Fungal Genomics

at Utrecht University

General Properties

Protein IDOphauB2|7226
Gene name
LocationContig_74:73671..74547
Strand+
Gene length (bp)876
Transcript length (bp)876
Coding sequence length (bp)876
Protein length (aa) 292

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

(None)

Swissprot hits

(None)

GO

(None)

Deeploc

Deeploc data not available for this genome

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

No expression data available for this genome

Orthologs

Orthofinder run ID4
Orthogroup1155
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|364
Ophiocordyceps australis map64 (Brazil) OphauB2|7226 (this protein)
Ophiocordyceps camponoti-floridani Ophcf2|05479
Ophiocordyceps camponoti-rufipedis Ophun1|334
Ophiocordyceps kimflemingae Ophio5|7411
Ophiocordyceps subramaniannii Hirsu2|1024

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >OphauB2|7226
MDDSCPRSSEAPEMLSSLAAYNDDTSAVPSCPPLSHDAVGAPTSAAASLLEPGRVGGAFLDFAGGQLPMELLVGR
LEKQSLDMAMRQSEEGSCSQPLGLREADLDDKLQAMDVDMEEPGEVETALPMLPHRLEAMRLRKRYSCSQASRSA
RAVGPPIARAEQSSAQHRRASNTESKAPLEAPDPSSSMCGKLEADEGYCEGADDMSWLDGDEVMAGLSSTARSNG
LLKFQTSAERAMQCSMVVRKAARMRRRRHQKRETRMRPSETETATAVASTAMYNGREPGQAQSWQS*
Coding >OphauB2|7226
ATGGATGACTCATGCCCGAGATCGAGCGAGGCACCAGAGATGCTGTCGTCATTGGCGGCCTACAACGACGACACT
AGCGCAGTGCCATCTTGTCCACCATTATCCCATGATGCAGTGGGTGCGCCGACGAGTGCCGCTGCCTCACTCTTG
GAGCCAGGCCGAGTCGGCGGTGCATTCTTAGACTTTGCAGGTGGCCAGCTGCCGATGGAACTGCTCGTCGGCCGG
TTGGAGAAACAGAGCCTCGACATGGCCATGCGCCAGAGTGAAGAGGGCAGCTGCTCGCAGCCACTGGGCCTGCGT
GAGGCAGACTTAGATGACAAGCTGCAGGCCATGGACGTGGACATGGAAGAGCCTGGAGAGGTAGAGACAGCATTG
CCCATGCTCCCGCACAGGCTGGAGGCGATGCGCTTGCGCAAAAGGTACTCTTGCAGCCAAGCTTCTCGGTCAGCC
AGAGCAGTCGGCCCTCCAATAGCAAGGGCAGAGCAGTCGTCGGCTCAGCACAGACGGGCGTCGAATACAGAAAGT
AAAGCGCCCCTGGAAGCACCAGACCCAAGCTCGTCCATGTGTGGCAAACTGGAGGCTGACGAGGGGTATTGCGAG
GGCGCCGACGACATGTCGTGGCTTGACGGCGATGAAGTCATGGCGGGCTTATCCTCAACGGCACGTAGCAATGGA
CTGCTCAAGTTCCAAACCTCGGCAGAGAGGGCGATGCAATGCTCCATGGTGGTGCGCAAGGCGGCGCGGATGCGG
CGCAGAAGACATCAGAAGCGAGAAACAAGAATGCGTCCCTCGGAGACGGAAACGGCAACAGCAGTGGCATCAACG
GCAATGTACAATGGGCGGGAACCCGGCCAGGCGCAGTCATGGCAGTCTTGA
Transcript >OphauB2|7226
ATGGATGACTCATGCCCGAGATCGAGCGAGGCACCAGAGATGCTGTCGTCATTGGCGGCCTACAACGACGACACT
AGCGCAGTGCCATCTTGTCCACCATTATCCCATGATGCAGTGGGTGCGCCGACGAGTGCCGCTGCCTCACTCTTG
GAGCCAGGCCGAGTCGGCGGTGCATTCTTAGACTTTGCAGGTGGCCAGCTGCCGATGGAACTGCTCGTCGGCCGG
TTGGAGAAACAGAGCCTCGACATGGCCATGCGCCAGAGTGAAGAGGGCAGCTGCTCGCAGCCACTGGGCCTGCGT
GAGGCAGACTTAGATGACAAGCTGCAGGCCATGGACGTGGACATGGAAGAGCCTGGAGAGGTAGAGACAGCATTG
CCCATGCTCCCGCACAGGCTGGAGGCGATGCGCTTGCGCAAAAGGTACTCTTGCAGCCAAGCTTCTCGGTCAGCC
AGAGCAGTCGGCCCTCCAATAGCAAGGGCAGAGCAGTCGTCGGCTCAGCACAGACGGGCGTCGAATACAGAAAGT
AAAGCGCCCCTGGAAGCACCAGACCCAAGCTCGTCCATGTGTGGCAAACTGGAGGCTGACGAGGGGTATTGCGAG
GGCGCCGACGACATGTCGTGGCTTGACGGCGATGAAGTCATGGCGGGCTTATCCTCAACGGCACGTAGCAATGGA
CTGCTCAAGTTCCAAACCTCGGCAGAGAGGGCGATGCAATGCTCCATGGTGGTGCGCAAGGCGGCGCGGATGCGG
CGCAGAAGACATCAGAAGCGAGAAACAAGAATGCGTCCCTCGGAGACGGAAACGGCAACAGCAGTGGCATCAACG
GCAATGTACAATGGGCGGGAACCCGGCCAGGCGCAGTCATGGCAGTCTTGA
Gene >OphauB2|7226
ATGGATGACTCATGCCCGAGATCGAGCGAGGCACCAGAGATGCTGTCGTCATTGGCGGCCTACAACGACGACACT
AGCGCAGTGCCATCTTGTCCACCATTATCCCATGATGCAGTGGGTGCGCCGACGAGTGCCGCTGCCTCACTCTTG
GAGCCAGGCCGAGTCGGCGGTGCATTCTTAGACTTTGCAGGTGGCCAGCTGCCGATGGAACTGCTCGTCGGCCGG
TTGGAGAAACAGAGCCTCGACATGGCCATGCGCCAGAGTGAAGAGGGCAGCTGCTCGCAGCCACTGGGCCTGCGT
GAGGCAGACTTAGATGACAAGCTGCAGGCCATGGACGTGGACATGGAAGAGCCTGGAGAGGTAGAGACAGCATTG
CCCATGCTCCCGCACAGGCTGGAGGCGATGCGCTTGCGCAAAAGGTACTCTTGCAGCCAAGCTTCTCGGTCAGCC
AGAGCAGTCGGCCCTCCAATAGCAAGGGCAGAGCAGTCGTCGGCTCAGCACAGACGGGCGTCGAATACAGAAAGT
AAAGCGCCCCTGGAAGCACCAGACCCAAGCTCGTCCATGTGTGGCAAACTGGAGGCTGACGAGGGGTATTGCGAG
GGCGCCGACGACATGTCGTGGCTTGACGGCGATGAAGTCATGGCGGGCTTATCCTCAACGGCACGTAGCAATGGA
CTGCTCAAGTTCCAAACCTCGGCAGAGAGGGCGATGCAATGCTCCATGGTGGTGCGCAAGGCGGCGCGGATGCGG
CGCAGAAGACATCAGAAGCGAGAAACAAGAATGCGTCCCTCGGAGACGGAAACGGCAACAGCAGTGGCATCAACG
GCAATGTACAATGGGCGGGAACCCGGCCAGGCGCAGTCATGGCAGTCTTGA

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail