Fungal Genomics

at Utrecht University

General Properties

Protein IDOphauB2|7238
Gene name
LocationContig_75:28358..29838
Strand+
Gene length (bp)1480
Transcript length (bp)1254
Coding sequence length (bp)1254
Protein length (aa) 418

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF08438 MMR_HSR1_C GTPase of unknown function C-terminal 8.6E-36 226 345
PF01926 MMR_HSR1 50S ribosome-binding GTPase 1.5E-19 7 127
PF02421 FeoB_N Ferrous iron transport protein B 1.1E-07 7 44

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|O94362|YHOF_SCHPO Uncharacterized GTP-binding protein C428.15 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPBC428.15 PE=3 SV=1 1 414 0.0E+00
sp|P42942|YG4I_YEAST Uncharacterized GTP-binding protein YGR210C OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=YGR210C PE=1 SV=1 1 414 0.0E+00
sp|Q58728|Y1332_METJA Uncharacterized GTP-binding protein MJ1332 OS=Methanocaldococcus jannaschii (strain ATCC 43067 / DSM 2661 / JAL-1 / JCM 10045 / NBRC 100440) GN=MJ1332 PE=3 SV=1 6 412 6.0E-82
sp|P37518|YCHF_BACSU Ribosome-binding ATPase YchF OS=Bacillus subtilis (strain 168) GN=ychF PE=3 SV=1 8 260 1.0E-16
sp|B8BBN7|OLA1_ORYSI Obg-like ATPase 1 OS=Oryza sativa subsp. indica GN=OsI_28170 PE=3 SV=1 7 136 9.0E-16
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|O94362|YHOF_SCHPO Uncharacterized GTP-binding protein C428.15 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPBC428.15 PE=3 SV=1 1 414 0.0E+00
sp|P42942|YG4I_YEAST Uncharacterized GTP-binding protein YGR210C OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=YGR210C PE=1 SV=1 1 414 0.0E+00
sp|Q58728|Y1332_METJA Uncharacterized GTP-binding protein MJ1332 OS=Methanocaldococcus jannaschii (strain ATCC 43067 / DSM 2661 / JAL-1 / JCM 10045 / NBRC 100440) GN=MJ1332 PE=3 SV=1 6 412 6.0E-82
sp|P37518|YCHF_BACSU Ribosome-binding ATPase YchF OS=Bacillus subtilis (strain 168) GN=ychF PE=3 SV=1 8 260 1.0E-16
sp|B8BBN7|OLA1_ORYSI Obg-like ATPase 1 OS=Oryza sativa subsp. indica GN=OsI_28170 PE=3 SV=1 7 136 9.0E-16
sp|Q6Z1J6|OLA1_ORYSJ Obg-like ATPase 1 OS=Oryza sativa subsp. japonica GN=YchF1 PE=1 SV=1 7 136 1.0E-15
sp|Q6AK07|OBG_DESPS GTPase Obg OS=Desulfotalea psychrophila (strain LSv54 / DSM 12343) GN=obg PE=3 SV=1 7 131 1.0E-15
sp|Q9SA73|OLA1_ARATH Obg-like ATPase 1 OS=Arabidopsis thaliana GN=YchF1 PE=1 SV=1 7 122 5.0E-15
sp|P57288|YCHF_BUCAI Ribosome-binding ATPase YchF OS=Buchnera aphidicola subsp. Acyrthosiphon pisum (strain APS) GN=ychF PE=3 SV=3 8 145 1.0E-14
sp|Q7VMI2|YCHF_HAEDU Ribosome-binding ATPase YchF OS=Haemophilus ducreyi (strain 35000HP / ATCC 700724) GN=ychF PE=3 SV=3 8 144 2.0E-14
sp|P0C1E6|OBG_CORGL GTPase Obg OS=Corynebacterium glutamicum (strain ATCC 13032 / DSM 20300 / JCM 1318 / LMG 3730 / NCIMB 10025) GN=obg PE=3 SV=1 7 155 2.0E-14
sp|A4QG78|OBG_CORGB GTPase Obg OS=Corynebacterium glutamicum (strain R) GN=obg PE=3 SV=1 7 155 2.0E-14
sp|P0ABU4|YCHF_SHIFL Ribosome-binding ATPase YchF OS=Shigella flexneri GN=ychF PE=3 SV=2 8 144 3.0E-14
sp|P0ABU2|YCHF_ECOLI Ribosome-binding ATPase YchF OS=Escherichia coli (strain K12) GN=ychF PE=1 SV=2 8 144 3.0E-14
sp|P0ABU3|YCHF_ECO57 Ribosome-binding ATPase YchF OS=Escherichia coli O157:H7 GN=ychF PE=3 SV=2 8 144 3.0E-14
sp|Q8K9V2|YCHF_BUCAP Ribosome-binding ATPase YchF OS=Buchnera aphidicola subsp. Schizaphis graminum (strain Sg) GN=ychF PE=3 SV=3 8 145 4.0E-14
sp|Q6NFV7|OBG_CORDI GTPase Obg OS=Corynebacterium diphtheriae (strain ATCC 700971 / NCTC 13129 / Biotype gravis) GN=obg PE=3 SV=1 7 149 8.0E-14
sp|A0JPJ7|OLA1_RAT Obg-like ATPase 1 OS=Rattus norvegicus GN=Ola1 PE=2 SV=1 7 277 8.0E-14
sp|B2A6B7|OBG_NATTJ GTPase Obg OS=Natranaerobius thermophilus (strain ATCC BAA-1301 / DSM 18059 / JW/NM-WN-LF) GN=obg PE=3 SV=1 7 149 1.0E-13
sp|Q8FN81|OBG_COREF GTPase Obg OS=Corynebacterium efficiens (strain DSM 44549 / YS-314 / AJ 12310 / JCM 11189 / NBRC 100395) GN=obg PE=3 SV=2 7 149 1.0E-13
sp|A3DBS5|OBG_CLOTH GTPase Obg OS=Clostridium thermocellum (strain ATCC 27405 / DSM 1237 / NBRC 103400 / NCIMB 10682 / NRRL B-4536 / VPI 7372) GN=obg PE=3 SV=1 7 147 1.0E-13
sp|B0S3Z4|OBG_FINM2 GTPase Obg OS=Finegoldia magna (strain ATCC 29328) GN=obg PE=3 SV=1 7 147 1.0E-13
sp|P44681|YCHF_HAEIN Ribosome-binding ATPase YchF OS=Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd) GN=ychF PE=1 SV=2 8 144 1.0E-13
sp|P38746|YLF2_YEAST Obg-like ATPase homolog OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=YLF2 PE=1 SV=1 1 145 1.0E-13
sp|Q89AR6|YCHF_BUCBP Ribosome-binding ATPase YchF OS=Buchnera aphidicola subsp. Baizongia pistaciae (strain Bp) GN=ychF PE=3 SV=3 8 115 2.0E-13
sp|Q9CZ30|OLA1_MOUSE Obg-like ATPase 1 OS=Mus musculus GN=Ola1 PE=1 SV=1 7 277 2.0E-13
sp|B2UQ30|OBG_AKKM8 GTPase Obg OS=Akkermansia muciniphila (strain ATCC BAA-835 / Muc) GN=obg PE=3 SV=2 8 156 2.0E-13
sp|Q9CP90|YCHF_PASMU Ribosome-binding ATPase YchF OS=Pasteurella multocida (strain Pm70) GN=ychF PE=3 SV=3 8 115 2.0E-13
sp|A4T2J4|OBG_MYCGI GTPase Obg OS=Mycobacterium gilvum (strain PYR-GCK) GN=obg PE=3 SV=1 7 147 2.0E-13
sp|A1TC21|OBG_MYCVP GTPase Obg OS=Mycobacterium vanbaalenii (strain DSM 7251 / PYR-1) GN=obg PE=3 SV=1 7 147 3.0E-13
sp|Q2HJ33|OLA1_BOVIN Obg-like ATPase 1 OS=Bos taurus GN=OLA1 PE=2 SV=1 7 277 3.0E-13
sp|Q67SC6|OBG_SYMTH GTPase Obg OS=Symbiobacterium thermophilum (strain T / IAM 14863) GN=obg PE=3 SV=1 7 147 4.0E-13
sp|A7NRU6|OBG_ROSCS GTPase Obg OS=Roseiflexus castenholzii (strain DSM 13941 / HLO8) GN=obg PE=3 SV=2 7 279 4.0E-13
sp|Q5R821|OLA1_PONAB Obg-like ATPase 1 OS=Pongo abelii GN=OLA1 PE=2 SV=1 7 277 4.0E-13
sp|Q8RBA5|OBG_CALS4 GTPase Obg OS=Caldanaerobacter subterraneus subsp. tengcongensis (strain DSM 15242 / JCM 11007 / NBRC 100824 / MB4) GN=obg PE=3 SV=1 7 147 4.0E-13
sp|Q9NTK5|OLA1_HUMAN Obg-like ATPase 1 OS=Homo sapiens GN=OLA1 PE=1 SV=2 7 277 5.0E-13
sp|Q5ZM25|OLA1_CHICK Obg-like ATPase 1 OS=Gallus gallus GN=OLA1 PE=2 SV=1 7 275 5.0E-13
sp|B0K414|OBG_THEPX GTPase Obg OS=Thermoanaerobacter sp. (strain X514) GN=obg PE=3 SV=1 7 147 8.0E-13
sp|B0KAB8|OBG_THEP3 GTPase Obg OS=Thermoanaerobacter pseudethanolicus (strain ATCC 33223 / 39E) GN=obg PE=3 SV=1 7 147 8.0E-13
sp|Q7ZU42|OLA1_DANRE Obg-like ATPase 1 OS=Danio rerio GN=ola1 PE=2 SV=1 7 144 9.0E-13
sp|A0R149|OBG_MYCS2 GTPase Obg OS=Mycobacterium smegmatis (strain ATCC 700084 / mc(2)155) GN=obg PE=3 SV=1 7 147 1.0E-12
sp|Q1B629|OBG_MYCSS GTPase Obg OS=Mycobacterium sp. (strain MCS) GN=obg PE=3 SV=1 7 147 1.0E-12
sp|A1UJ07|OBG_MYCSK GTPase Obg OS=Mycobacterium sp. (strain KMS) GN=obg PE=3 SV=1 7 147 1.0E-12
sp|A3Q2F3|OBG_MYCSJ GTPase Obg OS=Mycobacterium sp. (strain JLS) GN=obg PE=3 SV=1 7 147 1.0E-12
sp|Q1AVU3|OBG_RUBXD GTPase Obg OS=Rubrobacter xylanophilus (strain DSM 9941 / NBRC 16129) GN=obg PE=3 SV=1 7 127 1.0E-12
sp|Q5NR23|OBG_ZYMMO GTPase Obg OS=Zymomonas mobilis subsp. mobilis (strain ATCC 31821 / ZM4 / CP4) GN=obg PE=3 SV=1 7 119 1.0E-12
sp|B2HMG1|OBG_MYCMM GTPase Obg OS=Mycobacterium marinum (strain ATCC BAA-535 / M) GN=obg PE=3 SV=1 7 147 1.0E-12
sp|B1M697|OBG_METRJ GTPase Obg OS=Methylobacterium radiotolerans (strain ATCC 27329 / DSM 1819 / JCM 2831) GN=obg PE=3 SV=1 8 201 1.0E-12
sp|B1I5V8|OBG_DESAP GTPase Obg OS=Desulforudis audaxviator (strain MP104C) GN=obg PE=3 SV=1 7 147 1.0E-12
sp|Q5Z041|OBG_NOCFA GTPase Obg OS=Nocardia farcinica (strain IFM 10152) GN=obg PE=3 SV=1 7 147 1.0E-12
sp|P47270|YCHF_MYCGE Ribosome-binding ATPase YchF OS=Mycoplasma genitalium (strain ATCC 33530 / G-37 / NCTC 10195) GN=ychF PE=3 SV=1 8 115 1.0E-12
sp|P91917|OLA1_CAEEL Obg-like ATPase 1 OS=Caenorhabditis elegans GN=ola-1 PE=3 SV=1 7 174 2.0E-12
sp|A0QDH0|OBG_MYCA1 GTPase Obg OS=Mycobacterium avium (strain 104) GN=obg PE=3 SV=1 7 147 2.0E-12
sp|Q73XP5|OBG_MYCPA GTPase Obg OS=Mycobacterium paratuberculosis (strain ATCC BAA-968 / K-10) GN=obg PE=3 SV=1 7 147 2.0E-12
sp|Q3YRX8|OBG_EHRCJ GTPase Obg OS=Ehrlichia canis (strain Jake) GN=obg PE=3 SV=1 7 118 2.0E-12
sp|A0PU15|OBG_MYCUA GTPase Obg OS=Mycobacterium ulcerans (strain Agy99) GN=obg PE=3 SV=1 7 147 2.0E-12
sp|Q5HB45|OBG_EHRRW GTPase Obg OS=Ehrlichia ruminantium (strain Welgevonden) GN=obg PE=3 SV=1 7 118 3.0E-12
sp|Q5FH94|OBG_EHRRG GTPase Obg OS=Ehrlichia ruminantium (strain Gardel) GN=obg PE=3 SV=1 7 118 3.0E-12
sp|A9AXD9|OBG_HERA2 GTPase Obg OS=Herpetosiphon aurantiacus (strain ATCC 23779 / DSM 785) GN=obg PE=3 SV=1 7 155 3.0E-12
sp|B1MMY5|OBG_MYCA9 GTPase Obg OS=Mycobacterium abscessus (strain ATCC 19977 / DSM 44196 / CIP 104536 / JCM 13569 / NCTC 13031 / TMC 1543) GN=obg PE=3 SV=1 7 147 3.0E-12
sp|A7HJZ8|OBG_FERNB GTPase Obg OS=Fervidobacterium nodosum (strain ATCC 35602 / DSM 5306 / Rt17-B1) GN=obg PE=3 SV=1 7 155 3.0E-12
sp|Q2JDP2|OBG_FRASC GTPase Obg OS=Frankia sp. (strain CcI3) GN=obg PE=3 SV=1 7 155 3.0E-12
sp|Q6MEQ6|OBG_PARUW GTPase Obg OS=Protochlamydia amoebophila (strain UWE25) GN=obg PE=3 SV=1 7 155 4.0E-12
sp|B9L101|OBG_THERP GTPase Obg OS=Thermomicrobium roseum (strain ATCC 27502 / DSM 5159 / P-2) GN=obg PE=3 SV=1 7 147 4.0E-12
sp|B9DNE7|OBG_STACT GTPase Obg OS=Staphylococcus carnosus (strain TM300) GN=obg PE=3 SV=1 7 159 4.0E-12
sp|Q0SH51|OBG_RHOJR GTPase Obg OS=Rhodococcus jostii (strain RHA1) GN=obg PE=3 SV=1 7 147 5.0E-12
sp|Q2GGS7|OBG_EHRCR GTPase Obg OS=Ehrlichia chaffeensis (strain ATCC CRL-10679 / Arkansas) GN=obg PE=3 SV=1 7 118 6.0E-12
sp|P9WMT1|OBG_MYCTU GTPase Obg OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=obg PE=1 SV=1 7 147 6.0E-12
sp|A5U5D6|OBG_MYCTA GTPase Obg OS=Mycobacterium tuberculosis (strain ATCC 25177 / H37Ra) GN=obg PE=3 SV=1 7 147 6.0E-12
sp|A1KLD6|OBG_MYCBP GTPase Obg OS=Mycobacterium bovis (strain BCG / Pasteur 1173P2) GN=obg PE=3 SV=1 7 147 6.0E-12
sp|Q7TYK5|OBG_MYCBO GTPase Obg OS=Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97) GN=obg PE=3 SV=1 7 147 6.0E-12
sp|P9WMT0|OBG_MYCTO GTPase Obg OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) GN=obg PE=3 SV=1 7 147 6.0E-12
sp|A4J7I9|OBG_DESRM GTPase Obg OS=Desulfotomaculum reducens (strain MI-1) GN=obg PE=3 SV=1 7 144 6.0E-12
sp|Q21D04|OBG_RHOPB GTPase Obg OS=Rhodopseudomonas palustris (strain BisB18) GN=obg PE=3 SV=1 8 201 7.0E-12
sp|A6TQJ6|OBG_ALKMQ GTPase Obg OS=Alkaliphilus metalliredigens (strain QYMF) GN=obg PE=3 SV=1 7 147 7.0E-12
sp|B8FM68|OBG_DESAA GTPase Obg OS=Desulfatibacillum alkenivorans (strain AK-01) GN=obg PE=3 SV=1 7 135 8.0E-12
sp|B3QZT1|OBG_PHYMT GTPase Obg OS=Phytoplasma mali (strain AT) GN=obg PE=3 SV=1 7 155 9.0E-12
sp|C1F9K2|OBG_ACIC5 GTPase Obg OS=Acidobacterium capsulatum (strain ATCC 51196 / DSM 11244 / JCM 7670 / NBRC 15755 / NCIMB 13165 / 161) GN=obg PE=3 SV=1 7 159 1.0E-11
sp|A0LSX1|OBG_ACIC1 GTPase Obg OS=Acidothermus cellulolyticus (strain ATCC 43068 / 11B) GN=obg PE=3 SV=1 7 152 1.0E-11
sp|C0QUB5|OBG_PERMH GTPase Obg OS=Persephonella marina (strain DSM 14350 / EX-H1) GN=obg PE=3 SV=1 7 118 1.0E-11
sp|A8L1V6|OBG_FRASN GTPase Obg OS=Frankia sp. (strain EAN1pec) GN=obg PE=3 SV=1 7 149 1.0E-11
sp|Q9PAS3|OBG_XYLFA GTPase Obg OS=Xylella fastidiosa (strain 9a5c) GN=obg PE=3 SV=2 7 130 1.0E-11
sp|B0U3R3|OBG_XYLFM GTPase Obg OS=Xylella fastidiosa (strain M12) GN=obg PE=3 SV=1 7 130 1.0E-11
sp|A5VD74|OBG_SPHWW GTPase Obg OS=Sphingomonas wittichii (strain RW1 / DSM 6014 / JCM 10273) GN=obg PE=3 SV=1 8 119 1.0E-11
sp|Q6MGS5|OBG_BDEBA GTPase Obg OS=Bdellovibrio bacteriovorus (strain ATCC 15356 / DSM 50701 / NCIB 9529 / HD100) GN=obg PE=3 SV=2 7 151 2.0E-11
sp|Q1GHD0|OBG_RUEST GTPase Obg OS=Ruegeria sp. (strain TM1040) GN=obg PE=3 SV=1 8 128 2.0E-11
sp|Q87BL2|OBG_XYLFT GTPase Obg OS=Xylella fastidiosa (strain Temecula1 / ATCC 700964) GN=obg PE=3 SV=1 7 130 2.0E-11
sp|B2I6V6|OBG_XYLF2 GTPase Obg OS=Xylella fastidiosa (strain M23) GN=obg PE=3 SV=1 7 130 2.0E-11
sp|B8CXZ0|OBG_HALOH GTPase Obg OS=Halothermothrix orenii (strain H 168 / OCM 544 / DSM 9562) GN=obg PE=3 SV=1 7 147 2.0E-11
sp|Q7ZWM6|OLA1_XENLA Obg-like ATPase 1 OS=Xenopus laevis GN=ola1 PE=2 SV=1 7 275 2.0E-11
sp|C1A1L5|OBG_RHOE4 GTPase Obg OS=Rhodococcus erythropolis (strain PR4 / NBRC 100887) GN=obg PE=3 SV=1 7 147 2.0E-11
sp|A7IH06|OBG_XANP2 GTPase Obg OS=Xanthobacter autotrophicus (strain ATCC BAA-1158 / Py2) GN=obg PE=3 SV=1 8 159 2.0E-11
sp|Q0RPF6|OBG_FRAAA GTPase Obg OS=Frankia alni (strain ACN14a) GN=obg PE=3 SV=1 7 155 2.0E-11
sp|Q49Y82|OBG_STAS1 GTPase Obg OS=Staphylococcus saprophyticus subsp. saprophyticus (strain ATCC 15305 / DSM 20229) GN=obg PE=3 SV=1 7 159 2.0E-11
sp|Q6A9H8|OBG_PROAC GTPase Obg OS=Propionibacterium acnes (strain KPA171202 / DSM 16379) GN=obg PE=3 SV=1 7 146 2.0E-11
sp|A8HS51|OBG_AZOC5 GTPase Obg OS=Azorhizobium caulinodans (strain ATCC 43989 / DSM 5975 / JCM 20966 / NBRC 14845 / NCIMB 13405 / ORS 571) GN=obg PE=3 SV=1 8 150 3.0E-11
sp|Q07U75|OBG_RHOP5 GTPase Obg OS=Rhodopseudomonas palustris (strain BisA53) GN=obg PE=3 SV=1 8 118 3.0E-11
sp|A8MHK8|OBG_ALKOO GTPase Obg OS=Alkaliphilus oremlandii (strain OhILAs) GN=obg PE=3 SV=1 7 147 3.0E-11
sp|A5UZ80|OBG_ROSS1 GTPase Obg OS=Roseiflexus sp. (strain RS-1) GN=obg PE=3 SV=1 7 163 3.0E-11
sp|B2IE44|OBG_BEII9 GTPase Obg OS=Beijerinckia indica subsp. indica (strain ATCC 9039 / DSM 1715 / NCIB 8712) GN=obg PE=3 SV=1 8 202 3.0E-11
sp|Q2SRV9|OBG_MYCCT GTPase Obg OS=Mycoplasma capricolum subsp. capricolum (strain California kid / ATCC 27343 / NCTC 10154) GN=obg PE=3 SV=1 7 188 4.0E-11
sp|A4F9L3|OBG_SACEN GTPase Obg OS=Saccharopolyspora erythraea (strain ATCC 11635 / DSM 40517 / JCM 4748 / NBRC 13426 / NCIMB 8594 / NRRL 2338) GN=obg PE=3 SV=1 8 147 4.0E-11
sp|C0ZAL7|OBG_BREBN GTPase Obg OS=Brevibacillus brevis (strain 47 / JCM 6285 / NBRC 100599) GN=obg PE=3 SV=1 7 147 4.0E-11
sp|B3PMC1|OBG_MYCA5 GTPase Obg OS=Mycoplasma arthritidis (strain 158L3-1) GN=obg PE=3 SV=1 7 214 4.0E-11
sp|Q8SWU7|OLA1_DROME Obg-like ATPase 1 OS=Drosophila melanogaster GN=CG1354 PE=1 SV=1 7 154 4.0E-11
sp|Q7CW97|OBG_AGRFC GTPase Obg OS=Agrobacterium fabrum (strain C58 / ATCC 33970) GN=obg PE=3 SV=2 8 118 5.0E-11
sp|A0ZZZ0|OBG_BIFAA GTPase Obg OS=Bifidobacterium adolescentis (strain ATCC 15703 / DSM 20083 / NCTC 11814 / E194a) GN=obg PE=3 SV=1 7 147 5.0E-11
sp|Q82C85|OBG_STRAW GTPase Obg OS=Streptomyces avermitilis (strain ATCC 31267 / DSM 46492 / JCM 5070 / NBRC 14893 / NCIMB 12804 / NRRL 8165 / MA-4680) GN=obg PE=3 SV=1 7 150 5.0E-11
sp|Q5LRY4|OBG_RUEPO GTPase Obg OS=Ruegeria pomeroyi (strain ATCC 700808 / DSM 15171 / DSS-3) GN=obg PE=3 SV=1 7 118 5.0E-11
sp|B2KAW2|OBG_ELUMP GTPase Obg OS=Elusimicrobium minutum (strain Pei191) GN=obg PE=3 SV=1 7 128 5.0E-11
sp|A0JXJ8|OBG_ARTS2 GTPase Obg OS=Arthrobacter sp. (strain FB24) GN=obg PE=3 SV=1 7 147 5.0E-11
sp|B3E609|OBG_GEOLS GTPase Obg OS=Geobacter lovleyi (strain ATCC BAA-1151 / DSM 17278 / SZ) GN=obg PE=3 SV=1 7 124 6.0E-11
sp|O67849|OBG_AQUAE GTPase Obg OS=Aquifex aeolicus (strain VF5) GN=obg PE=3 SV=1 7 118 6.0E-11
sp|B6IQZ9|OBG_RHOCS GTPase Obg OS=Rhodospirillum centenum (strain ATCC 51521 / SW) GN=obg PE=3 SV=1 8 118 6.0E-11
sp|O13998|OLA1_SCHPO Obg-like ATPase 1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC27E2.03c PE=1 SV=1 8 250 7.0E-11
sp|B4U3Q7|OBG_STREM GTPase Obg OS=Streptococcus equi subsp. zooepidemicus (strain MGCS10565) GN=obg PE=3 SV=1 7 245 7.0E-11
sp|Q89X89|OBG_BRADU GTPase Obg OS=Bradyrhizobium diazoefficiens (strain JCM 10833 / IAM 13628 / NBRC 14792 / USDA 110) GN=obg PE=3 SV=1 8 118 7.0E-11
sp|Q2NCX8|OBG_ERYLH GTPase Obg OS=Erythrobacter litoralis (strain HTCC2594) GN=obg PE=3 SV=1 7 128 7.0E-11
sp|Q65GM7|OBG_BACLD GTPase Obg OS=Bacillus licheniformis (strain ATCC 14580 / DSM 13 / JCM 2505 / NBRC 12200 / NCIMB 9375 / NRRL NRS-1264 / Gibson 46) GN=obg PE=3 SV=1 7 147 7.0E-11
sp|A4YKF3|OBG_BRASO GTPase Obg OS=Bradyrhizobium sp. (strain ORS278) GN=obg PE=3 SV=1 8 118 7.0E-11
sp|C0MDB4|OBG_STRS7 GTPase Obg OS=Streptococcus equi subsp. zooepidemicus (strain H70) GN=obg PE=3 SV=1 7 147 8.0E-11
sp|Q4FP46|OBG_PELUB GTPase Obg OS=Pelagibacter ubique (strain HTCC1062) GN=obg PE=3 SV=1 7 118 8.0E-11
sp|A5E965|OBG_BRASB GTPase Obg OS=Bradyrhizobium sp. (strain BTAi1 / ATCC BAA-1182) GN=obg PE=3 SV=1 8 118 8.0E-11
sp|Q892N8|OBG_CLOTE GTPase Obg OS=Clostridium tetani (strain Massachusetts / E88) GN=obg PE=3 SV=1 7 147 8.0E-11
sp|C0MBS1|OBG_STRE4 GTPase Obg OS=Streptococcus equi subsp. equi (strain 4047) GN=obg PE=3 SV=1 7 245 8.0E-11
sp|B2GGD9|OBG_KOCRD GTPase Obg OS=Kocuria rhizophila (strain ATCC 9341 / DSM 348 / NBRC 103217 / DC2201) GN=obg PE=3 SV=1 7 147 8.0E-11
sp|B3CQ33|OBG_ORITI GTPase Obg OS=Orientia tsutsugamushi (strain Ikeda) GN=obg PE=3 SV=1 7 118 9.0E-11
sp|A5CDM6|OBG_ORITB GTPase Obg OS=Orientia tsutsugamushi (strain Boryong) GN=obg PE=3 SV=1 7 118 9.0E-11
sp|Q4JWT6|OBG_CORJK GTPase Obg OS=Corynebacterium jeikeium (strain K411) GN=obg PE=3 SV=1 7 147 9.0E-11
sp|Q2J3J8|OBG_RHOP2 GTPase Obg OS=Rhodopseudomonas palustris (strain HaA2) GN=obg PE=3 SV=1 8 118 9.0E-11
sp|P95758|OBG_STRGR GTPase Obg OS=Streptomyces griseus GN=obg PE=1 SV=1 7 144 9.0E-11
sp|B1VXD8|OBG_STRGG GTPase Obg OS=Streptomyces griseus subsp. griseus (strain JCM 4626 / NBRC 13350) GN=obg PE=3 SV=1 7 144 9.0E-11
sp|B2JHD7|OBG_BURP8 GTPase Obg OS=Burkholderia phymatum (strain DSM 17167 / STM815) GN=obg PE=3 SV=1 7 132 9.0E-11
sp|B8GA36|OBG_CHLAD GTPase Obg OS=Chloroflexus aggregans (strain MD-66 / DSM 9485) GN=obg PE=3 SV=1 7 119 1.0E-10
sp|Q9CF94|OBG_LACLA GTPase Obg OS=Lactococcus lactis subsp. lactis (strain IL1403) GN=obg PE=3 SV=1 7 147 1.0E-10
sp|B5ZUE3|OBG_RHILW GTPase Obg OS=Rhizobium leguminosarum bv. trifolii (strain WSM2304) GN=obg PE=3 SV=1 8 118 1.0E-10
sp|Q6NDE6|OBG_RHOPA GTPase Obg OS=Rhodopseudomonas palustris (strain ATCC BAA-98 / CGA009) GN=obg PE=3 SV=1 8 118 1.0E-10
sp|F4HSD4|OBGM_ARATH Probable GTP-binding protein OBGM, mitochondrial OS=Arabidopsis thaliana GN=ATOBGM PE=2 SV=1 7 125 1.0E-10
sp|A9IMA6|OBG_BART1 GTPase Obg OS=Bartonella tribocorum (strain CIP 105476 / IBS 506) GN=obg PE=3 SV=1 8 118 1.0E-10
sp|B0RDG3|OBG_CLAMS GTPase Obg OS=Clavibacter michiganensis subsp. sepedonicus (strain ATCC 33113 / DSM 20744 / JCM 9667 / LMG 2889 / C-1) GN=obg PE=3 SV=1 7 147 1.0E-10
sp|A5D410|OBG_PELTS GTPase Obg OS=Pelotomaculum thermopropionicum (strain DSM 13744 / JCM 10971 / SI) GN=obg PE=3 SV=1 7 159 1.0E-10
sp|B3Q731|OBG_RHOPT GTPase Obg OS=Rhodopseudomonas palustris (strain TIE-1) GN=obg PE=3 SV=1 8 118 1.0E-10
sp|B6JD21|OBG_OLICO GTPase Obg OS=Oligotropha carboxidovorans (strain ATCC 49405 / DSM 1227 / OM5) GN=obg PE=3 SV=1 8 118 1.0E-10
sp|A1R787|OBG_ARTAT GTPase Obg OS=Arthrobacter aurescens (strain TC1) GN=obg PE=3 SV=1 7 144 1.0E-10
sp|P75088|YCHF_MYCPN Ribosome-binding ATPase YchF OS=Mycoplasma pneumoniae (strain ATCC 29342 / M129) GN=ychF PE=3 SV=1 8 115 1.0E-10
sp|Q13U15|OBG_BURXL GTPase Obg OS=Burkholderia xenovorans (strain LB400) GN=obg PE=3 SV=1 7 161 1.0E-10
sp|A9WUU2|OBG_RENSM GTPase Obg OS=Renibacterium salmoninarum (strain ATCC 33209 / DSM 20767 / JCM 11484 / NBRC 15589 / NCIMB 2235) GN=obg PE=3 SV=1 7 147 1.0E-10
sp|Q6MTG9|OBG_MYCMS GTPase Obg OS=Mycoplasma mycoides subsp. mycoides SC (strain PG1) GN=obg PE=3 SV=1 7 188 1.0E-10
sp|Q0D3S3|OBGC1_ORYSJ Probable GTP-binding protein OBGC1, chloroplastic OS=Oryza sativa subsp. japonica GN=OBGC1 PE=3 SV=1 7 119 1.0E-10
sp|A2YPR8|OBGC1_ORYSI Probable GTP-binding protein OBGC1, chloroplastic OS=Oryza sativa subsp. indica GN=OBGC1 PE=3 SV=1 7 119 1.0E-10
sp|A5CR32|OBG_CLAM3 GTPase Obg OS=Clavibacter michiganensis subsp. michiganensis (strain NCPPB 382) GN=obg PE=3 SV=1 7 147 1.0E-10
sp|Q02XY2|OBG_LACLS GTPase Obg OS=Lactococcus lactis subsp. cremoris (strain SK11) GN=obg PE=3 SV=1 7 147 1.0E-10
sp|B8I179|OBG_CLOCE GTPase Obg OS=Clostridium cellulolyticum (strain ATCC 35319 / DSM 5812 / JCM 6584 / H10) GN=obg PE=3 SV=1 7 147 1.0E-10
sp|A2RJQ6|OBG_LACLM GTPase Obg OS=Lactococcus lactis subsp. cremoris (strain MG1363) GN=obg PE=3 SV=1 7 147 1.0E-10
sp|B9LC30|OBG_CHLSY GTPase Obg OS=Chloroflexus aurantiacus (strain ATCC 29364 / DSM 637 / Y-400-fl) GN=obg PE=3 SV=1 7 162 1.0E-10
sp|A9WK62|OBG_CHLAA GTPase Obg OS=Chloroflexus aurantiacus (strain ATCC 29366 / DSM 635 / J-10-fl) GN=obg PE=3 SV=1 7 162 1.0E-10
sp|A6WDM9|OBG_KINRD GTPase Obg OS=Kineococcus radiotolerans (strain ATCC BAA-149 / DSM 14245 / SRS30216) GN=obg PE=3 SV=1 7 147 1.0E-10
sp|Q13DL7|OBG_RHOPS GTPase Obg OS=Rhodopseudomonas palustris (strain BisB5) GN=obg PE=3 SV=1 8 118 1.0E-10
sp|Q3SVI2|OBG_NITWN GTPase Obg OS=Nitrobacter winogradskyi (strain Nb-255 / ATCC 25391) GN=obg PE=3 SV=1 8 117 2.0E-10
sp|B7HE73|OBG_BACC4 GTPase Obg OS=Bacillus cereus (strain B4264) GN=obg PE=3 SV=1 7 147 2.0E-10
sp|Q022G3|OBG_SOLUE GTPase Obg OS=Solibacter usitatus (strain Ellin6076) GN=obg PE=3 SV=1 7 147 2.0E-10
sp|Q1IVS5|OBG_KORVE GTPase Obg OS=Koribacter versatilis (strain Ellin345) GN=obg PE=3 SV=1 7 159 2.0E-10
sp|P20964|OBG_BACSU GTPase Obg OS=Bacillus subtilis (strain 168) GN=obg PE=1 SV=1 7 147 2.0E-10
sp|Q6HD85|OBG_BACHK GTPase Obg OS=Bacillus thuringiensis subsp. konkukian (strain 97-27) GN=obg PE=3 SV=1 7 147 2.0E-10
sp|Q634A3|OBG_BACCZ GTPase Obg OS=Bacillus cereus (strain ZK / E33L) GN=obg PE=3 SV=1 7 147 2.0E-10
sp|C1ETN7|OBG_BACC3 GTPase Obg OS=Bacillus cereus (strain 03BB102) GN=obg PE=3 SV=1 7 147 2.0E-10
sp|A0RJ47|OBG_BACAH GTPase Obg OS=Bacillus thuringiensis (strain Al Hakam) GN=obg PE=3 SV=1 7 147 2.0E-10
sp|B9JER1|OBG_AGRRK GTPase Obg OS=Agrobacterium radiobacter (strain K84 / ATCC BAA-868) GN=obg PE=3 SV=1 8 118 2.0E-10
sp|B9IZ16|OBG_BACCQ GTPase Obg OS=Bacillus cereus (strain Q1) GN=obg PE=3 SV=1 7 147 2.0E-10
sp|Q72ZY5|OBG_BACC1 GTPase Obg OS=Bacillus cereus (strain ATCC 10987 / NRS 248) GN=obg PE=3 SV=1 7 147 2.0E-10
sp|Q817U6|OBG_BACCR GTPase Obg OS=Bacillus cereus (strain ATCC 14579 / DSM 31 / JCM 2152 / NBRC 15305 / NCIMB 9373 / NRRL B-3711) GN=obg PE=3 SV=1 7 147 2.0E-10
sp|B7HQJ8|OBG_BACC7 GTPase Obg OS=Bacillus cereus (strain AH187) GN=obg PE=3 SV=1 7 147 2.0E-10
sp|B2SYV2|OBG_BURPP GTPase Obg OS=Burkholderia phytofirmans (strain DSM 17436 / PsJN) GN=obg PE=3 SV=1 7 161 2.0E-10
sp|Q2K2X6|OBG_RHIEC GTPase Obg OS=Rhizobium etli (strain CFN 42 / ATCC 51251) GN=obg PE=3 SV=1 8 118 2.0E-10
sp|Q1QQU0|OBG_NITHX GTPase Obg OS=Nitrobacter hamburgensis (strain X14 / DSM 10229) GN=obg PE=3 SV=1 8 118 2.0E-10
sp|B7JQ26|OBG_BACC0 GTPase Obg OS=Bacillus cereus (strain AH820) GN=obg PE=3 SV=1 7 147 2.0E-10
sp|Q81LF0|OBG_BACAN GTPase Obg OS=Bacillus anthracis GN=obg PE=3 SV=1 7 147 2.0E-10
sp|P95722|OBG_STRCO GTPase Obg OS=Streptomyces coelicolor (strain ATCC BAA-471 / A3(2) / M145) GN=obg PE=1 SV=1 7 147 2.0E-10
sp|Q5L6R9|OBG_CHLAB GTPase Obg OS=Chlamydophila abortus (strain DSM 27085 / S26/3) GN=obg PE=3 SV=1 7 147 2.0E-10
sp|A6LJZ0|OBG_THEM4 GTPase Obg OS=Thermosipho melanesiensis (strain DSM 12029 / CIP 104789 / BI429) GN=obg PE=3 SV=1 7 155 2.0E-10
sp|C3M9X9|OBG_RHISN GTPase Obg OS=Rhizobium sp. (strain NGR234) GN=obg PE=3 SV=1 8 118 2.0E-10
sp|Q6AFY1|OBG_LEIXX GTPase Obg OS=Leifsonia xyli subsp. xyli (strain CTCB07) GN=obg PE=3 SV=1 7 147 2.0E-10
sp|Q72HR4|OBG_THET2 GTPase Obg OS=Thermus thermophilus (strain HB27 / ATCC BAA-163 / DSM 7039) GN=obg PE=3 SV=1 7 154 2.0E-10
sp|A1WY48|OBG_HALHL GTPase Obg OS=Halorhodospira halophila (strain DSM 244 / SL1) GN=obg PE=3 SV=1 7 161 2.0E-10
sp|Q2SZG0|OBG_BURTA GTPase Obg OS=Burkholderia thailandensis (strain E264 / ATCC 700388 / DSM 13276 / CIP 106301) GN=obg PE=3 SV=1 7 162 2.0E-10
sp|B9JUH9|OBG_AGRVS GTPase Obg OS=Agrobacterium vitis (strain S4 / ATCC BAA-846) GN=obg PE=3 SV=1 8 118 2.0E-10
sp|Q66JG0|OLA1_XENTR Obg-like ATPase 1 OS=Xenopus tropicalis GN=ola1 PE=2 SV=1 7 144 2.0E-10
sp|B5YJ65|OBG_THEYD GTPase Obg OS=Thermodesulfovibrio yellowstonii (strain ATCC 51303 / DSM 11347 / YP87) GN=obg PE=3 SV=1 7 147 2.0E-10
sp|Q5SHE9|OBG_THET8 GTPase Obg OS=Thermus thermophilus (strain HB8 / ATCC 27634 / DSM 579) GN=obg PE=1 SV=1 7 154 2.0E-10
sp|B1Y280|OBG_LEPCP GTPase Obg OS=Leptothrix cholodnii (strain ATCC 51168 / LMG 8142 / SP-6) GN=obg PE=3 SV=1 7 167 2.0E-10
sp|B3PRZ3|OBG_RHIE6 GTPase Obg OS=Rhizobium etli (strain CIAT 652) GN=obg PE=3 SV=1 8 118 2.0E-10
sp|A4SVA3|OBG_POLSQ GTPase Obg OS=Polynucleobacter necessarius subsp. asymbioticus (strain DSM 18221 / CIP 109841 / QLW-P1DMWA-1) GN=obg PE=3 SV=1 7 116 2.0E-10
sp|A9VIR5|OBG_BACWK GTPase Obg OS=Bacillus weihenstephanensis (strain KBAB4) GN=obg PE=3 SV=1 7 147 2.0E-10
sp|B1XT35|OBG_POLNS GTPase Obg OS=Polynucleobacter necessarius subsp. necessarius (strain STIR1) GN=obg PE=3 SV=1 7 144 2.0E-10
sp|Q0AWJ4|OBG_SYNWW GTPase Obg OS=Syntrophomonas wolfei subsp. wolfei (strain DSM 2245B / Goettingen) GN=obg PE=3 SV=1 7 120 2.0E-10
sp|Q8EPQ0|OBG_OCEIH GTPase Obg OS=Oceanobacillus iheyensis (strain DSM 14371 / JCM 11309 / KCTC 3954 / HTE831) GN=obg PE=3 SV=1 7 147 2.0E-10
sp|Q1MA76|OBG_RHIL3 GTPase Obg OS=Rhizobium leguminosarum bv. viciae (strain 3841) GN=obg PE=3 SV=1 8 118 2.0E-10
sp|B8H9P2|OBG_ARTCA GTPase Obg OS=Arthrobacter chlorophenolicus (strain ATCC 700700 / DSM 12829 / JCM 12360 / NCIMB 13794 / A6) GN=obg PE=3 SV=1 7 147 3.0E-10
sp|Q824F3|OBG_CHLCV GTPase Obg OS=Chlamydophila caviae (strain GPIC) GN=obg PE=3 SV=1 7 147 3.0E-10
sp|B7IIV2|OBG_BACC2 GTPase Obg OS=Bacillus cereus (strain G9842) GN=obg PE=3 SV=1 7 147 3.0E-10
sp|Q9KDK0|OBG_BACHD GTPase Obg OS=Bacillus halodurans (strain ATCC BAA-125 / DSM 18197 / FERM 7344 / JCM 9153 / C-125) GN=obg PE=3 SV=1 8 147 3.0E-10
sp|Q29K06|GTPBA_DROPS GTP-binding protein 10 homolog OS=Drosophila pseudoobscura pseudoobscura GN=GA10450 PE=3 SV=1 7 135 3.0E-10
sp|A2SD36|OBG_METPP GTPase Obg OS=Methylibium petroleiphilum (strain PM1) GN=obg PE=3 SV=1 7 135 3.0E-10
sp|Q2YT86|OBG_STAAB GTPase Obg OS=Staphylococcus aureus (strain bovine RF122 / ET3-1) GN=obg PE=3 SV=1 7 147 3.0E-10
sp|Q2IH84|OBG_ANADE GTPase Obg OS=Anaeromyxobacter dehalogenans (strain 2CP-C) GN=obg PE=3 SV=1 7 147 3.0E-10
sp|Q4L6Y9|OBG_STAHJ GTPase Obg OS=Staphylococcus haemolyticus (strain JCSC1435) GN=obg PE=3 SV=1 7 147 3.0E-10
sp|B1YSU7|OBG_BURA4 GTPase Obg OS=Burkholderia ambifaria (strain MC40-6) GN=obg PE=3 SV=1 7 161 4.0E-10
sp|A1AT81|OBG_PELPD GTPase Obg OS=Pelobacter propionicus (strain DSM 2379) GN=obg PE=3 SV=1 7 118 4.0E-10
sp|A4JBB8|OBG_BURVG GTPase Obg OS=Burkholderia vietnamiensis (strain G4 / LMG 22486) GN=obg PE=3 SV=1 7 161 4.0E-10
sp|A8ZRY1|OBG_DESOH GTPase Obg OS=Desulfococcus oleovorans (strain DSM 6200 / Hxd3) GN=obg PE=3 SV=1 7 118 4.0E-10
sp|A8LK09|OBG_DINSH GTPase Obg OS=Dinoroseobacter shibae (strain DSM 16493 / NCIMB 14021 / DFL 12) GN=obg PE=3 SV=1 8 118 4.0E-10
sp|A3NDS7|OBG_BURP6 GTPase Obg OS=Burkholderia pseudomallei (strain 668) GN=obg PE=3 SV=1 7 162 4.0E-10
sp|Q63QM0|OBG_BURPS GTPase Obg OS=Burkholderia pseudomallei (strain K96243) GN=obg PE=3 SV=1 7 162 4.0E-10
sp|Q3JNG0|OBG_BURP1 GTPase Obg OS=Burkholderia pseudomallei (strain 1710b) GN=obg PE=3 SV=1 7 162 4.0E-10
sp|A3NZJ0|OBG_BURP0 GTPase Obg OS=Burkholderia pseudomallei (strain 1106a) GN=obg PE=3 SV=1 7 162 4.0E-10
sp|A1V0P1|OBG_BURMS GTPase Obg OS=Burkholderia mallei (strain SAVP1) GN=obg PE=3 SV=1 7 162 4.0E-10
sp|Q62GV4|OBG_BURMA GTPase Obg OS=Burkholderia mallei (strain ATCC 23344) GN=obg PE=3 SV=1 7 162 4.0E-10
sp|A2S5R8|OBG_BURM9 GTPase Obg OS=Burkholderia mallei (strain NCTC 10229) GN=obg PE=3 SV=1 7 162 4.0E-10
sp|A3MR90|OBG_BURM7 GTPase Obg OS=Burkholderia mallei (strain NCTC 10247) GN=obg PE=3 SV=1 7 162 4.0E-10
sp|Q47MV6|OBG_THEFY GTPase Obg OS=Thermobifida fusca (strain YX) GN=obg PE=3 SV=1 7 147 4.0E-10
sp|B8JBP2|OBG_ANAD2 GTPase Obg OS=Anaeromyxobacter dehalogenans (strain 2CP-1 / ATCC BAA-258) GN=obg PE=3 SV=1 7 159 4.0E-10
sp|Q03JJ8|OBG_STRTD GTPase Obg OS=Streptococcus thermophilus (strain ATCC BAA-491 / LMD-9) GN=obg PE=3 SV=1 7 147 4.0E-10
sp|Q5M3C8|OBG_STRT2 GTPase Obg OS=Streptococcus thermophilus (strain ATCC BAA-250 / LMG 18311) GN=obg PE=3 SV=1 7 147 4.0E-10
sp|Q5LYR4|OBG_STRT1 GTPase Obg OS=Streptococcus thermophilus (strain CNRZ 1066) GN=obg PE=3 SV=1 7 147 4.0E-10
sp|A9BK05|OBG_PETMO GTPase Obg OS=Petrotoga mobilis (strain DSM 10674 / SJ95) GN=obg PE=3 SV=1 7 181 4.0E-10
sp|B7GIR2|OBG_ANOFW GTPase Obg OS=Anoxybacillus flavithermus (strain DSM 21510 / WK1) GN=obg PE=3 SV=1 7 147 4.0E-10
sp|A9FJF8|OBG_SORC5 GTPase Obg OS=Sorangium cellulosum (strain So ce56) GN=obg PE=3 SV=1 7 147 5.0E-10
sp|B2V968|OBG_SULSY GTPase Obg OS=Sulfurihydrogenibium sp. (strain YO3AOP1) GN=obg PE=3 SV=1 7 118 5.0E-10
sp|B4UIU2|OBG_ANASK GTPase Obg OS=Anaeromyxobacter sp. (strain K) GN=obg PE=3 SV=1 7 147 5.0E-10
sp|B7GNK1|OBG_BIFLS GTPase Obg OS=Bifidobacterium longum subsp. infantis (strain ATCC 15697 / DSM 20088 / JCM 1222 / NCTC 11817 / S12) GN=obg PE=3 SV=1 7 147 5.0E-10
sp|Q39JU7|OBG_BURL3 GTPase Obg OS=Burkholderia lata (strain ATCC 17760 / LMG 22485 / NCIMB 9086 / R18194 / 383) GN=obg PE=3 SV=1 7 175 5.0E-10
sp|B8IEL9|OBG_METNO GTPase Obg OS=Methylobacterium nodulans (strain ORS2060 / LMG 21967) GN=obg PE=3 SV=1 8 118 5.0E-10
sp|Q8G4U0|OBG_BIFLO GTPase Obg OS=Bifidobacterium longum (strain NCC 2705) GN=obg PE=3 SV=1 7 147 5.0E-10
sp|Q6GG60|OBG_STAAR GTPase Obg OS=Staphylococcus aureus (strain MRSA252) GN=obg PE=3 SV=1 7 147 5.0E-10
sp|Q2VZU2|OBG_MAGSA GTPase Obg OS=Magnetospirillum magneticum (strain AMB-1 / ATCC 700264) GN=obg PE=3 SV=1 8 118 6.0E-10
sp|B2V0A8|OBG_CLOBA GTPase Obg OS=Clostridium botulinum (strain Alaska E43 / Type E3) GN=obg PE=3 SV=1 7 147 6.0E-10
sp|Q7A0Q3|OBG_STAAW GTPase Obg OS=Staphylococcus aureus (strain MW2) GN=obg PE=3 SV=1 7 147 6.0E-10
sp|A8Z2H2|OBG_STAAT GTPase Obg OS=Staphylococcus aureus (strain USA300 / TCH1516) GN=obg PE=3 SV=1 7 147 6.0E-10
sp|Q6G8S5|OBG_STAAS GTPase Obg OS=Staphylococcus aureus (strain MSSA476) GN=obg PE=3 SV=1 7 147 6.0E-10
sp|Q7A584|OBG_STAAN GTPase Obg OS=Staphylococcus aureus (strain N315) GN=obg PE=1 SV=1 7 147 6.0E-10
sp|Q99TK9|OBG_STAAM GTPase Obg OS=Staphylococcus aureus (strain Mu50 / ATCC 700699) GN=obg PE=3 SV=1 7 147 6.0E-10
sp|A6QHI6|OBG_STAAE GTPase Obg OS=Staphylococcus aureus (strain Newman) GN=obg PE=3 SV=1 7 147 6.0E-10
sp|A5ITG8|OBG_STAA9 GTPase Obg OS=Staphylococcus aureus (strain JH9) GN=obg PE=3 SV=1 7 147 6.0E-10
sp|Q2FXT1|OBG_STAA8 GTPase Obg OS=Staphylococcus aureus (strain NCTC 8325) GN=obg PE=3 SV=1 7 147 6.0E-10
sp|Q2FG83|OBG_STAA3 GTPase Obg OS=Staphylococcus aureus (strain USA300) GN=obg PE=3 SV=1 7 147 6.0E-10
sp|A6U2B2|OBG_STAA2 GTPase Obg OS=Staphylococcus aureus (strain JH1) GN=obg PE=3 SV=1 7 147 6.0E-10
sp|A7X361|OBG_STAA1 GTPase Obg OS=Staphylococcus aureus (strain Mu3 / ATCC 700698) GN=obg PE=3 SV=1 7 147 6.0E-10
sp|B5YEQ1|OBG_DICT6 GTPase Obg OS=Dictyoglomus thermophilum (strain ATCC 35947 / DSM 3960 / H-6-12) GN=obg PE=3 SV=1 7 121 6.0E-10
sp|Q5HFB9|OBG_STAAC GTPase Obg OS=Staphylococcus aureus (strain COL) GN=obg PE=3 SV=1 7 147 6.0E-10
sp|B2TK70|OBG_CLOBB GTPase Obg OS=Clostridium botulinum (strain Eklund 17B / Type B) GN=obg PE=3 SV=1 7 147 6.0E-10
sp|B8E0B2|OBG_DICTD GTPase Obg OS=Dictyoglomus turgidum (strain Z-1310 / DSM 6724) GN=obg PE=3 SV=1 7 122 6.0E-10
sp|B9L605|OBG_NAUPA GTPase Obg OS=Nautilia profundicola (strain ATCC BAA-1463 / DSM 18972 / AmH) GN=obg PE=3 SV=1 7 122 6.0E-10
sp|Q9I7M2|GTPBA_DROME GTP-binding protein 10 homolog OS=Drosophila melanogaster GN=CG10628 PE=2 SV=2 7 135 6.0E-10
sp|Q253F8|OBG_CHLFF GTPase Obg OS=Chlamydophila felis (strain Fe/C-56) GN=obg PE=3 SV=1 7 119 7.0E-10
sp|A6LQR9|OBG_CLOB8 GTPase Obg OS=Clostridium beijerinckii (strain ATCC 51743 / NCIMB 8052) GN=obg PE=3 SV=1 7 147 7.0E-10
sp|Q0BIH8|OBG_BURCM GTPase Obg OS=Burkholderia ambifaria (strain ATCC BAA-244 / AMMD) GN=obg PE=3 SV=1 7 161 7.0E-10
sp|A5GD29|OBG_GEOUR GTPase Obg OS=Geobacter uraniireducens (strain Rf4) GN=obg PE=3 SV=1 7 122 7.0E-10
sp|Q48SX8|OBG_STRPM GTPase Obg OS=Streptococcus pyogenes serotype M28 (strain MGAS6180) GN=obg PE=3 SV=1 7 147 7.0E-10
sp|B2IQ29|OBG_STRPS GTPase Obg OS=Streptococcus pneumoniae (strain CGSP14) GN=obg PE=3 SV=1 7 147 7.0E-10
sp|P0DB53|OBG_STRPQ GTPase Obg OS=Streptococcus pyogenes serotype M3 (strain SSI-1) GN=obg PE=3 SV=1 7 147 7.0E-10
sp|P0DB52|OBG_STRP3 GTPase Obg OS=Streptococcus pyogenes serotype M3 (strain ATCC BAA-595 / MGAS315) GN=obg PE=3 SV=1 7 147 7.0E-10
sp|Q8DPV8|OBG_STRR6 GTPase Obg OS=Streptococcus pneumoniae (strain ATCC BAA-255 / R6) GN=obg PE=3 SV=1 7 147 7.0E-10
sp|Q04KK7|OBG_STRP2 GTPase Obg OS=Streptococcus pneumoniae serotype 2 (strain D39 / NCTC 7466) GN=obg PE=3 SV=1 7 147 7.0E-10
sp|Q8P0I6|OBG_STRP8 GTPase Obg OS=Streptococcus pyogenes serotype M18 (strain MGAS8232) GN=obg PE=3 SV=1 7 147 8.0E-10
sp|Q5XBM1|OBG_STRP6 GTPase Obg OS=Streptococcus pyogenes serotype M6 (strain ATCC BAA-946 / MGAS10394) GN=obg PE=3 SV=1 7 147 8.0E-10
sp|B4RD64|OBG_PHEZH GTPase Obg OS=Phenylobacterium zucineum (strain HLK1) GN=obg PE=3 SV=1 7 118 8.0E-10
sp|Q97QW8|OBG_STRPN GTPase Obg OS=Streptococcus pneumoniae serotype 4 (strain ATCC BAA-334 / TIGR4) GN=obg PE=3 SV=1 7 147 8.0E-10
sp|B5E4J4|OBG_STRP4 GTPase Obg OS=Streptococcus pneumoniae serotype 19F (strain G54) GN=obg PE=3 SV=1 7 147 8.0E-10
sp|B8ZPS8|OBG_STRPJ GTPase Obg OS=Streptococcus pneumoniae (strain ATCC 700669 / Spain 23F-1) GN=obg PE=3 SV=1 7 147 8.0E-10
sp|Q1JGD5|OBG_STRPD GTPase Obg OS=Streptococcus pyogenes serotype M2 (strain MGAS10270) GN=obg PE=3 SV=1 7 147 8.0E-10
sp|Q2RV04|OBG_RHORT GTPase Obg OS=Rhodospirillum rubrum (strain ATCC 11170 / ATH 1.1.1 / DSM 467 / LMG 4362 / NCIB 8255 / S1) GN=obg PE=3 SV=1 8 118 8.0E-10
sp|Q1JLA1|OBG_STRPC GTPase Obg OS=Streptococcus pyogenes serotype M12 (strain MGAS9429) GN=obg PE=3 SV=1 7 147 8.0E-10
sp|Q1JBB7|OBG_STRPB GTPase Obg OS=Streptococcus pyogenes serotype M12 (strain MGAS2096) GN=obg PE=3 SV=1 7 147 8.0E-10
sp|A1SMB4|OBG_NOCSJ GTPase Obg OS=Nocardioides sp. (strain BAA-499 / JS614) GN=obg PE=3 SV=1 7 118 8.0E-10
sp|B5XLZ0|OBG_STRPZ GTPase Obg OS=Streptococcus pyogenes serotype M49 (strain NZ131) GN=obg PE=3 SV=1 7 147 8.0E-10
sp|B1IBL9|OBG_STRPI GTPase Obg OS=Streptococcus pneumoniae (strain Hungary19A-6) GN=obg PE=3 SV=1 7 147 8.0E-10
sp|A8AWM9|OBG_STRGC GTPase Obg OS=Streptococcus gordonii (strain Challis / ATCC 35105 / CH1 / DL1 / V288) GN=obg PE=3 SV=1 7 147 8.0E-10
sp|B9M3W3|OBG_GEODF GTPase Obg OS=Geobacter daltonii (strain DSM 22248 / JCM 15807 / FRC-32) GN=obg PE=3 SV=1 7 199 8.0E-10
sp|A2RE30|OBG_STRPG GTPase Obg OS=Streptococcus pyogenes serotype M5 (strain Manfredo) GN=obg PE=3 SV=1 7 147 9.0E-10
sp|Q1J652|OBG_STRPF GTPase Obg OS=Streptococcus pyogenes serotype M4 (strain MGAS10750) GN=obg PE=3 SV=1 7 147 9.0E-10
sp|Q99Z94|OBG_STRP1 GTPase Obg OS=Streptococcus pyogenes serotype M1 GN=obg PE=3 SV=1 7 147 9.0E-10
sp|A7Z781|OBG_BACMF GTPase Obg OS=Bacillus methylotrophicus (strain DSM 23117 / BGSC 10A6 / FZB42) GN=obg PE=3 SV=1 7 147 9.0E-10
sp|Q8DUU2|OBG_STRMU GTPase Obg OS=Streptococcus mutans serotype c (strain ATCC 700610 / UA159) GN=obg PE=3 SV=1 7 155 9.0E-10
sp|A9AI60|OBG_BURM1 GTPase Obg OS=Burkholderia multivorans (strain ATCC 17616 / 249) GN=obg PE=3 SV=1 7 191 9.0E-10
sp|B7IGK8|OBG_THEAB GTPase Obg OS=Thermosipho africanus (strain TCF52B) GN=obg PE=3 SV=1 7 155 9.0E-10
sp|A0K4B0|OBG_BURCH GTPase Obg OS=Burkholderia cenocepacia (strain HI2424) GN=obg PE=3 SV=1 7 116 9.0E-10
sp|B1JVA1|OBG_BURCC GTPase Obg OS=Burkholderia cenocepacia (strain MC0-3) GN=obg PE=3 SV=1 7 116 9.0E-10
sp|B4E5X0|OBG_BURCJ GTPase Obg OS=Burkholderia cenocepacia (strain ATCC BAA-245 / DSM 16553 / LMG 16656 / NCTC 13227 / J2315 / CF5610) GN=obg PE=3 SV=1 7 116 1.0E-09
sp|Q1BZE0|OBG_BURCA GTPase Obg OS=Burkholderia cenocepacia (strain AU 1054) GN=obg PE=3 SV=1 7 116 1.0E-09
sp|A1B9C8|OBG_PARDP GTPase Obg OS=Paracoccus denitrificans (strain Pd 1222) GN=obg PE=3 SV=1 8 135 1.0E-09
sp|A4W0M2|OBG_STRS2 GTPase Obg OS=Streptococcus suis (strain 98HAH33) GN=obg PE=3 SV=1 7 147 1.0E-09
sp|A4VUC8|OBG_STRSY GTPase Obg OS=Streptococcus suis (strain 05ZYH33) GN=obg PE=3 SV=1 7 147 1.0E-09
sp|A9NBL5|OBG_COXBR GTPase Obg OS=Coxiella burnetii (strain RSA 331 / Henzerling II) GN=obg PE=3 SV=1 7 156 1.0E-09
sp|Q5WHS8|OBG_BACSK GTPase Obg OS=Bacillus clausii (strain KSM-K16) GN=obg PE=3 SV=1 7 147 1.0E-09
sp|C0QLE9|OBG_DESAH GTPase Obg OS=Desulfobacterium autotrophicum (strain ATCC 43914 / DSM 3382 / HRM2) GN=obg PE=3 SV=1 7 118 1.0E-09
sp|Q83ED8|OBG_COXBU GTPase Obg OS=Coxiella burnetii (strain RSA 493 / Nine Mile phase I) GN=obg PE=3 SV=1 7 156 1.0E-09
sp|A9KEJ7|OBG_COXBN GTPase Obg OS=Coxiella burnetii (strain Dugway 5J108-111) GN=obg PE=3 SV=1 7 156 1.0E-09
sp|B6J1S8|OBG_COXB2 GTPase Obg OS=Coxiella burnetii (strain CbuG_Q212) GN=obg PE=3 SV=1 7 156 1.0E-09
sp|A1KAD0|OBG_AZOSB GTPase Obg OS=Azoarcus sp. (strain BH72) GN=obg PE=3 SV=1 7 136 1.0E-09
sp|B1H0I4|OBG_UNCTG GTPase Obg OS=Uncultured termite group 1 bacterium phylotype Rs-D17 GN=obg PE=3 SV=1 7 147 1.0E-09
sp|A6UDV6|OBG_SINMW GTPase Obg OS=Sinorhizobium medicae (strain WSM419) GN=obg PE=3 SV=1 8 118 1.0E-09
sp|B1YJR9|OBG_EXIS2 GTPase Obg OS=Exiguobacterium sibiricum (strain DSM 17290 / JCM 13490 / 255-15) GN=obg PE=3 SV=1 7 147 1.0E-09
sp|Q9CBZ4|OBG_MYCLE GTPase Obg OS=Mycobacterium leprae (strain TN) GN=obg PE=3 SV=1 7 137 1.0E-09
sp|B8ZRN3|OBG_MYCLB GTPase Obg OS=Mycobacterium leprae (strain Br4923) GN=obg PE=3 SV=1 7 137 1.0E-09
sp|B6J9K2|OBG_COXB1 GTPase Obg OS=Coxiella burnetii (strain CbuK_Q154) GN=obg PE=3 SV=1 7 156 1.0E-09
sp|B8EQH4|OBG_METSB GTPase Obg OS=Methylocella silvestris (strain BL2 / DSM 15510 / NCIMB 13906) GN=obg PE=3 SV=1 8 117 1.0E-09
sp|Q92LB4|OBG_RHIME GTPase Obg OS=Rhizobium meliloti (strain 1021) GN=obg PE=3 SV=2 8 118 1.0E-09
sp|Q28Q12|OBG_JANSC GTPase Obg OS=Jannaschia sp. (strain CCS1) GN=obg PE=3 SV=2 7 118 1.0E-09
sp|B0T310|OBG_CAUSK GTPase Obg OS=Caulobacter sp. (strain K31) GN=obg PE=3 SV=1 7 118 1.0E-09
sp|B9DSH7|OBG_STRU0 GTPase Obg OS=Streptococcus uberis (strain ATCC BAA-854 / 0140J) GN=obg PE=3 SV=1 7 155 1.0E-09
sp|A3CM33|OBG_STRSV GTPase Obg OS=Streptococcus sanguinis (strain SK36) GN=obg PE=3 SV=1 7 147 1.0E-09
sp|Q18B27|OBG_PEPD6 GTPase Obg OS=Peptoclostridium difficile (strain 630) GN=obg PE=3 SV=1 7 159 1.0E-09
sp|Q2G983|OBG_NOVAD GTPase Obg OS=Novosphingobium aromaticivorans (strain DSM 12444 / F199) GN=obg PE=3 SV=2 8 122 1.0E-09
sp|Q0AKX2|OBG_MARMM GTPase Obg OS=Maricaulis maris (strain MCS10) GN=obg PE=3 SV=1 7 118 1.0E-09
sp|B1ZZ37|OBG_OPITP GTPase Obg OS=Opitutus terrae (strain DSM 11246 / PB90-1) GN=obg PE=3 SV=1 7 172 1.0E-09
sp|A7HIF8|OBG_ANADF GTPase Obg OS=Anaeromyxobacter sp. (strain Fw109-5) GN=obg PE=3 SV=1 7 147 2.0E-09
sp|Q8CNZ7|OBG_STAES GTPase Obg OS=Staphylococcus epidermidis (strain ATCC 12228) GN=obg PE=3 SV=1 7 181 2.0E-09
sp|Q5HNQ7|OBG_STAEQ GTPase Obg OS=Staphylococcus epidermidis (strain ATCC 35984 / RP62A) GN=obg PE=3 SV=1 7 181 2.0E-09
sp|Q6DHF7|GTPBA_DANRE GTP-binding protein 10 OS=Danio rerio GN=gtpbp10 PE=2 SV=1 7 119 2.0E-09
sp|B2UCV3|OBG_RALPJ GTPase Obg OS=Ralstonia pickettii (strain 12J) GN=obg PE=3 SV=1 7 116 2.0E-09
sp|O14078|YEAD_SCHPO Obg-like ATPase homolog OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC2E11.13c PE=3 SV=1 7 145 2.0E-09
sp|Q5GTG3|OBG_WOLTR GTPase Obg OS=Wolbachia sp. subsp. Brugia malayi (strain TRS) GN=obg PE=3 SV=1 7 118 2.0E-09
sp|A5EVP4|OBG_DICNV GTPase Obg OS=Dichelobacter nodosus (strain VCS1703A) GN=obg PE=3 SV=1 7 208 2.0E-09
sp|Q3A1D8|OBG_PELCD GTPase Obg OS=Pelobacter carbinolicus (strain DSM 2380 / Gra Bd 1) GN=obg PE=3 SV=1 7 118 2.0E-09
sp|A6GZB7|OBG_FLAPJ GTPase Obg OS=Flavobacterium psychrophilum (strain JIP02/86 / ATCC 49511) GN=obg PE=3 SV=1 7 135 2.0E-09
sp|B3DPS4|OBG_BIFLD GTPase Obg OS=Bifidobacterium longum (strain DJO10A) GN=obg PE=3 SV=1 7 147 2.0E-09
sp|A1W4B0|OBG_ACISJ GTPase Obg OS=Acidovorax sp. (strain JS42) GN=obg PE=3 SV=2 7 118 2.0E-09
sp|B3DVG9|OBG_METI4 GTPase Obg OS=Methylacidiphilum infernorum (isolate V4) GN=obg PE=3 SV=2 7 147 2.0E-09
sp|Q1GZ53|OBG_METFK GTPase Obg OS=Methylobacillus flagellatus (strain KT / ATCC 51484 / DSM 6875) GN=obg PE=3 SV=1 7 116 2.0E-09
sp|A4WZ45|OBG_RHOS5 GTPase Obg OS=Rhodobacter sphaeroides (strain ATCC 17025 / ATH 2.4.3) GN=obg PE=3 SV=2 8 120 2.0E-09
sp|P0CB41|OBG_CAUCR GTPase Obg OS=Caulobacter crescentus (strain ATCC 19089 / CB15) GN=obg PE=3 SV=1 7 118 2.0E-09
sp|B8GYI7|OBG_CAUCN GTPase Obg/CgtA OS=Caulobacter crescentus (strain NA1000 / CB15N) GN=cgtA PE=1 SV=1 7 118 2.0E-09
sp|B0TBW1|OBG_HELMI GTPase Obg OS=Heliobacterium modesticaldum (strain ATCC 51547 / Ice1) GN=obg PE=3 SV=1 7 147 2.0E-09
sp|Q2Y807|OBG_NITMU GTPase Obg OS=Nitrosospira multiformis (strain ATCC 25196 / NCIMB 11849) GN=obg PE=3 SV=1 7 116 2.0E-09
sp|B9KW04|OBG_RHOSK GTPase Obg OS=Rhodobacter sphaeroides (strain KD131 / KCTC 12085) GN=obg PE=3 SV=1 8 120 2.0E-09
sp|Q3IXX9|OBG_RHOS4 GTPase Obg OS=Rhodobacter sphaeroides (strain ATCC 17023 / 2.4.1 / NCIB 8253 / DSM 158) GN=obg PE=3 SV=1 8 120 2.0E-09
sp|A3PQJ0|OBG_RHOS1 GTPase Obg OS=Rhodobacter sphaeroides (strain ATCC 17029 / ATH 2.4.9) GN=obg PE=3 SV=1 8 120 2.0E-09
sp|Q3AF51|OBG_CARHZ GTPase Obg OS=Carboxydothermus hydrogenoformans (strain ATCC BAA-161 / DSM 6008 / Z-2901) GN=obg PE=3 SV=1 7 147 2.0E-09
sp|Q2QZ37|OBGM_ORYSJ Probable GTP-binding protein OBGM, mitochondrial OS=Oryza sativa subsp. japonica GN=OBGM PE=2 SV=1 7 123 2.0E-09
sp|Q7UVH6|OBG_RHOBA GTPase Obg OS=Rhodopirellula baltica (strain DSM 10527 / NCIMB 13988 / SH1) GN=obg PE=3 SV=2 7 147 3.0E-09
sp|Q0SR54|OBG_CLOPS GTPase Obg OS=Clostridium perfringens (strain SM101 / Type A) GN=obg PE=3 SV=1 7 119 3.0E-09
sp|Q8XIJ2|OBG_CLOPE GTPase Obg OS=Clostridium perfringens (strain 13 / Type A) GN=obg PE=3 SV=1 7 119 3.0E-09
sp|Q0TNI5|OBG_CLOP1 GTPase Obg OS=Clostridium perfringens (strain ATCC 13124 / DSM 756 / JCM 1290 / NCIMB 6125 / NCTC 8237 / Type A) GN=obg PE=3 SV=1 7 119 3.0E-09
sp|Q8DYL0|OBG_STRA5 GTPase Obg OS=Streptococcus agalactiae serotype V (strain ATCC BAA-611 / 2603 V/R) GN=obg PE=3 SV=1 7 147 3.0E-09
sp|Q8E465|OBG_STRA3 GTPase Obg OS=Streptococcus agalactiae serotype III (strain NEM316) GN=obg PE=3 SV=1 7 147 3.0E-09
sp|Q3K046|OBG_STRA1 GTPase Obg OS=Streptococcus agalactiae serotype Ia (strain ATCC 27591 / A909 / CDC SS700) GN=obg PE=3 SV=1 7 147 3.0E-09
sp|Q03F34|OBG_PEDPA GTPase Obg OS=Pediococcus pentosaceus (strain ATCC 25745 / 183-1w) GN=obg PE=3 SV=1 7 135 3.0E-09
sp|A4SR17|OBG_AERS4 GTPase Obg OS=Aeromonas salmonicida (strain A449) GN=obg PE=3 SV=1 7 128 3.0E-09
sp|Q8XVL0|OBG_RALSO GTPase Obg OS=Ralstonia solanacearum (strain GMI1000) GN=obg PE=3 SV=1 7 116 3.0E-09
sp|Q2GK25|OBG_ANAPZ GTPase Obg OS=Anaplasma phagocytophilum (strain HZ) GN=obg PE=3 SV=1 7 118 3.0E-09
sp|B9K736|OBG_THENN GTPase Obg OS=Thermotoga neapolitana (strain ATCC 49049 / DSM 4359 / NS-E) GN=obg PE=3 SV=1 7 155 3.0E-09
sp|A6WXS0|OBG_OCHA4 GTPase Obg OS=Ochrobactrum anthropi (strain ATCC 49188 / DSM 6882 / NCTC 12168) GN=obg PE=3 SV=1 8 118 3.0E-09
sp|B9MDZ7|OBG_ACIET GTPase Obg OS=Acidovorax ebreus (strain TPSY) GN=obg PE=3 SV=1 7 116 3.0E-09
sp|Q8FYM2|OBG_BRUSU GTPase Obg OS=Brucella suis biovar 1 (strain 1330) GN=obg PE=3 SV=1 8 118 3.0E-09
sp|A9WWW9|OBG_BRUSI GTPase Obg OS=Brucella suis (strain ATCC 23445 / NCTC 10510) GN=obg PE=3 SV=1 8 118 3.0E-09
sp|A5VSI5|OBG_BRUO2 GTPase Obg OS=Brucella ovis (strain ATCC 25840 / 63/290 / NCTC 10512) GN=obg PE=3 SV=2 8 118 3.0E-09
sp|Q8YJ80|OBG_BRUME GTPase Obg OS=Brucella melitensis biotype 1 (strain 16M / ATCC 23456 / NCTC 10094) GN=obg PE=3 SV=2 8 118 3.0E-09
sp|A9M882|OBG_BRUC2 GTPase Obg OS=Brucella canis (strain ATCC 23365 / NCTC 10854) GN=obg PE=3 SV=1 8 118 3.0E-09
sp|Q57B45|OBG_BRUAB GTPase Obg OS=Brucella abortus biovar 1 (strain 9-941) GN=obg PE=3 SV=1 8 118 3.0E-09
sp|Q2YLM2|OBG_BRUA2 GTPase Obg OS=Brucella abortus (strain 2308) GN=obg PE=3 SV=1 8 118 3.0E-09
sp|B2S806|OBG_BRUA1 GTPase Obg OS=Brucella abortus (strain S19) GN=obg PE=3 SV=1 8 118 3.0E-09
sp|A1TTD3|OBG_ACIAC GTPase Obg OS=Acidovorax citrulli (strain AAC00-1) GN=obg PE=3 SV=1 7 116 3.0E-09
sp|Q5PAA7|OBG2_ANAMM GTPase Obg 2 OS=Anaplasma marginale (strain St. Maries) GN=obg2 PE=3 SV=1 7 118 3.0E-09
sp|Q7NZS1|OBG_CHRVO GTPase Obg OS=Chromobacterium violaceum (strain ATCC 12472 / DSM 30191 / JCM 1249 / NBRC 12614 / NCIMB 9131 / NCTC 9757) GN=obg PE=3 SV=1 7 136 3.0E-09
sp|Q21YZ9|OBG_RHOFT GTPase Obg OS=Rhodoferax ferrireducens (strain ATCC BAA-621 / DSM 15236 / T118) GN=obg PE=3 SV=1 7 135 3.0E-09
sp|B9KJ19|OBG2_ANAMF GTPase Obg 2 OS=Anaplasma marginale (strain Florida) GN=obg2 PE=3 SV=1 7 118 3.0E-09
sp|Q3SKG2|OBG_THIDA GTPase Obg OS=Thiobacillus denitrificans (strain ATCC 25259) GN=obg PE=3 SV=1 7 118 3.0E-09
sp|A4IRC7|OBG_GEOTN GTPase Obg OS=Geobacillus thermodenitrificans (strain NG80-2) GN=obg PE=3 SV=1 7 225 3.0E-09
sp|Q5KWP5|OBG_GEOKA GTPase Obg OS=Geobacillus kaustophilus (strain HTA426) GN=obg PE=3 SV=1 7 147 4.0E-09
sp|Q7VZX6|OBG_BORPE GTPase Obg OS=Bordetella pertussis (strain Tohama I / ATCC BAA-589 / NCTC 13251) GN=obg PE=3 SV=1 7 135 4.0E-09
sp|Q7W1P2|OBG_BORPA GTPase Obg OS=Bordetella parapertussis (strain 12822 / ATCC BAA-587 / NCTC 13253) GN=obg PE=3 SV=1 7 135 4.0E-09
sp|Q7WQL8|OBG_BORBR GTPase Obg OS=Bordetella bronchiseptica (strain ATCC BAA-588 / NCTC 13252 / RB50) GN=obg PE=3 SV=1 7 135 4.0E-09
sp|B3QVU6|OBG_CHLT3 GTPase Obg OS=Chloroherpeton thalassium (strain ATCC 35110 / GB-78) GN=obg PE=3 SV=1 7 135 4.0E-09
sp|B9E021|OBG_CLOK1 GTPase Obg OS=Clostridium kluyveri (strain NBRC 12016) GN=obg PE=3 SV=2 7 153 4.0E-09
sp|A0KGS9|OBG_AERHH GTPase Obg OS=Aeromonas hydrophila subsp. hydrophila (strain ATCC 7966 / DSM 30187 / JCM 1027 / KCTC 2358 / NCIMB 9240) GN=obg PE=3 SV=1 7 116 4.0E-09
sp|Q5PAS5|OBG1_ANAMM GTPase Obg 1 OS=Anaplasma marginale (strain St. Maries) GN=obg1 PE=3 SV=1 7 118 4.0E-09
sp|B9KIJ7|OBG1_ANAMF GTPase Obg 1 OS=Anaplasma marginale (strain Florida) GN=obg1 PE=3 SV=1 7 118 4.0E-09
sp|Q9UT06|YLWB_SCHPO Uncharacterized GTP-binding protein P8A3.11c, mitochondrial OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAP8A3.11c PE=3 SV=1 7 116 4.0E-09
sp|B8DVU1|OBG_BIFA0 GTPase Obg OS=Bifidobacterium animalis subsp. lactis (strain AD011) GN=obg PE=3 SV=1 7 144 4.0E-09
sp|A0LCZ3|OBG_MAGMM GTPase Obg OS=Magnetococcus marinus (strain ATCC BAA-1437 / JCM 17883 / MC-1) GN=obg PE=3 SV=1 7 116 4.0E-09
sp|Q65ZZ3|OBG_BORBP GTPase Obg OS=Borrelia bavariensis (strain ATCC BAA-2496 / DSM 23469 / PBi) GN=obg PE=3 SV=1 7 118 5.0E-09
sp|Q11CP6|OBG_CHESB GTPase Obg OS=Chelativorans sp. (strain BNC1) GN=obg PE=3 SV=1 8 117 5.0E-09
sp|A5FMX0|OBG_FLAJ1 GTPase Obg OS=Flavobacterium johnsoniae (strain ATCC 17061 / DSM 2064 / UW101) GN=obg PE=3 SV=1 7 135 5.0E-09
sp|A4VI54|OBG_PSEU5 GTPase Obg OS=Pseudomonas stutzeri (strain A1501) GN=obg PE=3 SV=1 7 118 5.0E-09
sp|Q0I1P5|OBG_HAES1 GTPase Obg OS=Haemophilus somnus (strain 129Pt) GN=obg PE=3 SV=1 7 147 5.0E-09
sp|Q5P7Z4|OBG_AROAE GTPase Obg OS=Aromatoleum aromaticum (strain EbN1) GN=obg PE=3 SV=1 7 161 6.0E-09
sp|Q0SM73|OBG_BORAP GTPase Obg OS=Borrelia afzelii (strain PKo) GN=obg PE=3 SV=1 7 118 6.0E-09
sp|Q0VSE6|OBG_ALCBS GTPase Obg OS=Alcanivorax borkumensis (strain ATCC 700651 / DSM 11573 / NCIMB 13689 / SK2) GN=obg PE=3 SV=1 7 116 6.0E-09
sp|B0UVI2|OBG_HISS2 GTPase Obg OS=Histophilus somni (strain 2336) GN=obg PE=3 SV=1 7 147 6.0E-09
sp|Q2JS78|OBG_SYNJA GTPase Obg OS=Synechococcus sp. (strain JA-3-3Ab) GN=obg PE=3 SV=1 7 150 6.0E-09
sp|Q0AHG5|OBG_NITEC GTPase Obg OS=Nitrosomonas eutropha (strain C91) GN=obg PE=3 SV=1 7 118 6.0E-09
sp|A0LPF9|OBG_SYNFM GTPase Obg OS=Syntrophobacter fumaroxidans (strain DSM 10017 / MPOB) GN=obg PE=3 SV=1 7 118 6.0E-09
sp|Q2JJ90|OBG_SYNJB GTPase Obg OS=Synechococcus sp. (strain JA-2-3B'a(2-13)) GN=obg PE=3 SV=1 7 150 6.0E-09
sp|A9BP68|OBG_DELAS GTPase Obg OS=Delftia acidovorans (strain DSM 14801 / SPH-1) GN=obg PE=3 SV=1 7 116 7.0E-09
sp|Q98EZ3|OBG_RHILO GTPase Obg OS=Rhizobium loti (strain MAFF303099) GN=obg PE=3 SV=1 8 118 7.0E-09
sp|Q1GSF4|OBG_SPHAL GTPase Obg OS=Sphingopyxis alaskensis (strain DSM 13593 / LMG 18877 / RB2256) GN=obg PE=3 SV=1 8 118 7.0E-09
sp|Q6KHM2|OBG_MYCMO GTPase Obg OS=Mycoplasma mobile (strain ATCC 43663 / 163K / NCTC 11711) GN=obg PE=3 SV=1 7 116 7.0E-09
sp|Q9CNS4|OBG_PASMU GTPase Obg OS=Pasteurella multocida (strain Pm70) GN=obg PE=3 SV=1 7 147 7.0E-09
sp|A3QB95|OBG_SHELP GTPase Obg OS=Shewanella loihica (strain ATCC BAA-1088 / PV-4) GN=obg PE=3 SV=1 7 116 7.0E-09
sp|Q2GDW7|OBG_NEOSM GTPase Obg OS=Neorickettsia sennetsu (strain Miyayama) GN=obg PE=3 SV=1 7 118 7.0E-09
sp|Q3BW46|OBG_XANC5 GTPase Obg OS=Xanthomonas campestris pv. vesicatoria (strain 85-10) GN=obg PE=3 SV=1 7 126 7.0E-09
sp|Q6F9D8|OBG_ACIAD GTPase Obg OS=Acinetobacter baylyi (strain ATCC 33305 / BD413 / ADP1) GN=obg PE=3 SV=1 7 116 8.0E-09
sp|A8F478|OBG_PSELT GTPase Obg OS=Pseudothermotoga lettingae (strain ATCC BAA-301 / DSM 14385 / NBRC 107922 / TMO) GN=obg PE=3 SV=1 8 132 9.0E-09
sp|B0VTQ1|OBG_ACIBS GTPase Obg OS=Acinetobacter baumannii (strain SDF) GN=obg PE=3 SV=1 7 116 1.0E-08
sp|B0VCR5|OBG_ACIBY GTPase Obg OS=Acinetobacter baumannii (strain AYE) GN=obg PE=3 SV=1 7 116 1.0E-08
sp|A3M7M2|OBG_ACIBT GTPase Obg OS=Acinetobacter baumannii (strain ATCC 17978 / CIP 53.77 / LMG 1025 / NCDC KC755 / 5377) GN=obg PE=3 SV=2 7 116 1.0E-08
sp|B2HWM9|OBG_ACIBC GTPase Obg OS=Acinetobacter baumannii (strain ACICU) GN=obg PE=3 SV=1 7 116 1.0E-08
sp|B7I557|OBG_ACIB5 GTPase Obg OS=Acinetobacter baumannii (strain AB0057) GN=obg PE=3 SV=1 7 116 1.0E-08
sp|B7GYV1|OBG_ACIB3 GTPase Obg OS=Acinetobacter baumannii (strain AB307-0294) GN=obg PE=3 SV=1 7 116 1.0E-08
sp|A8FRU4|OBG_SHESH GTPase Obg OS=Shewanella sediminis (strain HAW-EB3) GN=obg PE=3 SV=1 7 116 1.0E-08
sp|A9IFF9|OBG_BORPD GTPase Obg OS=Bordetella petrii (strain ATCC BAA-461 / DSM 12804 / CCUG 43448) GN=obg PE=3 SV=1 7 135 1.0E-08
sp|B1KGH1|OBG_SHEWM GTPase Obg OS=Shewanella woodyi (strain ATCC 51908 / MS32) GN=obg PE=3 SV=1 7 116 1.0E-08
sp|Q8PN23|OBG_XANAC GTPase Obg OS=Xanthomonas axonopodis pv. citri (strain 306) GN=obg PE=3 SV=1 7 126 1.0E-08
sp|A4G8R4|OBG_HERAR GTPase Obg OS=Herminiimonas arsenicoxydans GN=obg PE=3 SV=1 7 135 1.0E-08
sp|Q1WT46|OBG_LACS1 GTPase Obg OS=Lactobacillus salivarius (strain UCC118) GN=obg PE=3 SV=1 7 147 1.0E-08
sp|Q97JL4|OBG_CLOAB GTPase Obg OS=Clostridium acetobutylicum (strain ATCC 824 / DSM 792 / JCM 1419 / LMG 5710 / VKM B-1787) GN=obg PE=3 SV=1 7 147 1.0E-08
sp|A0AIY6|OBG_LISW6 GTPase Obg OS=Listeria welshimeri serovar 6b (strain ATCC 35897 / DSM 20650 / SLCC5334) GN=obg PE=3 SV=1 7 120 1.0E-08
sp|Q834V4|OBG_ENTFA GTPase Obg OS=Enterococcus faecalis (strain ATCC 700802 / V583) GN=obg PE=3 SV=1 7 146 1.0E-08
sp|A5CX17|OBG_VESOH GTPase Obg OS=Vesicomyosocius okutanii subsp. Calyptogena okutanii (strain HA) GN=obg PE=3 SV=1 7 116 1.0E-08
sp|B8F871|OBG_HAEPS GTPase Obg OS=Haemophilus parasuis serovar 5 (strain SH0165) GN=obg PE=3 SV=1 7 147 1.0E-08
sp|Q8Y6Z3|OBG_LISMO GTPase Obg OS=Listeria monocytogenes serovar 1/2a (strain ATCC BAA-679 / EGD-e) GN=obg PE=3 SV=1 7 120 1.0E-08
sp|Q71ZD3|OBG_LISMF GTPase Obg OS=Listeria monocytogenes serotype 4b (strain F2365) GN=obg PE=3 SV=1 7 120 1.0E-08
sp|Q92BH7|OBG_LISIN GTPase Obg OS=Listeria innocua serovar 6a (strain CLIP 11262) GN=obg PE=3 SV=1 7 120 1.0E-08
sp|Q5H2E5|OBG_XANOR GTPase Obg OS=Xanthomonas oryzae pv. oryzae (strain KACC10331 / KXO85) GN=obg PE=3 SV=1 7 118 1.0E-08
sp|B2STC0|OBG_XANOP GTPase Obg OS=Xanthomonas oryzae pv. oryzae (strain PXO99A) GN=obg PE=3 SV=1 7 118 1.0E-08
sp|Q2P5B4|OBG_XANOM GTPase Obg OS=Xanthomonas oryzae pv. oryzae (strain MAFF 311018) GN=obg PE=3 SV=1 7 118 1.0E-08
sp|A6T2D5|OBG_JANMA GTPase Obg OS=Janthinobacterium sp. (strain Marseille) GN=obg PE=3 SV=1 7 116 1.0E-08
sp|Q2L062|OBG_BORA1 GTPase Obg OS=Bordetella avium (strain 197N) GN=obg PE=3 SV=1 7 162 1.0E-08
sp|B3ER55|OBG_AMOA5 GTPase Obg OS=Amoebophilus asiaticus (strain 5a2) GN=obg PE=3 SV=1 7 122 1.0E-08
sp|Q5RDW1|MTG2_PONAB Mitochondrial ribosome-associated GTPase 2 OS=Pongo abelii GN=MTG2 PE=2 SV=1 8 118 1.0E-08
sp|A0Q1T4|OBG_CLONN GTPase Obg OS=Clostridium novyi (strain NT) GN=obg PE=3 SV=1 7 147 2.0E-08
sp|Q165Y6|OBG_ROSDO GTPase Obg OS=Roseobacter denitrificans (strain ATCC 33942 / OCh 114) GN=obg PE=3 SV=1 7 118 2.0E-08
sp|B8DHL1|OBG_LISMH GTPase Obg OS=Listeria monocytogenes serotype 4a (strain HCC23) GN=obg PE=3 SV=1 7 120 2.0E-08
sp|Q605N2|OBG_METCA GTPase Obg OS=Methylococcus capsulatus (strain ATCC 33009 / NCIMB 11132 / Bath) GN=obg PE=3 SV=1 7 116 2.0E-08
sp|Q12F99|OBG_POLSJ GTPase Obg OS=Polaromonas sp. (strain JS666 / ATCC BAA-500) GN=obg PE=3 SV=1 7 116 2.0E-08
sp|Q0AAD6|OBG_ALKEH GTPase Obg OS=Alkalilimnicola ehrlichii (strain ATCC BAA-1101 / DSM 17681 / MLHE-1) GN=obg PE=3 SV=1 7 117 2.0E-08
sp|Q8PBH0|OBG_XANCP GTPase Obg OS=Xanthomonas campestris pv. campestris (strain ATCC 33913 / DSM 3586 / NCPPB 528 / LMG 568 / P 25) GN=obg PE=3 SV=1 7 118 2.0E-08
sp|B0RY32|OBG_XANCB GTPase Obg OS=Xanthomonas campestris pv. campestris (strain B100) GN=obg PE=3 SV=1 7 118 2.0E-08
sp|Q4US36|OBG_XANC8 GTPase Obg OS=Xanthomonas campestris pv. campestris (strain 8004) GN=obg PE=3 SV=1 7 118 2.0E-08
sp|Q88Q08|OBG_PSEPK GTPase Obg OS=Pseudomonas putida (strain KT2440) GN=obg PE=3 SV=1 7 116 2.0E-08
sp|A5VYC6|OBG_PSEP1 GTPase Obg OS=Pseudomonas putida (strain F1 / ATCC 700007) GN=obg PE=3 SV=1 7 116 2.0E-08
sp|Q1CUK0|OBG_HELPH GTPase Obg OS=Helicobacter pylori (strain HPAG1) GN=obg PE=3 SV=1 7 118 2.0E-08
sp|Q2S9T3|OBG_HAHCH GTPase Obg OS=Hahella chejuensis (strain KCTC 2396) GN=obg PE=3 SV=1 7 118 2.0E-08
sp|A6LD68|OBG_PARD8 GTPase Obg OS=Parabacteroides distasonis (strain ATCC 8503 / DSM 20701 / NCTC 11152) GN=obg PE=3 SV=1 7 119 2.0E-08
sp|B0KMF6|OBG_PSEPG GTPase Obg OS=Pseudomonas putida (strain GB-1) GN=obg PE=3 SV=1 7 116 2.0E-08
sp|A1VK90|OBG_POLNA GTPase Obg OS=Polaromonas naphthalenivorans (strain CJ2) GN=obg PE=3 SV=1 7 116 2.0E-08
sp|Q9H4K7|MTG2_HUMAN Mitochondrial ribosome-associated GTPase 2 OS=Homo sapiens GN=MTG2 PE=1 SV=1 8 118 2.0E-08
sp|Q30XW0|OBG_DESAG GTPase Obg OS=Desulfovibrio alaskensis (strain G20) GN=obg PE=3 SV=2 8 115 2.0E-08
sp|Q7MW55|OBG_PORGI GTPase Obg OS=Porphyromonas gingivalis (strain ATCC BAA-308 / W83) GN=obg PE=3 SV=1 7 117 2.0E-08
sp|B2RIY7|OBG_PORG3 GTPase Obg OS=Porphyromonas gingivalis (strain ATCC 33277 / DSM 20709 / JCM 12257) GN=obg PE=3 SV=1 7 117 2.0E-08
sp|C1DEA4|OBG_AZOVD GTPase Obg OS=Azotobacter vinelandii (strain DJ / ATCC BAA-1303) GN=obg PE=3 SV=1 7 118 2.0E-08
sp|Q7VP37|OBG_HAEDU GTPase Obg OS=Haemophilus ducreyi (strain 35000HP / ATCC 700724) GN=obg PE=3 SV=1 7 147 2.0E-08
sp|B8CSY3|OBG_SHEPW GTPase Obg OS=Shewanella piezotolerans (strain WP3 / JCM 13877) GN=obg PE=3 SV=1 7 116 2.0E-08
sp|Q03YT6|OBG_LEUMM GTPase Obg OS=Leuconostoc mesenteroides subsp. mesenteroides (strain ATCC 8293 / NCDO 523) GN=obg PE=3 SV=1 7 119 2.0E-08
sp|Q1IF13|OBG_PSEE4 GTPase Obg OS=Pseudomonas entomophila (strain L48) GN=obg PE=3 SV=1 7 116 2.0E-08
sp|A6L100|OBG_BACV8 GTPase Obg OS=Bacteroides vulgatus (strain ATCC 8482 / DSM 1447 / NCTC 11154) GN=obg PE=3 SV=1 7 115 2.0E-08
sp|A1VF56|OBG_DESVV GTPase Obg OS=Desulfovibrio vulgaris subsp. vulgaris (strain DP4) GN=obg PE=3 SV=1 8 132 2.0E-08
sp|Q72DK0|OBG_DESVH GTPase Obg OS=Desulfovibrio vulgaris (strain Hildenborough / ATCC 29579 / NCIMB 8303) GN=obg PE=3 SV=1 8 132 2.0E-08
sp|Q9HVL8|OBG_PSEAE GTPase Obg OS=Pseudomonas aeruginosa (strain ATCC 15692 / PAO1 / 1C / PRS 101 / LMG 12228) GN=obg PE=3 SV=1 7 118 2.0E-08
sp|Q02GB1|OBG_PSEAB GTPase Obg OS=Pseudomonas aeruginosa (strain UCBPP-PA14) GN=obg PE=1 SV=1 7 118 2.0E-08
sp|B7V0A9|OBG_PSEA8 GTPase Obg OS=Pseudomonas aeruginosa (strain LESB58) GN=obg PE=3 SV=1 7 118 2.0E-08
sp|A6VBV3|OBG_PSEA7 GTPase Obg OS=Pseudomonas aeruginosa (strain PA7) GN=obg PE=3 SV=1 7 118 2.0E-08
sp|A6VMU1|OBG_ACTSZ GTPase Obg OS=Actinobacillus succinogenes (strain ATCC 55618 / 130Z) GN=obg PE=3 SV=1 7 147 2.0E-08
sp|Q4QM31|OBG_HAEI8 GTPase Obg OS=Haemophilus influenzae (strain 86-028NP) GN=obg PE=3 SV=1 7 147 2.0E-08
sp|Q65S59|OBG_MANSM GTPase Obg OS=Mannheimia succiniciproducens (strain MBEL55E) GN=obg PE=3 SV=1 7 147 2.0E-08
sp|Q851Q6|OBGC2_ORYSJ Probable GTP-binding protein OBGC2 OS=Oryza sativa subsp. japonica GN=Os03g0799700 PE=2 SV=1 7 113 2.0E-08
sp|B0BRJ9|OBG_ACTPJ GTPase Obg OS=Actinobacillus pleuropneumoniae serotype 3 (strain JL03) GN=obg PE=3 SV=1 7 147 2.0E-08
sp|B3GZN0|OBG_ACTP7 GTPase Obg OS=Actinobacillus pleuropneumoniae serotype 7 (strain AP76) GN=obg PE=3 SV=1 7 147 2.0E-08
sp|B1N057|OBG_LEUCK GTPase Obg OS=Leuconostoc citreum (strain KM20) GN=obg PE=3 SV=2 7 119 3.0E-08
sp|A5UDJ7|OBG_HAEIE GTPase Obg OS=Haemophilus influenzae (strain PittEE) GN=obg PE=3 SV=1 7 147 3.0E-08
sp|Q1DC95|OBG_MYXXD GTPase Obg OS=Myxococcus xanthus (strain DK 1622) GN=obg PE=3 SV=1 7 147 3.0E-08
sp|A5UI23|OBG_HAEIG GTPase Obg OS=Haemophilus influenzae (strain PittGG) GN=obg PE=3 SV=1 7 147 3.0E-08
sp|C0R5N5|OBG_WOLWR GTPase Obg OS=Wolbachia sp. subsp. Drosophila simulans (strain wRi) GN=obg PE=3 SV=1 7 118 3.0E-08
sp|Q73HQ3|OBG_WOLPM GTPase Obg OS=Wolbachia pipientis wMel GN=obg PE=3 SV=1 7 118 3.0E-08
sp|B8J4L3|OBG_DESDA GTPase Obg OS=Desulfovibrio desulfuricans (strain ATCC 27774 / DSM 6949) GN=obg PE=3 SV=1 8 115 3.0E-08
sp|Q82V20|OBG_NITEU GTPase Obg OS=Nitrosomonas europaea (strain ATCC 19718 / NBRC 14298) GN=obg PE=3 SV=1 7 118 3.0E-08
sp|Q89ZI9|OBG_BACTN GTPase Obg OS=Bacteroides thetaiotaomicron (strain ATCC 29148 / DSM 2079 / NCTC 10582 / E50 / VPI-5482) GN=obg PE=3 SV=1 7 117 3.0E-08
sp|Q3J6S0|OBG_NITOC GTPase Obg OS=Nitrosococcus oceani (strain ATCC 19707 / NCIMB 11848) GN=obg PE=3 SV=1 7 118 3.0E-08
sp|C0QX49|OBG_BRAHW GTPase Obg OS=Brachyspira hyodysenteriae (strain ATCC 49526 / WA1) GN=obg PE=3 SV=1 7 118 3.0E-08
sp|A3MYB2|OBG_ACTP2 GTPase Obg OS=Actinobacillus pleuropneumoniae serotype 5b (strain L20) GN=obg PE=3 SV=1 7 147 3.0E-08
sp|Q15PF0|OBG_PSEA6 GTPase Obg OS=Pseudoalteromonas atlantica (strain T6c / ATCC BAA-1087) GN=obg PE=3 SV=1 7 116 4.0E-08
sp|Q1MQQ1|OBG_LAWIP GTPase Obg OS=Lawsonia intracellularis (strain PHE/MN1-00) GN=obg PE=3 SV=1 8 118 4.0E-08
sp|Q39QR4|OBG_GEOMG GTPase Obg OS=Geobacter metallireducens (strain GS-15 / ATCC 53774 / DSM 7210) GN=obg PE=3 SV=1 7 122 4.0E-08
sp|P44915|OBG_HAEIN GTPase Obg OS=Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd) GN=obg PE=3 SV=1 7 147 4.0E-08
sp|Q2LR77|OBG_SYNAS GTPase Obg OS=Syntrophus aciditrophicus (strain SB) GN=obg PE=3 SV=2 7 118 4.0E-08
sp|A6W352|OBG_MARMS GTPase Obg OS=Marinomonas sp. (strain MWYL1) GN=obg PE=3 SV=1 7 116 4.0E-08
sp|Q9ZMD3|OBG_HELPJ GTPase Obg OS=Helicobacter pylori (strain J99 / ATCC 700824) GN=obg PE=3 SV=1 7 118 5.0E-08
sp|Q3K6K9|OBG_PSEPF GTPase Obg OS=Pseudomonas fluorescens (strain Pf0-1) GN=obg PE=3 SV=1 7 118 5.0E-08
sp|B1JF57|OBG_PSEPW GTPase Obg OS=Pseudomonas putida (strain W619) GN=obg PE=3 SV=1 7 116 5.0E-08
sp|Q4K5T8|OBG_PSEF5 GTPase Obg OS=Pseudomonas fluorescens (strain Pf-5 / ATCC BAA-477) GN=obg PE=3 SV=1 7 118 5.0E-08
sp|Q4ZYK1|OBG_PSEU2 GTPase Obg OS=Pseudomonas syringae pv. syringae (strain B728a) GN=obg PE=3 SV=1 7 118 5.0E-08
sp|Q48NL2|OBG_PSE14 GTPase Obg OS=Pseudomonas savastanoi pv. phaseolicola (strain 1448A / Race 6) GN=obg PE=3 SV=1 7 118 5.0E-08
sp|B2USD4|OBG_HELPS GTPase Obg OS=Helicobacter pylori (strain Shi470) GN=obg PE=3 SV=1 7 118 5.0E-08
sp|B1X580|OBG_PAUCH Putative GTPase Obg OS=Paulinella chromatophora GN=obg PE=3 SV=1 7 118 5.0E-08
sp|A0M5C6|OBG_GRAFK GTPase Obg OS=Gramella forsetii (strain KT0803) GN=obg PE=3 SV=1 7 135 6.0E-08
sp|Q8KAF0|OBG_CHLTE GTPase Obg OS=Chlorobium tepidum (strain ATCC 49652 / DSM 12025 / NBRC 103806 / TLS) GN=obg PE=3 SV=1 7 135 6.0E-08
sp|A4XYL2|OBG_PSEMY GTPase Obg OS=Pseudomonas mendocina (strain ymp) GN=obg PE=3 SV=1 7 118 6.0E-08
sp|B2S1C3|OBG_BORHD GTPase Obg OS=Borrelia hermsii (strain HS1 / DAH) GN=obg PE=3 SV=1 7 118 6.0E-08
sp|A5I666|OBG_CLOBH GTPase Obg OS=Clostridium botulinum (strain Hall / ATCC 3502 / NCTC 13319 / Type A) GN=obg PE=3 SV=1 7 147 6.0E-08
sp|A7FXU6|OBG_CLOB1 GTPase Obg OS=Clostridium botulinum (strain ATCC 19397 / Type A) GN=obg PE=3 SV=1 7 147 6.0E-08
[Show less]

GO

GO Term Description Terminal node
GO:0005525 GTP binding Yes
GO:0032553 ribonucleotide binding No
GO:0017076 purine nucleotide binding No
GO:0000166 nucleotide binding No
GO:0097159 organic cyclic compound binding No
GO:0043167 ion binding No
GO:0019001 guanyl nucleotide binding No
GO:1901265 nucleoside phosphate binding No
GO:0032555 purine ribonucleotide binding No
GO:1901363 heterocyclic compound binding No
GO:0035639 purine ribonucleoside triphosphate binding No
GO:0032561 guanyl ribonucleotide binding No
GO:0043168 anion binding No
GO:0036094 small molecule binding No
GO:0005488 binding No
GO:0003674 molecular_function No
GO:0097367 carbohydrate derivative binding No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 11 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >OphauB2|7238
MPRDPLIGLVGKPSAGKSTTLNSLTDASSKVGNFPFTTIDAQRAVGYLQIDCACARYGVEDRCKPNYGSCVGGRR
SVPIELLDVAGLVPGAHQGRGLGNKFLDDLRHADALIHVVDASGTVDAEGKETRGYDPSVDIAWLRSEIVAWISG
NLLQRWPSVRRRHVAVKAAAADTLQGQFSGYGATASVIARTLDRAAVKEPLEDWSDQTLHHIVRCFVDEKFPTVI
ALNKIDHPDADKNIAKIAKMQDPNTIVLCSAISEIFLRKMAKQGYIKYVEGSEFVDTKQDLMQQGDPTGGGLKEL
DEKNRTRIENLKDMVLYRFGSTGVVQVLSRAAELLGLVPVFPVRNTSTFSAGASESKFVFRDCVLVRKGSTVGDV
ARKVMGDAPIAYIEGVGSLRVAEDDPVAVGKNDVLSFKIGRT*
Coding >OphauB2|7238
ATGCCGCGCGACCCCCTCATCGGGCTCGTGGGCAAGCCGTCGGCCGGCAAGAGCACAACGCTCAACAGCCTGACG
GACGCTTCGTCAAAAGTTGGCAACTTCCCCTTCACCACAATTGACGCCCAGCGAGCCGTGGGCTACCTTCAGATA
GACTGTGCCTGCGCGCGCTACGGCGTCGAGGACCGCTGCAAACCAAACTATGGCTCGTGCGTCGGCGGGCGGCGG
TCTGTCCCCATAGAGCTGCTGGATGTTGCTGGGCTTGTGCCGGGCGCTCATCAGGGCCGCGGCCTGGGCAACAAG
TTCCTCGACGACCTGCGCCATGCCGATGCCCTCATCCACGTTGTTGACGCCTCGGGCACTGTCGACGCCGAGGGC
AAGGAGACGCGCGGCTACGATCCTTCGGTAGACATTGCTTGGCTGCGCAGCGAAATTGTCGCCTGGATCTCGGGC
AATCTGCTCCAGCGCTGGCCCTCGGTTCGTCGCCGCCATGTTGCCGTCAAGGCTGCCGCCGCAGACACTCTGCAG
GGCCAGTTCTCGGGCTACGGCGCCACTGCCTCAGTCATTGCTCGCACCCTCGACCGTGCTGCTGTCAAGGAGCCG
CTGGAGGACTGGTCCGACCAAACCCTGCATCACATTGTCCGCTGCTTCGTCGACGAAAAGTTCCCCACCGTCATT
GCCCTCAACAAAATCGACCACCCCGACGCCGACAAGAACATTGCCAAGATTGCAAAGATGCAGGATCCCAATACC
ATTGTTCTCTGCTCTGCCATTTCAGAAATCTTCCTGCGCAAAATGGCCAAGCAAGGCTACATCAAGTATGTCGAG
GGCAGCGAATTCGTCGATACTAAGCAAGACTTGATGCAGCAGGGCGATCCTACCGGAGGCGGCCTCAAGGAGCTC
GATGAAAAGAACCGCACCCGAATCGAAAACCTAAAGGACATGGTGCTCTACCGCTTCGGCTCCACAGGCGTCGTT
CAAGTCTTGTCCCGCGCCGCCGAGCTGCTCGGCCTCGTGCCCGTCTTCCCGGTCCGCAACACTTCTACCTTTAGC
GCCGGCGCCTCCGAGTCCAAGTTTGTATTTCGTGACTGTGTCTTGGTCAGAAAAGGTTCCACTGTTGGCGATGTT
GCCCGCAAAGTCATGGGCGATGCCCCCATAGCCTACATTGAGGGCGTCGGGAGCCTAAGAGTGGCCGAAGATGAT
CCCGTTGCCGTTGGTAAAAATGATGTCCTGTCCTTTAAAATAGGCCGCACATAA
Transcript >OphauB2|7238
ATGCCGCGCGACCCCCTCATCGGGCTCGTGGGCAAGCCGTCGGCCGGCAAGAGCACAACGCTCAACAGCCTGACG
GACGCTTCGTCAAAAGTTGGCAACTTCCCCTTCACCACAATTGACGCCCAGCGAGCCGTGGGCTACCTTCAGATA
GACTGTGCCTGCGCGCGCTACGGCGTCGAGGACCGCTGCAAACCAAACTATGGCTCGTGCGTCGGCGGGCGGCGG
TCTGTCCCCATAGAGCTGCTGGATGTTGCTGGGCTTGTGCCGGGCGCTCATCAGGGCCGCGGCCTGGGCAACAAG
TTCCTCGACGACCTGCGCCATGCCGATGCCCTCATCCACGTTGTTGACGCCTCGGGCACTGTCGACGCCGAGGGC
AAGGAGACGCGCGGCTACGATCCTTCGGTAGACATTGCTTGGCTGCGCAGCGAAATTGTCGCCTGGATCTCGGGC
AATCTGCTCCAGCGCTGGCCCTCGGTTCGTCGCCGCCATGTTGCCGTCAAGGCTGCCGCCGCAGACACTCTGCAG
GGCCAGTTCTCGGGCTACGGCGCCACTGCCTCAGTCATTGCTCGCACCCTCGACCGTGCTGCTGTCAAGGAGCCG
CTGGAGGACTGGTCCGACCAAACCCTGCATCACATTGTCCGCTGCTTCGTCGACGAAAAGTTCCCCACCGTCATT
GCCCTCAACAAAATCGACCACCCCGACGCCGACAAGAACATTGCCAAGATTGCAAAGATGCAGGATCCCAATACC
ATTGTTCTCTGCTCTGCCATTTCAGAAATCTTCCTGCGCAAAATGGCCAAGCAAGGCTACATCAAGTATGTCGAG
GGCAGCGAATTCGTCGATACTAAGCAAGACTTGATGCAGCAGGGCGATCCTACCGGAGGCGGCCTCAAGGAGCTC
GATGAAAAGAACCGCACCCGAATCGAAAACCTAAAGGACATGGTGCTCTACCGCTTCGGCTCCACAGGCGTCGTT
CAAGTCTTGTCCCGCGCCGCCGAGCTGCTCGGCCTCGTGCCCGTCTTCCCGGTCCGCAACACTTCTACCTTTAGC
GCCGGCGCCTCCGAGTCCAAGTTTGTATTTCGTGACTGTGTCTTGGTCAGAAAAGGTTCCACTGTTGGCGATGTT
GCCCGCAAAGTCATGGGCGATGCCCCCATAGCCTACATTGAGGGCGTCGGGAGCCTAAGAGTGGCCGAAGATGAT
CCCGTTGCCGTTGGTAAAAATGATGTCCTGTCCTTTAAAATAGGCCGCACATAA
Gene >OphauB2|7238
ATGCCGCGCGACCCCCTCATCGGGCTCGTGGGCAAGCCGTCGGCCGGCAAGAGCACAACGCTCAACAGCCTGACG
GACGCTTCGTCAAAAGTTGGTCCGTGGCCCGTCTGCGGCGACTAGGTGGCCGGCGAGCGCATCACACTGACTGCG
CGCACACAGGCAACTTCCCGTGCGTATCCTCCAAGGCGCTGTGCCCTTGACGGGTGGAATGGCTGACGGGCGACA
ACACCAGCTTCACCACAATTGACGCCCAGCGAGCCGTGGGCTACCTTCAGATAGACTGTGCCTGCGCGCGCTACG
GCGTCGAGGACCGCTGCAAACCAAACTATGGCTCGTGCGTCGGCGGGCGGCGGTCTGTCCCCATAGAGCTGCTGG
ATGTTGCTGGGCTTGTGCCGGGCGCTCATCAGGGCCGCGGCCTGGGCAACAAGTTCCTCGACGACCTGCGCCATG
CCGATGCCCTCATCCACGTTGTTGACGCCTCGGGCACTGTCGACGCCGAGGGCAAGGAGACGCGCGGCTACGATC
CTTCGGTAGACATTGCTTGGCTGCGCAGCGAAATTGTCGCCTGGATCTCGGGCAATCTGCTCCAGCGCTGGCCCT
CGGTTCGTCGCCGCCATGTTGCCGTCAAGGCTGCCGCCGCAGACACTCTGCAGGGCCAGTTCTCGGGCTACGGCG
CCACTGCCTCAGTCATTGCTCGCACCCTCGACCGTGCTGCTGTCAAGGAGCCGCTGGAGGACTGGTCCGACCAAA
CCCTGCATCACATTGTCCGCTGCTTCGTCGACGAAAAGTTCCCCACCGTCATTGCCCTCAACAAAATCGACCACC
CCGACGCCGACAAGAACATTGCCAAGATTGCAAAGATGCAGGATCCCAATACCATTGTTCTCTGCTCTGCCATTT
CAGAAATCTTCCTGCGCAAAATGGCCAAGCAAGGCTACATCAAGTATGTCGAGGGCAGCGAATTCGTCGATACTA
AGCAAGACTTGATGCAGCAGGGCGATCCTACCGGAGGCGGCCTCAAGGAGCTCGATGAAAAGAACCGCACCCGAA
TCGAAAACCTAAAGGACATGGTGCTCTACCGCTTCGGCTCCACAGGCGTCGTTCAAGTCTTGTCCCGCGCCGCCG
AGCTGCTCGGCCTCGTGCCCGTCTTCCCGGTCCGCAACACTTCTACCTTTAGCGCCGGCGCCTCCGAGTCCAAGT
TTGTATTTCGTGACTGTGTCTTGGTCAGAAAAGGTTCCACTGTTGGCGATGTTGCCCGCAAAGTCATGGGCGATG
CCCCCATAGCCTACATTGAGGGCGTCGGGAGCCTAAGAGTGGCCGAAGATGATCCCGTTGCCGTTGGTAAAAATG
ATGTGAGTCAATCCCGTCTCTGTCATTGCTTTAGCCGCTCTATTCTTCTGCATCTCCATTGTCCTCTCTCTGCCT
TTGGCTTTGTTACTGACCTCTACAGGTCCTGTCCTTTAAAATAGGCCGCACATAA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail