Fungal Genomics

at Utrecht University

General Properties

Protein IDOphauB2|7220
Gene name
LocationContig_74:48493..49036
Strand+
Gene length (bp)543
Transcript length (bp)366
Coding sequence length (bp)366
Protein length (aa) 122

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00173 Cyt-b5 Cytochrome b5-like Heme/Steroid binding domain 5.7E-12 23 87

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q9SK39|SBP3_ARATH Probable steroid-binding protein 3 OS=Arabidopsis thaliana GN=MP3 PE=1 SV=1 21 114 2.0E-22
sp|O13995|DAP1_SCHPO Cytochrome P450 regulator dap1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=dap1 PE=1 SV=1 25 114 3.0E-15
sp|Q60YT6|NEUFC_CAEBR Neuferricin homolog OS=Caenorhabditis briggsae GN=tag-131 PE=3 SV=1 33 114 1.0E-13
sp|Q9M2Z4|MSBP2_ARATH Membrane steroid-binding protein 2 OS=Arabidopsis thaliana GN=MSBP2 PE=1 SV=1 10 115 1.0E-13
sp|Q9XFM6|MSBP1_ARATH Membrane steroid-binding protein 1 OS=Arabidopsis thaliana GN=MSBP1 PE=1 SV=2 6 117 2.0E-13
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q9SK39|SBP3_ARATH Probable steroid-binding protein 3 OS=Arabidopsis thaliana GN=MP3 PE=1 SV=1 21 114 2.0E-22
sp|O13995|DAP1_SCHPO Cytochrome P450 regulator dap1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=dap1 PE=1 SV=1 25 114 3.0E-15
sp|Q60YT6|NEUFC_CAEBR Neuferricin homolog OS=Caenorhabditis briggsae GN=tag-131 PE=3 SV=1 33 114 1.0E-13
sp|Q9M2Z4|MSBP2_ARATH Membrane steroid-binding protein 2 OS=Arabidopsis thaliana GN=MSBP2 PE=1 SV=1 10 115 1.0E-13
sp|Q9XFM6|MSBP1_ARATH Membrane steroid-binding protein 1 OS=Arabidopsis thaliana GN=MSBP1 PE=1 SV=2 6 117 2.0E-13
sp|Q5ZKN2|PGRC1_CHICK Membrane-associated progesterone receptor component 1 OS=Gallus gallus GN=PGRMC1 PE=2 SV=3 21 114 7.0E-13
sp|Q12091|DAP1_YEAST Damage response protein 1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=DAP1 PE=1 SV=1 26 114 1.0E-12
sp|Q95250|PGRC1_PIG Membrane-associated progesterone receptor component 1 OS=Sus scrofa GN=PGRMC1 PE=1 SV=3 25 114 1.0E-12
sp|Q5RED0|PGRC1_PONAB Membrane-associated progesterone receptor component 1 OS=Pongo abelii GN=PGRMC1 PE=2 SV=3 25 114 1.0E-12
sp|O00264|PGRC1_HUMAN Membrane-associated progesterone receptor component 1 OS=Homo sapiens GN=PGRMC1 PE=1 SV=3 25 114 2.0E-12
sp|Q17QC0|PGRC1_BOVIN Membrane-associated progesterone receptor component 1 OS=Bos taurus GN=PGRMC1 PE=2 SV=3 25 114 2.0E-12
sp|P70580|PGRC1_RAT Membrane-associated progesterone receptor component 1 OS=Rattus norvegicus GN=Pgrmc1 PE=1 SV=3 25 114 2.0E-12
sp|O55022|PGRC1_MOUSE Membrane-associated progesterone receptor component 1 OS=Mus musculus GN=Pgrmc1 PE=1 SV=4 25 114 2.0E-12
sp|Q9XXA7|NEUFC_CAEEL Neuferricin homolog OS=Caenorhabditis elegans GN=tag-131 PE=3 SV=1 33 114 8.0E-12
sp|A2CES0|NEUFC_DANRE Neuferricin OS=Danio rerio GN=cyb5d2 PE=3 SV=1 21 116 1.0E-11
sp|Q8WUJ1|NEUFC_HUMAN Neuferricin OS=Homo sapiens GN=CYB5D2 PE=2 SV=1 38 116 1.0E-11
sp|O15173|PGRC2_HUMAN Membrane-associated progesterone receptor component 2 OS=Homo sapiens GN=PGRMC2 PE=1 SV=1 21 114 3.0E-11
sp|Q5XIU9|PGRC2_RAT Membrane-associated progesterone receptor component 2 OS=Rattus norvegicus GN=Pgrmc2 PE=1 SV=1 17 114 4.0E-11
sp|Q80UU9|PGRC2_MOUSE Membrane-associated progesterone receptor component 2 OS=Mus musculus GN=Pgrmc2 PE=1 SV=2 17 114 4.0E-11
sp|Q28FI8|NEUFC_XENTR Neuferricin OS=Xenopus tropicalis GN=cyb5d2 PE=2 SV=1 9 116 6.0E-11
sp|Q6AY62|NEUFC_RAT Neuferricin OS=Rattus norvegicus GN=Cyb5d2 PE=2 SV=1 24 116 1.0E-10
sp|Q5SSH8|NEUFC_MOUSE Neuferricin OS=Mus musculus GN=Cyb5d2 PE=1 SV=1 24 116 2.0E-10
sp|Q6IUR5|NENF_RAT Neudesin OS=Rattus norvegicus GN=Nenf PE=2 SV=1 24 118 2.0E-09
sp|Q9CQ45|NENF_MOUSE Neudesin OS=Mus musculus GN=Nenf PE=1 SV=1 24 112 9.0E-09
sp|Q9UMX5|NENF_HUMAN Neudesin OS=Homo sapiens GN=NENF PE=1 SV=1 20 112 3.0E-08
sp|Q1JQA5|NENF_BOVIN Neudesin OS=Bos taurus GN=NENF PE=2 SV=1 17 112 4.0E-08
sp|Q2HIW2|MAPR4_ARATH Membrane-associated progesterone-binding protein 4 OS=Arabidopsis thaliana GN=MAPR4 PE=2 SV=1 21 116 1.0E-07
sp|Q29HF1|NEUFC_DROPS Neuferricin homolog OS=Drosophila pseudoobscura pseudoobscura GN=GA11364 PE=3 SV=1 21 116 7.0E-07
[Show less]

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 35 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >OphauB2|7220
MTGKFEPKVPVQLDPPKSDPISLQDLAKANGVDGGKCYVAIKGKVYDVTGNKAYQPGGSYHVFAGKDASRALGKT
STKPEDVRPDWHDLEDKEKGVLDDWVTFFSKRYNVVGAVEGATNME*
Coding >OphauB2|7220
ATGACTGGCAAGTTTGAACCCAAAGTGCCCGTACAGCTGGATCCTCCCAAGAGTGACCCCATCTCGCTCCAGGAC
TTGGCCAAGGCTAACGGAGTCGACGGTGGCAAGTGCTATGTGGCCATCAAAGGCAAAGTCTACGATGTGACGGGC
AACAAGGCCTACCAGCCCGGCGGCTCGTACCATGTCTTTGCGGGAAAGGACGCCTCTCGGGCTTTGGGTAAGACA
TCTACCAAGCCCGAGGATGTCCGGCCGGACTGGCATGATCTCGAGGACAAGGAAAAGGGCGTCCTCGACGACTGG
GTCACCTTTTTCTCCAAGCGCTACAATGTTGTCGGAGCTGTCGAGGGCGCGACCAATATGGAATGA
Transcript >OphauB2|7220
ATGACTGGCAAGTTTGAACCCAAAGTGCCCGTACAGCTGGATCCTCCCAAGAGTGACCCCATCTCGCTCCAGGAC
TTGGCCAAGGCTAACGGAGTCGACGGTGGCAAGTGCTATGTGGCCATCAAAGGCAAAGTCTACGATGTGACGGGC
AACAAGGCCTACCAGCCCGGCGGCTCGTACCATGTCTTTGCGGGAAAGGACGCCTCTCGGGCTTTGGGTAAGACA
TCTACCAAGCCCGAGGATGTCCGGCCGGACTGGCATGATCTCGAGGACAAGGAAAAGGGCGTCCTCGACGACTGG
GTCACCTTTTTCTCCAAGCGCTACAATGTTGTCGGAGCTGTCGAGGGCGCGACCAATATGGAATGA
Gene >OphauB2|7220
ATGACTGGCAAGTTTGAACCCAAAGTGCCCGTACAGCTGGATCCTCCCAAGAGTGACCCCATCTCGCTCCAGGAC
TTGGCCAAGGCTAACGGTACATGCGCCTTTCACCATGCTGGCTTCTTTCTCCTAGCTAACTGGCGTTGCTATAAT
GGCTAGGAGTCGACGGTGGCAAGTGCTATGTGGCCATCAAAGTAAGTCTCTCTACTGCGTGACTGGGCCGCGGAC
TGCTCAAGTCGCCATTCAAGGGCAAAGTCTACGATGTGACGGGCAACAAGGCCTACCAGCCCGGCGGCTCGTACC
ATGGTGCGCAACAATCTGCCCTTGTCACAAGCAGCGCCAAGGACTAATAGTGTGGCTTCAGTCTTTGCGGGAAAG
GACGCCTCTCGGGCTTTGGGTAAGACATCTACCAAGCCCGAGGATGTCCGGCCGGACTGGCATGATCTCGAGGAC
AAGGAAAAGGGCGTCCTCGACGACTGGGTCACCTTTTTCTCCAAGCGCTACAATGTTGTCGGAGCTGTCGAGGGC
GCGACCAATATGGAATGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail