Fungal Genomics

at Utrecht University

General Properties

Protein IDOphauB2|7235
Gene name
LocationContig_75:20575..21547
Strand-
Gene length (bp)972
Transcript length (bp)972
Coding sequence length (bp)972
Protein length (aa) 324

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00076 RRM_1 RNA recognition motif. (a.k.a. RRM, RBD, or RNP domain) 5.7E-13 90 160

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q4IE79|PPIL4_GIBZE Peptidyl-prolyl cis-trans isomerase-like 4 OS=Gibberella zeae (strain PH-1 / ATCC MYA-4620 / FGSC 9075 / NRRL 31084) GN=CYP6 PE=3 SV=2 65 227 1.0E-81
sp|Q2U256|PPIL4_ASPOR Peptidyl-prolyl cis-trans isomerase-like 4 OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) GN=cyp6 PE=3 SV=1 4 266 2.0E-73
sp|Q5ARI5|PPIL4_EMENI Peptidyl-prolyl cis-trans isomerase-like 4 OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=cyp6 PE=3 SV=1 56 254 2.0E-73
sp|Q4WAQ9|PPIL4_ASPFU Peptidyl-prolyl cis-trans isomerase-like 4 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=cyp6 PE=3 SV=1 53 219 1.0E-70
sp|Q871A4|PPIL4_NEUCR Peptidyl-prolyl cis-trans isomerase-like 4 OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=cyp-6 PE=3 SV=1 68 236 3.0E-67
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q4IE79|PPIL4_GIBZE Peptidyl-prolyl cis-trans isomerase-like 4 OS=Gibberella zeae (strain PH-1 / ATCC MYA-4620 / FGSC 9075 / NRRL 31084) GN=CYP6 PE=3 SV=2 65 227 1.0E-81
sp|Q2U256|PPIL4_ASPOR Peptidyl-prolyl cis-trans isomerase-like 4 OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) GN=cyp6 PE=3 SV=1 4 266 2.0E-73
sp|Q5ARI5|PPIL4_EMENI Peptidyl-prolyl cis-trans isomerase-like 4 OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=cyp6 PE=3 SV=1 56 254 2.0E-73
sp|Q4WAQ9|PPIL4_ASPFU Peptidyl-prolyl cis-trans isomerase-like 4 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=cyp6 PE=3 SV=1 53 219 1.0E-70
sp|Q871A4|PPIL4_NEUCR Peptidyl-prolyl cis-trans isomerase-like 4 OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=cyp-6 PE=3 SV=1 68 236 3.0E-67
sp|Q6Q151|CYP59_ARATH Peptidyl-prolyl cis-trans isomerase CYP59 OS=Arabidopsis thaliana GN=CYP59 PE=1 SV=1 46 297 3.0E-50
sp|P0CP88|PPIL4_CRYNJ Peptidyl-prolyl cis-trans isomerase-like 4 OS=Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565) GN=CYP6 PE=3 SV=1 65 179 1.0E-49
sp|P0CP89|PPIL4_CRYNB Peptidyl-prolyl cis-trans isomerase-like 4 OS=Cryptococcus neoformans var. neoformans serotype D (strain B-3501A) GN=CYP6 PE=3 SV=1 65 179 1.0E-49
sp|Q9UUE4|PPIL4_SCHPO Peptidyl-prolyl cis-trans isomerase cyp6 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=cyp6 PE=1 SV=1 70 169 3.0E-48
sp|Q8WUA2|PPIL4_HUMAN Peptidyl-prolyl cis-trans isomerase-like 4 OS=Homo sapiens GN=PPIL4 PE=1 SV=1 49 168 5.0E-46
sp|P0C196|PPIL4_USTMA Peptidyl-prolyl cis-trans isomerase-like 4 OS=Ustilago maydis (strain 521 / FGSC 9021) GN=CYP6 PE=3 SV=1 52 179 6.0E-46
sp|Q9CXG3|PPIL4_MOUSE Peptidyl-prolyl cis-trans isomerase-like 4 OS=Mus musculus GN=Ppil4 PE=1 SV=2 49 168 8.0E-46
sp|O35698|RBY1A_MOUSE RNA-binding motif protein, Y chromosome, family 1 member A1 OS=Mus musculus GN=Rbmy1a1 PE=1 SV=2 80 314 5.0E-10
sp|Q60990|RBY1B_MOUSE RNA-binding motif protein, Y chromosome, family 1 member B OS=Mus musculus GN=Rbmy1b PE=2 SV=3 90 176 1.0E-09
sp|Q5U1W5|U1SBP_RAT U11/U12 small nuclear ribonucleoprotein 35 kDa protein OS=Rattus norvegicus GN=Snrnp35 PE=2 SV=1 86 163 2.0E-09
sp|Q9D384|U1SBP_MOUSE U11/U12 small nuclear ribonucleoprotein 35 kDa protein OS=Mus musculus GN=Snrnp35 PE=2 SV=1 86 163 3.0E-09
sp|Q05AT9|U1SBP_XENLA U11/U12 small nuclear ribonucleoprotein 35 kDa protein OS=Xenopus laevis GN=snrnp35 PE=2 SV=1 86 163 7.0E-09
sp|Q16560|U1SBP_HUMAN U11/U12 small nuclear ribonucleoprotein 35 kDa protein OS=Homo sapiens GN=SNRNP35 PE=1 SV=1 86 163 1.0E-08
sp|Q1LZH0|U1SBP_BOVIN U11/U12 small nuclear ribonucleoprotein 35 kDa protein OS=Bos taurus GN=SNRNP35 PE=2 SV=1 86 163 2.0E-08
sp|Q4KMD3|U1SBP_DANRE U11/U12 small nuclear ribonucleoprotein 35 kDa protein OS=Danio rerio GN=snrnp35 PE=2 SV=1 86 165 3.0E-08
sp|Q9WV02|RBMX_MOUSE RNA-binding motif protein, X chromosome OS=Mus musculus GN=Rbmx PE=1 SV=1 90 177 6.0E-08
sp|Q54Y98|TRA2_DICDI Transformer-2 protein homolog OS=Dictyostelium discoideum GN=tra2 PE=3 SV=1 80 166 6.0E-08
sp|Q55FQ0|RU17_DICDI U1 small nuclear ribonucleoprotein 70 kDa OS=Dictyostelium discoideum GN=snrnp70 PE=3 SV=1 86 162 6.0E-08
sp|Q96E39|RMXL1_HUMAN RNA binding motif protein, X-linked-like-1 OS=Homo sapiens GN=RBMXL1 PE=1 SV=1 90 162 6.0E-08
sp|Q4V898|RBMX_RAT RNA-binding motif protein, X chromosome OS=Rattus norvegicus GN=Rbmx PE=1 SV=1 90 177 7.0E-08
sp|Q91VM5|RMXL1_MOUSE RNA binding motif protein, X-linked-like-1 OS=Mus musculus GN=Rbmxl1 PE=2 SV=1 90 162 7.0E-08
sp|A5A6M3|RBMX_PANTR RNA-binding motif protein, X chromosome OS=Pan troglodytes GN=RBMX PE=2 SV=1 90 162 8.0E-08
sp|P38159|RBMX_HUMAN RNA-binding motif protein, X chromosome OS=Homo sapiens GN=RBMX PE=1 SV=3 90 162 8.0E-08
sp|Q4R7F0|RBMX_MACFA RNA-binding motif protein, X chromosome OS=Macaca fascicularis GN=RBMX PE=2 SV=1 90 162 8.0E-08
sp|P0C8Z4|RMXL3_PANTR RNA-binding motif protein, X-linked-like-3 OS=Pan troglodytes GN=RBMXL3 PE=3 SV=1 90 161 1.0E-07
sp|P84586|RMXRL_RAT RNA-binding motif protein, X chromosome retrogene-like OS=Rattus norvegicus GN=Rbmxrtl PE=1 SV=1 90 162 2.0E-07
sp|Q8WXF0|SRS12_HUMAN Serine/arginine-rich splicing factor 12 OS=Homo sapiens GN=SRSF12 PE=2 SV=1 83 165 2.0E-07
sp|O13829|RU17_SCHPO U1 small nuclear ribonucleoprotein 70 kDa homolog OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=usp101 PE=1 SV=1 86 162 3.0E-07
sp|Q29RT0|RBMX_BOVIN RNA-binding motif protein, X chromosome OS=Bos taurus GN=RBMX PE=2 SV=1 90 177 4.0E-07
sp|D4AE41|RMXL1_RAT RNA binding motif protein, X-linked-like-1 OS=Rattus norvegicus GN=Rbmxl1 PE=3 SV=1 90 162 5.0E-07
sp|Q9DED4|CIRBB_XENLA Cold-inducible RNA-binding protein B OS=Xenopus laevis GN=cirbp-b PE=1 SV=1 87 162 8.0E-07
sp|Q6IRQ4|RBMX_XENLA RNA-binding motif protein, X chromosome OS=Xenopus laevis GN=rbmx PE=2 SV=1 90 184 1.0E-06
sp|O75526|RMXL2_HUMAN RNA-binding motif protein, X-linked-like-2 OS=Homo sapiens GN=RBMXL2 PE=1 SV=3 90 161 1.0E-06
sp|Q28IQ9|CIRBP_XENTR Cold-inducible RNA-binding protein OS=Xenopus tropicalis GN=cirbp PE=2 SV=1 87 162 1.0E-06
sp|Q4R813|RMXL2_MACFA RNA-binding motif protein, X-linked-like-2 OS=Macaca fascicularis GN=RBMXL2 PE=2 SV=1 90 161 1.0E-06
sp|Q9R0U0|SRS10_MOUSE Serine/arginine-rich splicing factor 10 OS=Mus musculus GN=Srsf10 PE=1 SV=2 83 165 2.0E-06
sp|O75494|SRS10_HUMAN Serine/arginine-rich splicing factor 10 OS=Homo sapiens GN=SRSF10 PE=1 SV=1 83 165 2.0E-06
sp|Q8VY74|U1135_ARATH U11/U12 small nuclear ribonucleoprotein 35 kDa protein OS=Arabidopsis thaliana GN=SNRNP35 PE=1 SV=1 83 174 2.0E-06
sp|Q9FMG4|SC35_ARATH Serine/arginine-rich splicing factor SC35 OS=Arabidopsis thaliana GN=SC35 PE=1 SV=1 90 165 2.0E-06
[Show less]

GO

GO Term Description Terminal node
GO:0003723 RNA binding Yes
GO:0003674 molecular_function No
GO:0005488 binding No
GO:1901363 heterocyclic compound binding No
GO:0097159 organic cyclic compound binding No
GO:0003676 nucleic acid binding No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 23 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >OphauB2|7235
MASLGASEAALSGAAPASTSEAADKSQSINEPEPHADDGLDKQSSPQDKGPSKEDLDKQLRERKAAIQAVQLELM
GDLPFAEVKPPENVLFVCKLNAVTQDEDLELIFGRFGKIVSCEIIRDAKTKDSLQYAFIEFDEKAACEAAYFKMQ
DVLIDDRRIHVDFSQSVSKLSDAWRKGANKQRRANASRGGWGGVEELEKKRQYRAHMDKREGEGYDMVHGDKTAR
GRHEGVQEDVRREARSLRSHRRDPDERRYARNRSRSPQRQERNMDSYSSSRRDGDGRRKETELDMRSRDQRHYTR
DVKQHRDAGRYHDRHSDSYRSRR*
Coding >OphauB2|7235
ATGGCATCTCTTGGCGCGTCCGAGGCCGCATTGTCTGGCGCGGCGCCAGCCAGTACTTCCGAGGCAGCGGATAAG
AGTCAAAGTATCAATGAGCCCGAGCCACACGCAGACGATGGCCTGGACAAGCAATCATCGCCTCAAGACAAAGGT
CCCAGCAAAGAGGATCTTGACAAACAACTCCGCGAGCGCAAAGCTGCAATTCAAGCCGTCCAGCTCGAGCTCATG
GGCGACCTGCCTTTTGCCGAAGTCAAACCACCAGAAAACGTCCTCTTCGTATGCAAGCTCAACGCTGTGACGCAA
GACGAAGACCTAGAGCTCATCTTTGGCCGATTTGGAAAGATTGTCAGTTGCGAGATTATACGGGATGCGAAGACA
AAGGACAGCTTGCAGTATGCTTTTATCGAGTTTGATGAGAAAGCGGCATGTGAGGCTGCGTACTTTAAGATGCAA
GACGTCTTGATTGATGACCGGCGGATACACGTTGATTTCTCACAGAGCGTTAGCAAGCTGAGTGATGCATGGAGA
AAAGGTGCCAACAAGCAACGTAGAGCCAATGCTTCCAGAGGAGGCTGGGGGGGAGTTGAAGAACTGGAGAAGAAG
AGGCAGTACAGGGCACACATGGACAAGAGAGAGGGTGAGGGGTACGATATGGTTCATGGCGACAAGACAGCCAGA
GGGCGTCACGAAGGCGTGCAAGAGGATGTGCGAAGAGAGGCAAGATCCTTGAGGAGTCACCGAAGGGATCCGGAC
GAGCGCAGATATGCTCGTAATCGCAGCCGGAGCCCGCAACGACAAGAGAGAAACATGGACAGTTATTCATCAAGC
CGGAGAGATGGCGATGGACGCCGCAAAGAAACAGAGTTGGACATGAGGAGCCGTGACCAACGACACTATACACGA
GACGTAAAGCAGCATAGGGATGCAGGCCGCTACCACGATCGGCACTCGGACAGCTACAGGTCACGACGGTGA
Transcript >OphauB2|7235
ATGGCATCTCTTGGCGCGTCCGAGGCCGCATTGTCTGGCGCGGCGCCAGCCAGTACTTCCGAGGCAGCGGATAAG
AGTCAAAGTATCAATGAGCCCGAGCCACACGCAGACGATGGCCTGGACAAGCAATCATCGCCTCAAGACAAAGGT
CCCAGCAAAGAGGATCTTGACAAACAACTCCGCGAGCGCAAAGCTGCAATTCAAGCCGTCCAGCTCGAGCTCATG
GGCGACCTGCCTTTTGCCGAAGTCAAACCACCAGAAAACGTCCTCTTCGTATGCAAGCTCAACGCTGTGACGCAA
GACGAAGACCTAGAGCTCATCTTTGGCCGATTTGGAAAGATTGTCAGTTGCGAGATTATACGGGATGCGAAGACA
AAGGACAGCTTGCAGTATGCTTTTATCGAGTTTGATGAGAAAGCGGCATGTGAGGCTGCGTACTTTAAGATGCAA
GACGTCTTGATTGATGACCGGCGGATACACGTTGATTTCTCACAGAGCGTTAGCAAGCTGAGTGATGCATGGAGA
AAAGGTGCCAACAAGCAACGTAGAGCCAATGCTTCCAGAGGAGGCTGGGGGGGAGTTGAAGAACTGGAGAAGAAG
AGGCAGTACAGGGCACACATGGACAAGAGAGAGGGTGAGGGGTACGATATGGTTCATGGCGACAAGACAGCCAGA
GGGCGTCACGAAGGCGTGCAAGAGGATGTGCGAAGAGAGGCAAGATCCTTGAGGAGTCACCGAAGGGATCCGGAC
GAGCGCAGATATGCTCGTAATCGCAGCCGGAGCCCGCAACGACAAGAGAGAAACATGGACAGTTATTCATCAAGC
CGGAGAGATGGCGATGGACGCCGCAAAGAAACAGAGTTGGACATGAGGAGCCGTGACCAACGACACTATACACGA
GACGTAAAGCAGCATAGGGATGCAGGCCGCTACCACGATCGGCACTCGGACAGCTACAGGTCACGACGGTGA
Gene >OphauB2|7235
ATGGCATCTCTTGGCGCGTCCGAGGCCGCATTGTCTGGCGCGGCGCCAGCCAGTACTTCCGAGGCAGCGGATAAG
AGTCAAAGTATCAATGAGCCCGAGCCACACGCAGACGATGGCCTGGACAAGCAATCATCGCCTCAAGACAAAGGT
CCCAGCAAAGAGGATCTTGACAAACAACTCCGCGAGCGCAAAGCTGCAATTCAAGCCGTCCAGCTCGAGCTCATG
GGCGACCTGCCTTTTGCCGAAGTCAAACCACCAGAAAACGTCCTCTTCGTATGCAAGCTCAACGCTGTGACGCAA
GACGAAGACCTAGAGCTCATCTTTGGCCGATTTGGAAAGATTGTCAGTTGCGAGATTATACGGGATGCGAAGACA
AAGGACAGCTTGCAGTATGCTTTTATCGAGTTTGATGAGAAAGCGGCATGTGAGGCTGCGTACTTTAAGATGCAA
GACGTCTTGATTGATGACCGGCGGATACACGTTGATTTCTCACAGAGCGTTAGCAAGCTGAGTGATGCATGGAGA
AAAGGTGCCAACAAGCAACGTAGAGCCAATGCTTCCAGAGGAGGCTGGGGGGGAGTTGAAGAACTGGAGAAGAAG
AGGCAGTACAGGGCACACATGGACAAGAGAGAGGGTGAGGGGTACGATATGGTTCATGGCGACAAGACAGCCAGA
GGGCGTCACGAAGGCGTGCAAGAGGATGTGCGAAGAGAGGCAAGATCCTTGAGGAGTCACCGAAGGGATCCGGAC
GAGCGCAGATATGCTCGTAATCGCAGCCGGAGCCCGCAACGACAAGAGAGAAACATGGACAGTTATTCATCAAGC
CGGAGAGATGGCGATGGACGCCGCAAAGAAACAGAGTTGGACATGAGGAGCCGTGACCAACGACACTATACACGA
GACGTAAAGCAGCATAGGGATGCAGGCCGCTACCACGATCGGCACTCGGACAGCTACAGGTCACGACGGTGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail