OS=Mus musculus GN=Aqr PE=1 SV=2 578 851 2.0E-21
sp|O60306|AQR_HUMAN Intron-binding protein aquarius OS=Homo sapiens GN=AQR PE=1 SV=4 578 851 2.0E-21
sp|Q6NYU2|HELZ_DANRE Probable helicase with zinc finger domain OS=Danio rerio GN=helz PE=2 SV=1 607 856 2.0E-19
sp|E9QAM5|HELZ2_MOUSE Helicase with zinc finger domain 2 OS=Mus musculus GN=Helz2 PE=1 SV=1 463 867 2.0E-19
sp|Q9BYK8|HELZ2_HUMAN Helicase with zinc finger domain 2 OS=Homo sapiens GN=HELZ2 PE=1 SV=6 437 873 2.0E-17
sp|Q9P2E3|ZNFX1_HUMAN NFX1-type zinc finger-containing protein 1 OS=Homo sapiens GN=ZNFX1 PE=2 SV=2 383 564 9.0E-08
sp|O74465|HRR1_SCHPO Helicase required for RNAi-mediated heterochromatin assembly 1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=hrr1 PE=1 SV=2 448 536 2.0E-07
sp|Q6NYU2|HELZ_DANRE Probable helicase with zinc finger domain OS=Danio rerio GN=helz PE=2 SV=1 398 505 6.0E-06
[Show less]

GO

GO Term Description Terminal node
GO:0003724 RNA helicase activity Yes
GO:0004386 helicase activity Yes
GO:0003677 DNA binding Yes
GO:0005737 cytoplasm Yes
GO:0008270 zinc ion binding Yes
GO:0000184 nuclear-transcribed mRNA catabolic process, nonsense-mediated decay Yes
GO:0003723 RNA binding Yes
GO:0016787 hydrolase activity Yes
GO:0005524 ATP binding Yes
GO:0046700 heterocycle catabolic process No
GO:0035639 purine ribonucleoside triphosphate binding No
GO:0043167 ion binding No
GO:0140640 catalytic activity, acting on a nucleic acid No
GO:0008186 ATP-dependent activity, acting on RNA No
GO:0010629 negative regulation of gene expression No
GO:0060255 regulation of macromolecule metabolic process No
GO:0034655 nucleobase-containing compound catabolic process No
GO:0032553 ribonucleotide binding No
GO:0050789 regulation of biological process No
GO:0000956 nuclear-transcribed mRNA catabolic process No
GO:0110165 cellular anatomical entity No
GO:0006807 nitrogen compound metabolic process No
GO:0097367 carbohydrate derivative binding No
GO:0000166 nucleotide binding No
GO:0034641 cellular nitrogen compound metabolic process No
GO:1901361 organic cyclic compound catabolic process No
GO:1901360 organic cyclic compound metabolic process No
GO:0006401 RNA catabolic process No
GO:0003674 molecular_function No
GO:0044265 cellular macromolecule catabolic process No
GO:0005488 binding No
GO:0008150 biological_process No
GO:0006725 cellular aromatic compound metabolic process No
GO:0010468 regulation of gene expression No
GO:0005575 cellular_component No
GO:0043170 macromolecule metabolic process No
GO:0140098 catalytic activity, acting on RNA No
GO:0046914 transition metal ion binding No
GO:1901575 organic substance catabolic process No
GO:0009057 macromolecule catabolic process No
GO:0008152 metabolic process No
GO:0019222 regulation of metabolic process No
GO:0009987 cellular process No
GO:0010605 negative regulation of macromolecule metabolic process No
GO:0044238 primary metabolic process No
GO:0140657 ATP-dependent activity No
GO:0003676 nucleic acid binding No
GO:0019439 aromatic compound catabolic process No
GO:0036094 small molecule binding No
GO:0030554 adenyl nucleotide binding No
GO:0046483 heterocycle metabolic process No
GO:0043168 anion binding No
GO:0016071 mRNA metabolic process No
GO:0016070 RNA metabolic process No
GO:0009892 negative regulation of metabolic process No
GO:0048519 negative regulation of biological process No
GO:0006139 nucleobase-containing compound metabolic process No
GO:0097159 organic cyclic compound binding No
GO:0009056 catabolic process No
GO:0065007 biological regulation No
GO:0043169 cation binding No
GO:0046872 metal ion binding No
GO:0003824 catalytic activity No
GO:0017076 purine nucleotide binding No
GO:0090304 nucleic acid metabolic process No
GO:0044248 cellular catabolic process No
GO:0044270 cellular nitrogen compound catabolic process No
GO:1901265 nucleoside phosphate binding No
GO:0006402 mRNA catabolic process No
GO:0032555 purine ribonucleotide binding No
GO:1901363 heterocyclic compound binding No
GO:0044260 cellular macromolecule metabolic process No
GO:0071704 organic substance metabolic process No
GO:0044237 cellular metabolic process No
GO:0032559 adenyl ribonucleotide binding No

Deeploc

Deeploc data not available for this genome

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

No expression data available for this genome

Orthologs

Orthofinder run ID4
Orthogroup2717
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|6786
Ophiocordyceps australis map64 (Brazil) OphauB2|7247 (this protein)
Ophiocordyceps camponoti-floridani Ophcf2|00708
Ophiocordyceps camponoti-rufipedis Ophun1|4766
Ophiocordyceps kimflemingae Ophio5|6191
Ophiocordyceps subramaniannii Hirsu2|4259

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >OphauB2|7247
MEGAFTHVGNHLISDSAAAIKAGADDDLSALDADESLLFGKHRGPSGRRRADDDDNQTELLDEDDNDSVNSVTLG
GLGGMSLKDAQKEEPAPHACAYCGIHTPASVVKCLMCDKWFCGARGNGNTTHIVSHMVRARHKEVQLHPESTLGD
TVLECYNCGTKNAFILGFIPAKSDTVVVLLCRQPCAAGSSTKDMNWDVSRWQPLIEERAFLPWLVTPPPEEEQLR
SNHISTREMIFLEDTWKVDSTATIRDLAKVTNVDDDPDPVLLQYEDPYHYQNIFGPLVKMESDYDKKLKEEQSED
DLVVRWDQGLNGKYIAIFNLHKIESGDVKLAVGDEMRLRYNGELQQPWEGVGYVTKIPNSQSDDVCLELRKTDKK
DSVPKDLSHNFSADYVWKATSYDRMQLAMKTFAIDEMSASGYIFHALLGHDVQSKPLNVRQPKKWSAPNLPDLNP
SQIDAIKAALNKPLSLIQGPPGTGKTVTSATIIYHLAKETSNKVLVCAPSNVAVDQLCERIHRTGLKVVRLTAKS
REDVESSVSFLALHEQVRMAEPHTDLSKLTQLKSELGELSSVDEKKFKQLTKRAERKILNHADVVCCTCVGAGDP
RLSKMNFRNVLIDESTQSAEPECLIPLVLGCKQVVLVGDHMQLGPVIMNKKAAKAGLNKSLFERLINLRHAPIRL
NTQYRMHPCLSEFPCNMFYEGVLQNGVTREQRIRKGVDFPWPMAEIPMMFWVNLGNEEISSSGTSYLNRTEASNV
EKAVTRFFRAGVKPSEIGVITPYEGQRSYIVTTMQNTGSCTKSLYREVEVASVDAFQGREKDYIILSCVRSNESQ
GIGFLSDPRRLNVAMTRAKYGLVILGNPKVLSKHELWYELLRHYKDRNCLVEGPLTNLQTCLLQFSRPRSNYRQK
NLYQSQYPLGSYPNGRHHAAAGAGTASVLDSDVASTISFMPDDLSSIRGFHYGGGGAALNSAYPSMFSSFAPDHW
PGLPGVGAPGRGHRNRGRGAESVAGESVANSELTETTATTSNSVIGGKGVGQGGASLGAGLHDAVTGMRAVTYTQ
SDRLKHYVESNGRMTQGGGYGRRFDDDEKSISTAFHSQIGGGYD*
Coding >OphauB2|7247
ATGGAAGGTGCATTCACCCATGTAGGGAATCATCTCATCTCCGACTCGGCAGCTGCCATCAAAGCCGGCGCCGAT
GATGATCTCTCTGCCCTCGATGCCGACGAGAGCCTTCTCTTTGGCAAGCACCGAGGCCCTAGTGGCCGCCGTCGT
GCAGACGATGACGACAACCAGACCGAACTTCTCGACGAGGACGACAACGACAGCGTCAATAGTGTTACTCTTGGA
GGCTTGGGAGGCATGAGCCTCAAGGATGCGCAAAAAGAGGAACCTGCGCCCCACGCCTGCGCCTATTGCGGCATC
CACACGCCGGCCTCGGTCGTCAAGTGTCTGATGTGCGACAAGTGGTTCTGTGGTGCGCGAGGCAACGGCAACACG
ACCCACATCGTTAGCCACATGGTTCGAGCGAGGCACAAGGAGGTGCAGCTGCATCCCGAGTCGACTTTAGGAGAT
ACTGTCCTAGAGTGCTACAACTGTGGCACCAAAAATGCCTTTATTCTAGGCTTCATCCCGGCAAAGTCTGACACT
GTCGTCGTGCTTCTATGCCGCCAACCCTGCGCTGCCGGTTCCTCCACCAAGGACATGAATTGGGATGTTTCACGA
TGGCAGCCTCTGATAGAGGAACGAGCCTTCCTGCCATGGCTCGTTACCCCGCCTCCCGAAGAGGAGCAACTGAGG
TCGAACCATATCTCGACGAGGGAAATGATCTTTTTAGAAGACACATGGAAGGTTGATTCGACGGCAACTATCCGG
GACCTTGCCAAGGTCACCAACGTTGATGATGATCCCGATCCTGTGCTGCTCCAGTACGAAGACCCTTACCACTAC
CAAAACATCTTTGGTCCCCTGGTCAAGATGGAATCCGACTATGACAAGAAGCTCAAGGAAGAGCAGTCGGAAGAC
GACCTCGTGGTGCGCTGGGACCAGGGCCTCAACGGAAAGTACATTGCCATCTTCAACTTGCACAAGATTGAGTCG
GGGGATGTGAAGCTGGCTGTCGGAGACGAAATGCGGTTGCGCTACAACGGAGAGCTTCAACAACCCTGGGAGGGT
GTGGGATACGTTACCAAGATTCCCAACAGTCAGTCGGATGACGTGTGCCTGGAGCTACGCAAAACGGATAAGAAA
GATTCTGTTCCCAAGGATCTGTCGCATAATTTCTCGGCCGACTACGTCTGGAAGGCCACGTCTTACGACCGCATG
CAACTGGCCATGAAGACGTTTGCAATCGATGAAATGAGCGCCTCGGGGTACATTTTCCATGCTCTTCTTGGTCAC
GATGTTCAGTCTAAGCCACTTAATGTGCGCCAGCCCAAGAAGTGGTCTGCACCCAACTTGCCAGACCTTAACCCC
AGCCAAATTGACGCCATCAAAGCAGCGCTCAACAAGCCTCTCAGTCTTATCCAAGGGCCCCCAGGTACGGGAAAG
ACGGTGACATCAGCCACCATTATTTACCATCTTGCCAAGGAAACGAGCAACAAAGTGCTCGTGTGCGCGCCCTCC
AACGTGGCCGTCGACCAGCTCTGTGAACGCATTCATCGGACCGGTCTCAAGGTGGTGCGGCTAACTGCAAAGTCA
CGCGAGGATGTCGAGTCGTCTGTCAGCTTCTTGGCCTTGCACGAGCAGGTGCGCATGGCGGAGCCTCATACGGAC
CTGTCCAAGTTGACCCAGCTCAAGAGTGAGCTGGGCGAGCTTTCAAGCGTGGACGAGAAGAAGTTCAAGCAATTG
ACCAAGAGAGCCGAGCGCAAAATTCTGAATCATGCCGATGTGGTGTGCTGCACTTGTGTGGGTGCCGGAGACCCG
CGTCTCTCCAAGATGAACTTTCGCAATGTGCTTATTGATGAGTCGACACAATCAGCCGAGCCCGAGTGCTTGATT
CCATTGGTGCTTGGCTGCAAGCAGGTGGTGCTGGTTGGCGATCACATGCAACTTGGCCCCGTCATTATGAATAAA
AAGGCAGCAAAGGCAGGCCTCAACAAGTCGCTGTTTGAGCGCCTCATCAATCTGCGTCATGCCCCGATCCGATTG
AACACTCAATACCGCATGCACCCGTGTCTCTCCGAGTTCCCGTGCAACATGTTCTACGAAGGAGTTCTCCAAAAC
GGCGTGACTCGCGAACAGCGCATCAGAAAGGGTGTCGACTTTCCATGGCCCATGGCCGAGATCCCCATGATGTTT
TGGGTCAATTTGGGCAATGAGGAAATCTCGAGCTCGGGAACGTCGTATTTGAACCGTACTGAAGCCTCCAACGTG
GAAAAGGCGGTGACTCGTTTCTTCAGGGCGGGGGTGAAGCCCAGCGAGATTGGCGTCATCACGCCATACGAGGGC
CAACGAAGCTATATAGTGACGACGATGCAAAACACAGGATCGTGCACAAAATCTCTCTACCGAGAGGTCGAGGTT
GCGTCAGTGGATGCTTTTCAAGGCCGCGAGAAGGACTACATCATTTTGTCGTGTGTGCGATCGAATGAAAGTCAG
GGTATTGGTTTTCTCTCGGATCCGCGTCGTCTCAATGTGGCCATGACGCGTGCCAAGTATGGCCTGGTTATTCTG
GGTAATCCCAAGGTTCTTTCCAAGCACGAGCTGTGGTATGAGCTGCTCAGGCACTACAAGGACCGCAACTGTCTT
GTTGAGGGGCCCTTGACGAACCTGCAGACGTGCCTGCTTCAATTCAGCCGCCCGAGATCCAACTACCGTCAGAAG
AACCTCTACCAGTCGCAGTATCCTCTCGGCAGCTATCCCAATGGGCGGCATCACGCCGCTGCGGGAGCGGGAACG
GCTTCTGTGCTTGACAGCGACGTGGCGTCTACCATTTCGTTTATGCCAGATGACTTGTCGTCGATTCGAGGATTC
CACTACGGCGGTGGTGGTGCAGCTTTAAATTCGGCTTATCCCTCCATGTTCTCGTCGTTTGCGCCTGACCACTGG
CCCGGGCTTCCAGGCGTGGGTGCCCCTGGACGCGGCCACAGGAACCGTGGCCGAGGGGCCGAGAGCGTGGCTGGT
GAGAGTGTGGCCAACTCGGAGCTGACTGAGACGACGGCAACAACATCCAACAGCGTTATTGGCGGCAAGGGTGTG
GGCCAGGGCGGGGCCAGCCTTGGTGCTGGATTGCACGACGCGGTGACGGGAATGCGAGCCGTAACATACACGCAG
AGCGACCGACTGAAGCATTACGTGGAGAGCAACGGACGAATGACGCAGGGTGGGGGGTATGGCCGTCGGTTTGAC
GACGATGAAAAGAGCATCAGCACGGCCTTTCACAGCCAAATTGGCGGTGGCTACGACTGA
Transcript >OphauB2|7247
ATGGAAGGTGCATTCACCCATGTAGGGAATCATCTCATCTCCGACTCGGCAGCTGCCATCAAAGCCGGCGCCGAT
GATGATCTCTCTGCCCTCGATGCCGACGAGAGCCTTCTCTTTGGCAAGCACCGAGGCCCTAGTGGCCGCCGTCGT
GCAGACGATGACGACAACCAGACCGAACTTCTCGACGAGGACGACAACGACAGCGTCAATAGTGTTACTCTTGGA
GGCTTGGGAGGCATGAGCCTCAAGGATGCGCAAAAAGAGGAACCTGCGCCCCACGCCTGCGCCTATTGCGGCATC
CACACGCCGGCCTCGGTCGTCAAGTGTCTGATGTGCGACAAGTGGTTCTGTGGTGCGCGAGGCAACGGCAACACG
ACCCACATCGTTAGCCACATGGTTCGAGCGAGGCACAAGGAGGTGCAGCTGCATCCCGAGTCGACTTTAGGAGAT
ACTGTCCTAGAGTGCTACAACTGTGGCACCAAAAATGCCTTTATTCTAGGCTTCATCCCGGCAAAGTCTGACACT
GTCGTCGTGCTTCTATGCCGCCAACCCTGCGCTGCCGGTTCCTCCACCAAGGACATGAATTGGGATGTTTCACGA
TGGCAGCCTCTGATAGAGGAACGAGCCTTCCTGCCATGGCTCGTTACCCCGCCTCCCGAAGAGGAGCAACTGAGG
TCGAACCATATCTCGACGAGGGAAATGATCTTTTTAGAAGACACATGGAAGGTTGATTCGACGGCAACTATCCGG
GACCTTGCCAAGGTCACCAACGTTGATGATGATCCCGATCCTGTGCTGCTCCAGTACGAAGACCCTTACCACTAC
CAAAACATCTTTGGTCCCCTGGTCAAGATGGAATCCGACTATGACAAGAAGCTCAAGGAAGAGCAGTCGGAAGAC
GACCTCGTGGTGCGCTGGGACCAGGGCCTCAACGGAAAGTACATTGCCATCTTCAACTTGCACAAGATTGAGTCG
GGGGATGTGAAGCTGGCTGTCGGAGACGAAATGCGGTTGCGCTACAACGGAGAGCTTCAACAACCCTGGGAGGGT
GTGGGATACGTTACCAAGATTCCCAACAGTCAGTCGGATGACGTGTGCCTGGAGCTACGCAAAACGGATAAGAAA
GATTCTGTTCCCAAGGATCTGTCGCATAATTTCTCGGCCGACTACGTCTGGAAGGCCACGTCTTACGACCGCATG
CAACTGGCCATGAAGACGTTTGCAATCGATGAAATGAGCGCCTCGGGGTACATTTTCCATGCTCTTCTTGGTCAC
GATGTTCAGTCTAAGCCACTTAATGTGCGCCAGCCCAAGAAGTGGTCTGCACCCAACTTGCCAGACCTTAACCCC
AGCCAAATTGACGCCATCAAAGCAGCGCTCAACAAGCCTCTCAGTCTTATCCAAGGGCCCCCAGGTACGGGAAAG
ACGGTGACATCAGCCACCATTATTTACCATCTTGCCAAGGAAACGAGCAACAAAGTGCTCGTGTGCGCGCCCTCC
AACGTGGCCGTCGACCAGCTCTGTGAACGCATTCATCGGACCGGTCTCAAGGTGGTGCGGCTAACTGCAAAGTCA
CGCGAGGATGTCGAGTCGTCTGTCAGCTTCTTGGCCTTGCACGAGCAGGTGCGCATGGCGGAGCCTCATACGGAC
CTGTCCAAGTTGACCCAGCTCAAGAGTGAGCTGGGCGAGCTTTCAAGCGTGGACGAGAAGAAGTTCAAGCAATTG
ACCAAGAGAGCCGAGCGCAAAATTCTGAATCATGCCGATGTGGTGTGCTGCACTTGTGTGGGTGCCGGAGACCCG
CGTCTCTCCAAGATGAACTTTCGCAATGTGCTTATTGATGAGTCGACACAATCAGCCGAGCCCGAGTGCTTGATT
CCATTGGTGCTTGGCTGCAAGCAGGTGGTGCTGGTTGGCGATCACATGCAACTTGGCCCCGTCATTATGAATAAA
AAGGCAGCAAAGGCAGGCCTCAACAAGTCGCTGTTTGAGCGCCTCATCAATCTGCGTCATGCCCCGATCCGATTG
AACACTCAATACCGCATGCACCCGTGTCTCTCCGAGTTCCCGTGCAACATGTTCTACGAAGGAGTTCTCCAAAAC
GGCGTGACTCGCGAACAGCGCATCAGAAAGGGTGTCGACTTTCCATGGCCCATGGCCGAGATCCCCATGATGTTT
TGGGTCAATTTGGGCAATGAGGAAATCTCGAGCTCGGGAACGTCGTATTTGAACCGTACTGAAGCCTCCAACGTG
GAAAAGGCGGTGACTCGTTTCTTCAGGGCGGGGGTGAAGCCCAGCGAGATTGGCGTCATCACGCCATACGAGGGC
CAACGAAGCTATATAGTGACGACGATGCAAAACACAGGATCGTGCACAAAATCTCTCTACCGAGAGGTCGAGGTT
GCGTCAGTGGATGCTTTTCAAGGCCGCGAGAAGGACTACATCATTTTGTCGTGTGTGCGATCGAATGAAAGTCAG
GGTATTGGTTTTCTCTCGGATCCGCGTCGTCTCAATGTGGCCATGACGCGTGCCAAGTATGGCCTGGTTATTCTG
GGTAATCCCAAGGTTCTTTCCAAGCACGAGCTGTGGTATGAGCTGCTCAGGCACTACAAGGACCGCAACTGTCTT
GTTGAGGGGCCCTTGACGAACCTGCAGACGTGCCTGCTTCAATTCAGCCGCCCGAGATCCAACTACCGTCAGAAG
AACCTCTACCAGTCGCAGTATCCTCTCGGCAGCTATCCCAATGGGCGGCATCACGCCGCTGCGGGAGCGGGAACG
GCTTCTGTGCTTGACAGCGACGTGGCGTCTACCATTTCGTTTATGCCAGATGACTTGTCGTCGATTCGAGGATTC
CACTACGGCGGTGGTGGTGCAGCTTTAAATTCGGCTTATCCCTCCATGTTCTCGTCGTTTGCGCCTGACCACTGG
CCCGGGCTTCCAGGCGTGGGTGCCCCTGGACGCGGCCACAGGAACCGTGGCCGAGGGGCCGAGAGCGTGGCTGGT
GAGAGTGTGGCCAACTCGGAGCTGACTGAGACGACGGCAACAACATCCAACAGCGTTATTGGCGGCAAGGGTGTG
GGCCAGGGCGGGGCCAGCCTTGGTGCTGGATTGCACGACGCGGTGACGGGAATGCGAGCCGTAACATACACGCAG
AGCGACCGACTGAAGCATTACGTGGAGAGCAACGGACGAATGACGCAGGGTGGGGGGTATGGCCGTCGGTTTGAC
GACGATGAAAAGAGCATCAGCACGGCCTTTCACAGCCAAATTGGCGGTGGCTACGACTGA
Gene >OphauB2|7247
ATGGAAGGTGCATTCACCCATGTAGGGAATCATCTCATCTCCGACTCGGCAGCTGCCATCAAAGCCGGCGCCGAT
GATGATCTCTCTGCCCTCGATGCCGACGAGAGCCTTCTCTTTGGCAAGCACCGAGGCCCTAGTGGCCGCCGTCGT
GCAGACGATGACGACAACCAGACCGAACTTCTCGACGAGGACGACAACGACAGCGTCAATAGTGTTACTCTTGGA
GGCTTGGGAGGCATGAGCCTCAAGGATGCGCAAAAAGAGGAACCTGCGCCCCACGCCTGCGCGTCAGTCTACATT
CCCAAACCACGCCTCTTGGTTCTATATCGCTTGGCTGACATTGCTTGCTAGCTATTGCGGCATCCACACGCCGGC
CTCGGTCGTCAAGTGTCTGATGTGCGACAAGTGGTTCTGTGGTGCGCGAGGCAACGGCAACACGACCCACATCGT
TAGCCACATGGTTCGAGCGAGGCACAAGGAGGTGCAGCTGCATCCCGAGTCGACTTTAGGAGATACTGTCCTAGA
GTGCTACAACTGTGGCACCAAAAATGCCTTTATTCTAGGCTTCATCCCGGCAAAGTCTGACACTGTCGTCGTGCT
TCTATGCCGCCAACCCTGCGCTGCCGGTTCCTCCACCAAGGACATGAATTGGGATGTTTCACGATGGCAGCCTCT
GATAGAGGAACGAGCCTTCCTGCCATGGCTCGTTACCCCGCCTCCCGAAGAGGAGCAACTGAGGTCGAACCATAT
CTCGACGAGGGAAATGATCTTTTTAGAAGACACATGGAAGGTTGATTCGACGGCAACTATCCGGGACCTTGCCAA
GGTCACCAACGTTGATGATGATCCCGATCCTGTGCTGCTCCAGTACGAAGACCCTTACCACTACCAAAACATCTT
TGGTCCCCTGGTCAAGATGGAATCCGACTATGACAAGAAGCTCAAGGAAGAGCAGTCGGAAGACGACCTCGTGGT
GCGCTGGGACCAGGGCCTCAACGGAAAGTACATTGCCATCTTCAACTTGCACAAGATTGAGTCGGGGGATGTGAA
GCTGGCTGTCGGAGACGAAATGCGGTTGCGCTACAACGGAGAGCTTCAACAACCCTGGGAGGGTGTGGGATACGT
TACCAAGATTCCCAACAGTCAGTCGGATGACGTGTGCCTGGAGCTACGCAAAACGGATAAGAAAGATTCTGTTCC
CAAGGATCTGTCGCATAATTTCTCGGCCGACTACGTCTGGAAGGCCACGTCTTACGACCGCATGCAACTGGCCAT
GAAGACGTTTGCAATCGATGAAATGAGCGCCTCGGGGTACATTTTCCATGCTCTTCTTGGTCACGATGTTCAGTC
TAAGCCACTTAATGTGCGCCAGCCCAAGAAGTGGTCTGCACCCAACTTGCCAGACCTTAACCCCAGCCAAATTGA
CGCCATCAAAGCAGCGCTCAACAAGCCTCTCAGTCTTATCCAAGGGCCCCCAGGTACGGGAAAGACGGTGACATC
AGCCACCATTATTTACCATCTTGCCAAGGAAACGAGCAACAAAGTGCTCGTGTGCGCGCCCTCCAACGTGGCCGT
CGACCAGCTCTGTGAACGCATTCATCGGACCGGTCTCAAGGTGGTGCGGCTAACTGCAAAGTCACGCGAGGATGT
CGAGTCGTCTGTCAGCTTCTTGGCCTTGCACGAGCAGGTGCGCATGGCGGAGCCTCATACGGACCTGTCCAAGTT
GACCCAGCTCAAGAGTGAGCTGGGCGAGCTTTCAAGCGTGGACGAGAAGAAGTTCAAGCAATTGACCAAGAGAGC
CGAGCGCAAAATTCTGAATCATGCCGATGTGGTGTGCTGCACTTGTGTGGGTGCCGGAGACCCGCGTCTCTCCAA
GATGAACTTTCGCAATGTGCTTATTGATGAGTCGACACAATCAGCCGAGCCCGAGTGCTTGATTCCATTGGTGCT
TGGCTGCAAGCAGGTGGTGCTGGTTGGCGATCACATGCAACTTGGCCCCGTCATTATGAATAAAAAGGCAGCAAA
GGCAGGCCTCAACAAGTCGCTGTTTGAGCGCCTCATCAATCTGCGTCATGCCCCGATCCGATTGAACACTCAATA
CCGCATGCACCCGTGTCTCTCCGAGTTCCCGTGCAACATGTTCTACGAAGGAGTTCTCCAAAACGGCGTGACTCG
CGAACAGCGCATCAGAAAGGGTGTCGACTTTCCATGGCCCATGGCCGAGATCCCCATGATGTTTTGGGTCAATTT
GGGCAATGAGGAAATCTCGAGCTCGGGAACGTCGTATTTGAACCGTACTGAAGCCTCCAACGTGGAAAAGGCGGT
GACTCGTTTCTTCAGGGCGGGGGTGAAGCCCAGCGAGATTGGCGTCATCACGCCATACGAGGGCCAACGAAGCTA
TATAGTGACGACGATGCAAAACACAGGATCGTGCACAAAATCTCTCTACCGAGAGGTCGAGGTTGCGTCAGTGGA
TGCTTTTCAAGGCCGCGAGAAGGACTACATCATTTTGTCGTGTGTGCGATCGAATGAAAGTCAGGGTATTGGTTT
TCTCTCGGATCCGCGTCGTCTCAATGTGGCCATGACGCGTGCCAAGTATGGCCTGGTTATTCTGGGTAATCCCAA
GGTTCTTTCCAAGCACGAGCTGTGGTATGAGCTGCTCAGGCACTACAAGGACCGCAACTGTCTTGTTGAGGGGCC
CTTGACGAACCTGCAGACGTGCCTGCTTCAATTCAGCCGCCCGAGATCCAACTACCGTCAGAAGAACCTCTACCA
GTCGCAGTATCCTCTCGGCAGCTATCCCAATGGGCGGCATCACGCCGCTGCGGGAGCGGGAACGGCTTCTGTGCT
TGACAGCGACGTGGCGTCTACCATTTCGTTTATGCCAGATGACTTGTCGTCGATTCGAGGATTCCACTACGGCGG
TGGTGGTGCAGCTTTAAATTCGGCTTATCCCTCCATGTTCTCGTCGTTTGCGCCTGACCACTGGCCCGGGCTTCC
AGGCGTGGGTGCCCCTGGACGCGGCCACAGGAACCGTGGCCGAGGGGCCGAGAGCGTGGCTGGTGAGAGTGTGGC
CAACTCGGAGCTGACTGAGACGACGGCAACAACATCCAACAGCGTTATTGGCGGCAAGGGTGTGGGCCAGGGCGG
GGCCAGCCTTGGTGCTGGATTGCACGACGCGGTGACGGGAATGCGAGCCGTAACATACACGCAGAGCGACCGACT
GAAGCATTACGTGGAGAGCAACGGACGAATGACGCAGGGTGGGGGGTATGGCCGTCGGTTTGACGACGATGAAAA
GAGCATCAGCACGGCCTTTCACAGCCAAATTGGCGGTGGCTACGACTGA

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail