Fungal Genomics

at Utrecht University

General Properties

Protein IDOphauB2|7219
Gene name
LocationContig_74:46623..48200
Strand-
Gene length (bp)1577
Transcript length (bp)1521
Coding sequence length (bp)1521
Protein length (aa) 507

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

(None)

Swissprot hits

(None)

GO

(None)

Deeploc

Deeploc data not available for this genome

SignalP

(None)

Transmembrane Domains

Domain # Start End Length
1 107 129 22

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

No expression data available for this genome

Orthologs

Orthofinder run ID4
Orthogroup2517
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|1144
Ophiocordyceps australis map64 (Brazil) OphauB2|7219 (this protein)
Ophiocordyceps camponoti-floridani Ophcf2|05485
Ophiocordyceps camponoti-rufipedis Ophun1|4988
Ophiocordyceps kimflemingae Ophio5|7058
Ophiocordyceps subramaniannii Hirsu2|3679

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >OphauB2|7219
MAGSAGASLRLLQQSCLRHGLSSPRLGLRWTHPTLAAAVAPGYLQRRHESSAKEPASPKDSAKRPENMNPEPKYT
FRQAVGITFVNSFRNLGIALSPRGIRSAYNDLPVVTSLLLIALLATFGIGAYALHSYMSFFYGPNFSQFPDPVAN
TLRRAIYCTNIKPDPELALRYYKKAMQQCIDLDLDPFSDPVLGIRMYVAQWLESIHNFKLAIDVLESVLQDCKKW
VAVMEQSNQEGKVDDRGRLVQPDSEPVPVGKASDDTPPPETLWRKRERLLAKAIGTSVKLGALYADEHVMEPEKS
HLHLVWAVETALKEFQRRHVQGPKPGEEAWLTPQELGGAMESLAHNYERRSQFHLAIPLLMQALRLCDSPCHRAV
IMNNLSAVFAQQPIFSPAQPPSASSTIEGLVETAVPTSRKECFESAENWAQNALDHAQDVTGEERTAECDEACAV
AMCNLADVAAMLGKPDVARAKYRECIEMSSKMDFKQGVKHAQEGLAKLTSTPVTKV*
Coding >OphauB2|7219
ATGGCCGGCTCTGCAGGCGCGTCGCTGAGACTGCTCCAGCAGTCATGTCTGCGCCATGGCTTGTCATCACCTCGT
CTTGGCCTACGCTGGACTCATCCCACACTGGCGGCTGCTGTGGCTCCTGGCTATTTACAGAGGCGACATGAATCG
TCAGCCAAGGAGCCAGCGTCGCCCAAAGATTCAGCCAAGCGGCCAGAAAACATGAACCCAGAGCCCAAATACACC
TTCCGCCAAGCTGTAGGAATCACCTTTGTCAACAGTTTCCGAAATCTGGGCATAGCTCTCAGCCCGCGCGGCATA
CGCTCCGCCTACAACGACTTGCCCGTCGTGACGAGTCTGCTGCTCATTGCCCTCTTGGCCACTTTTGGCATCGGA
GCCTACGCTCTACACTCTTATATGAGCTTCTTCTATGGCCCCAACTTTAGCCAATTCCCCGACCCCGTTGCAAAT
ACCCTGCGCCGCGCCATCTACTGCACAAACATCAAGCCCGATCCCGAACTTGCGCTGCGCTACTACAAAAAGGCT
ATGCAACAGTGCATCGACTTGGATCTAGACCCCTTTTCTGACCCAGTCCTCGGAATCCGTATGTATGTTGCTCAG
TGGCTAGAATCCATACACAACTTCAAGCTCGCCATTGATGTTCTTGAATCAGTCCTTCAAGACTGCAAAAAATGG
GTAGCCGTCATGGAACAGTCGAATCAGGAAGGAAAAGTGGATGATAGAGGGCGGCTGGTGCAGCCTGATTCGGAG
CCCGTCCCCGTTGGAAAGGCTTCTGACGACACGCCCCCGCCAGAGACTCTTTGGAGAAAACGAGAGCGTCTGTTG
GCCAAAGCCATTGGCACCAGCGTCAAGTTGGGCGCATTATATGCCGACGAGCACGTCATGGAACCCGAAAAGTCG
CACCTTCATCTTGTATGGGCGGTGGAAACGGCTCTCAAAGAATTTCAGCGACGTCATGTTCAAGGCCCCAAACCG
GGCGAAGAAGCTTGGTTGACTCCCCAGGAGTTGGGTGGAGCGATGGAATCGCTTGCGCACAACTATGAGCGCAGA
TCGCAGTTTCATCTAGCTATTCCTCTCTTGATGCAAGCTCTGCGCCTTTGCGACAGCCCCTGCCACCGAGCTGTC
ATCATGAACAATCTTTCAGCTGTCTTTGCGCAGCAACCCATATTCTCTCCTGCCCAACCCCCCTCCGCGTCTTCC
ACTATCGAGGGGCTGGTGGAAACGGCTGTACCAACGTCGCGCAAAGAATGCTTCGAATCTGCCGAGAATTGGGCT
CAAAACGCCCTAGACCATGCTCAGGATGTCACAGGCGAGGAAAGAACGGCCGAGTGCGATGAGGCCTGCGCCGTC
GCCATGTGCAATTTGGCTGATGTGGCGGCTATGCTGGGCAAACCCGACGTGGCGCGCGCCAAATATCGAGAATGC
ATCGAGATGAGTAGCAAGATGGACTTCAAACAGGGTGTCAAGCACGCCCAGGAGGGACTTGCCAAGCTCACATCC
ACCCCTGTGACCAAAGTCTAG
Transcript >OphauB2|7219
ATGGCCGGCTCTGCAGGCGCGTCGCTGAGACTGCTCCAGCAGTCATGTCTGCGCCATGGCTTGTCATCACCTCGT
CTTGGCCTACGCTGGACTCATCCCACACTGGCGGCTGCTGTGGCTCCTGGCTATTTACAGAGGCGACATGAATCG
TCAGCCAAGGAGCCAGCGTCGCCCAAAGATTCAGCCAAGCGGCCAGAAAACATGAACCCAGAGCCCAAATACACC
TTCCGCCAAGCTGTAGGAATCACCTTTGTCAACAGTTTCCGAAATCTGGGCATAGCTCTCAGCCCGCGCGGCATA
CGCTCCGCCTACAACGACTTGCCCGTCGTGACGAGTCTGCTGCTCATTGCCCTCTTGGCCACTTTTGGCATCGGA
GCCTACGCTCTACACTCTTATATGAGCTTCTTCTATGGCCCCAACTTTAGCCAATTCCCCGACCCCGTTGCAAAT
ACCCTGCGCCGCGCCATCTACTGCACAAACATCAAGCCCGATCCCGAACTTGCGCTGCGCTACTACAAAAAGGCT
ATGCAACAGTGCATCGACTTGGATCTAGACCCCTTTTCTGACCCAGTCCTCGGAATCCGTATGTATGTTGCTCAG
TGGCTAGAATCCATACACAACTTCAAGCTCGCCATTGATGTTCTTGAATCAGTCCTTCAAGACTGCAAAAAATGG
GTAGCCGTCATGGAACAGTCGAATCAGGAAGGAAAAGTGGATGATAGAGGGCGGCTGGTGCAGCCTGATTCGGAG
CCCGTCCCCGTTGGAAAGGCTTCTGACGACACGCCCCCGCCAGAGACTCTTTGGAGAAAACGAGAGCGTCTGTTG
GCCAAAGCCATTGGCACCAGCGTCAAGTTGGGCGCATTATATGCCGACGAGCACGTCATGGAACCCGAAAAGTCG
CACCTTCATCTTGTATGGGCGGTGGAAACGGCTCTCAAAGAATTTCAGCGACGTCATGTTCAAGGCCCCAAACCG
GGCGAAGAAGCTTGGTTGACTCCCCAGGAGTTGGGTGGAGCGATGGAATCGCTTGCGCACAACTATGAGCGCAGA
TCGCAGTTTCATCTAGCTATTCCTCTCTTGATGCAAGCTCTGCGCCTTTGCGACAGCCCCTGCCACCGAGCTGTC
ATCATGAACAATCTTTCAGCTGTCTTTGCGCAGCAACCCATATTCTCTCCTGCCCAACCCCCCTCCGCGTCTTCC
ACTATCGAGGGGCTGGTGGAAACGGCTGTACCAACGTCGCGCAAAGAATGCTTCGAATCTGCCGAGAATTGGGCT
CAAAACGCCCTAGACCATGCTCAGGATGTCACAGGCGAGGAAAGAACGGCCGAGTGCGATGAGGCCTGCGCCGTC
GCCATGTGCAATTTGGCTGATGTGGCGGCTATGCTGGGCAAACCCGACGTGGCGCGCGCCAAATATCGAGAATGC
ATCGAGATGAGTAGCAAGATGGACTTCAAACAGGGTGTCAAGCACGCCCAGGAGGGACTTGCCAAGCTCACATCC
ACCCCTGTGACCAAAGTCTAG
Gene >OphauB2|7219
ATGGCCGGCTCTGCAGGCGCGTCGCTGAGACTGCTCCAGCAGTCATGTCTGCGCCATGGCTTGTCATCACCTCGT
CTTGGCCTACGCTGGACTCATCCCACACTGGCGGCTGCTGTGGCTCCTGGCTATTTACAGAGGCGACATGAATCG
TCAGCCAAGGAGCCAGCGTCGCCCAAAGATTCAGCCAAGCGGCCAGAAAACATGAACCCAGAGCCCAAATACACC
TTCCGCCAAGCTGTAGGAATCACCTTTGTCAACAGTTTCCGAAATCTGGGCATAGCTCTCAGCCCGCGCGGCATA
CGCTCCGCCTACAACGACTTGCCCGTCGTGACGAGTCTGCTGCTCATTGCGTGAGGTTTTTCTCCTTTTCATGGC
AACAAAACCGTCTACTGACCGCATCTGCAAGCCTCTTGGCCACTTTTGGCATCGGAGCCTACGCTCTACACTCTT
ATATGAGCTTCTTCTATGGCCCCAACTTTAGCCAATTCCCCGACCCCGTTGCAAATACCCTGCGCCGCGCCATCT
ACTGCACAAACATCAAGCCCGATCCCGAACTTGCGCTGCGCTACTACAAAAAGGCTATGCAACAGTGCATCGACT
TGGATCTAGACCCCTTTTCTGACCCAGTCCTCGGAATCCGTATGTATGTTGCTCAGTGGCTAGAATCCATACACA
ACTTCAAGCTCGCCATTGATGTTCTTGAATCAGTCCTTCAAGACTGCAAAAAATGGGTAGCCGTCATGGAACAGT
CGAATCAGGAAGGAAAAGTGGATGATAGAGGGCGGCTGGTGCAGCCTGATTCGGAGCCCGTCCCCGTTGGAAAGG
CTTCTGACGACACGCCCCCGCCAGAGACTCTTTGGAGAAAACGAGAGCGTCTGTTGGCCAAAGCCATTGGCACCA
GCGTCAAGTTGGGCGCATTATATGCCGACGAGCACGTCATGGAACCCGAAAAGTCGCACCTTCATCTTGTATGGG
CGGTGGAAACGGCTCTCAAAGAATTTCAGCGACGTCATGTTCAAGGCCCCAAACCGGGCGAAGAAGCTTGGTTGA
CTCCCCAGGAGTTGGGTGGAGCGATGGAATCGCTTGCGCACAACTATGAGCGCAGATCGCAGTTTCATCTAGCTA
TTCCTCTCTTGATGCAAGCTCTGCGCCTTTGCGACAGCCCCTGCCACCGAGCTGTCATCATGAACAATCTTTCAG
CTGTCTTTGCGCAGCAACCCATATTCTCTCCTGCCCAACCCCCCTCCGCGTCTTCCACTATCGAGGGGCTGGTGG
AAACGGCTGTACCAACGTCGCGCAAAGAATGCTTCGAATCTGCCGAGAATTGGGCTCAAAACGCCCTAGACCATG
CTCAGGATGTCACAGGCGAGGAAAGAACGGCCGAGTGCGATGAGGCCTGCGCCGTCGCCATGTGCAATTTGGCTG
ATGTGGCGGCTATGCTGGGCAAACCCGACGTGGCGCGCGCCAAATATCGAGAATGCATCGAGATGAGTAGCAAGA
TGGACTTCAAACAGGGTGTCAAGCACGCCCAGGAGGGACTTGCCAAGCTCACATCCACCCCTGTGACCAAAGTCT
AG

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail