Fungal Genomics

at Utrecht University

General Properties

Protein IDOphauB2|7218
Gene name
LocationContig_74:40920..42133
Strand+
Gene length (bp)1213
Transcript length (bp)1050
Coding sequence length (bp)1050
Protein length (aa) 350

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF04098 Rad52_Rad22 Rad52/22 family double-strand break repair protein 4.6E-59 29 178

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q8NK72|RAD52_MAGO7 DNA repair and recombination protein rhm52 OS=Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958) GN=RHM52 PE=2 SV=2 1 289 3.0E-122
sp|Q9HGI2|RAD52_NEUCR DNA repair and recombination protein mus-11 OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=mus-11 PE=3 SV=1 1 278 2.0E-108
sp|Q96UP6|RAD52_EMENI DNA repair and recombination protein radC OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=radC PE=3 SV=1 13 244 1.0E-76
sp|P36592|RAD22_SCHPO DNA repair and recombination protein rad22 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=rad22 PE=1 SV=2 25 208 7.0E-67
sp|O42905|RTI1_SCHPO DNA repair and recombination protein rti1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=rti1 PE=1 SV=1 24 229 2.0E-60
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q8NK72|RAD52_MAGO7 DNA repair and recombination protein rhm52 OS=Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958) GN=RHM52 PE=2 SV=2 1 289 3.0E-122
sp|Q9HGI2|RAD52_NEUCR DNA repair and recombination protein mus-11 OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=mus-11 PE=3 SV=1 1 278 2.0E-108
sp|Q96UP6|RAD52_EMENI DNA repair and recombination protein radC OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=radC PE=3 SV=1 13 244 1.0E-76
sp|P36592|RAD22_SCHPO DNA repair and recombination protein rad22 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=rad22 PE=1 SV=2 25 208 7.0E-67
sp|O42905|RTI1_SCHPO DNA repair and recombination protein rti1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=rti1 PE=1 SV=1 24 229 2.0E-60
sp|Q6BJ51|RAD52_DEBHA DNA repair and recombination protein RAD52 OS=Debaryomyces hansenii (strain ATCC 36239 / CBS 767 / JCM 1990 / NBRC 0083 / IGC 2968) GN=RAD52 PE=3 SV=1 25 200 2.0E-57
sp|P41768|RAD52_KLULA DNA repair and recombination protein RAD52 OS=Kluyveromyces lactis (strain ATCC 8585 / CBS 2359 / DSM 70799 / NBRC 1267 / NRRL Y-1140 / WM37) GN=RAD52 PE=3 SV=2 33 192 3.0E-56
sp|Q756F4|RAD52_ASHGO DNA repair and recombination protein RAD52 OS=Ashbya gossypii (strain ATCC 10895 / CBS 109.51 / FGSC 9923 / NRRL Y-1056) GN=RAD52 PE=3 SV=1 30 192 6.0E-56
sp|Q6FSW2|RAD52_CANGA DNA repair and recombination protein RAD52 OS=Candida glabrata (strain ATCC 2001 / CBS 138 / JCM 3761 / NBRC 0622 / NRRL Y-65) GN=RAD52 PE=3 SV=1 33 194 4.0E-54
sp|P06778|RAD52_YEAST DNA repair and recombination protein RAD52 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=RAD52 PE=1 SV=2 33 194 2.0E-53
sp|P43352|RAD52_MOUSE DNA repair protein RAD52 homolog OS=Mus musculus GN=Rad52 PE=2 SV=1 23 177 3.0E-48
sp|P43351|RAD52_HUMAN DNA repair protein RAD52 homolog OS=Homo sapiens GN=RAD52 PE=1 SV=1 24 177 1.0E-47
sp|P39022|RAD52_CHICK DNA repair protein RAD52 homolog OS=Gallus gallus GN=RAD52 PE=2 SV=1 24 183 3.0E-47
sp|Q6FWE1|RAD59_CANGA DNA repair protein RAD59 OS=Candida glabrata (strain ATCC 2001 / CBS 138 / JCM 3761 / NBRC 0622 / NRRL Y-65) GN=RAD59 PE=3 SV=1 23 158 1.0E-11
sp|Q757G7|RAD59_ASHGO DNA repair protein RAD59 OS=Ashbya gossypii (strain ATCC 10895 / CBS 109.51 / FGSC 9923 / NRRL Y-1056) GN=RAD59 PE=3 SV=1 23 158 5.0E-11
sp|Q9HEU2|RAD59_KLULA DNA repair protein RAD59 OS=Kluyveromyces lactis (strain ATCC 8585 / CBS 2359 / DSM 70799 / NBRC 1267 / NRRL Y-1140 / WM37) GN=RAD59 PE=3 SV=1 23 158 2.0E-10
sp|Q12223|RAD59_YEAST DNA repair protein RAD59 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=RAD59 PE=1 SV=1 23 158 1.0E-07
[Show less]

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 22 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >OphauB2|7218
MPAPGQQHTPWMNPFEEAKPRISEWTAKEIATISSKLDKQLGPEYISSRAGPGGSRVHYLTAEKCIGLANEVFGF
NGWSSSIQNIQVDFADENPQTQRVSIGLSVIVRVTLRDGTYHEDIGYGSIENARGKAMAFEKAKKEGTTDGLKRA
LRSFGNVLGNCIYDQGYVKQVTKVKAQPVKKFDEYNLHRHADFVKKDLVKLEAASNATAIALQAEPSESFEDYLG
ELDEADFCVPGDGHPDEVTLPNLGPAQGPNDKASTNQQATNRQLSRTASTGSIGRPLQGPNAPNRTSATNHDAQG
REGPNSMAQPLPRPAPQQTGNVSEPVSFFSARSVNIKLEESNAGGKPVY*
Coding >OphauB2|7218
ATGCCTGCACCAGGCCAACAACACACACCATGGATGAACCCCTTTGAAGAGGCCAAACCTCGCATATCAGAATGG
ACGGCCAAGGAAATCGCAACCATATCGTCCAAGCTTGACAAGCAATTAGGGCCCGAGTATATATCATCCAGGGCT
GGTCCGGGCGGCTCCAGAGTTCATTATCTGACGGCAGAAAAATGCATCGGTCTAGCCAACGAGGTTTTTGGCTTC
AACGGCTGGTCGTCATCCATTCAAAATATCCAGGTCGACTTTGCCGATGAGAATCCACAGACACAGCGCGTCAGC
ATTGGCCTTTCTGTTATTGTCCGAGTCACCTTGCGAGACGGTACATACCACGAAGACATTGGCTACGGATCAATA
GAAAATGCAAGGGGAAAGGCCATGGCGTTTGAAAAGGCGAAAAAGGAGGGCACTACGGACGGATTGAAGCGTGCT
CTGCGGAGCTTTGGCAATGTGCTGGGTAACTGCATATACGACCAAGGATACGTCAAACAAGTTACCAAGGTCAAG
GCGCAGCCAGTCAAGAAGTTTGACGAGTACAATCTTCACCGGCACGCTGATTTTGTGAAGAAGGACTTGGTCAAG
CTTGAAGCAGCGAGCAACGCCACAGCTATTGCTCTCCAGGCCGAGCCATCCGAGTCGTTTGAAGACTATCTTGGA
GAGCTCGATGAGGCCGACTTTTGCGTCCCAGGGGACGGTCATCCAGATGAAGTCACGCTGCCCAACCTAGGTCCA
GCCCAAGGTCCCAATGACAAGGCCAGCACCAATCAGCAAGCCACGAACCGGCAACTCAGTCGCACTGCATCGACA
GGTAGCATCGGCCGGCCGCTACAAGGACCAAATGCTCCAAATCGAACGTCAGCAACTAACCACGACGCTCAGGGC
CGAGAAGGCCCCAACAGTATGGCTCAGCCTCTGCCACGACCGGCGCCGCAGCAAACTGGCAACGTTTCTGAGCCC
GTTTCCTTCTTTTCAGCCAGATCCGTCAATATAAAGTTGGAAGAGAGCAATGCTGGCGGAAAGCCCGTCTATTAG
Transcript >OphauB2|7218
ATGCCTGCACCAGGCCAACAACACACACCATGGATGAACCCCTTTGAAGAGGCCAAACCTCGCATATCAGAATGG
ACGGCCAAGGAAATCGCAACCATATCGTCCAAGCTTGACAAGCAATTAGGGCCCGAGTATATATCATCCAGGGCT
GGTCCGGGCGGCTCCAGAGTTCATTATCTGACGGCAGAAAAATGCATCGGTCTAGCCAACGAGGTTTTTGGCTTC
AACGGCTGGTCGTCATCCATTCAAAATATCCAGGTCGACTTTGCCGATGAGAATCCACAGACACAGCGCGTCAGC
ATTGGCCTTTCTGTTATTGTCCGAGTCACCTTGCGAGACGGTACATACCACGAAGACATTGGCTACGGATCAATA
GAAAATGCAAGGGGAAAGGCCATGGCGTTTGAAAAGGCGAAAAAGGAGGGCACTACGGACGGATTGAAGCGTGCT
CTGCGGAGCTTTGGCAATGTGCTGGGTAACTGCATATACGACCAAGGATACGTCAAACAAGTTACCAAGGTCAAG
GCGCAGCCAGTCAAGAAGTTTGACGAGTACAATCTTCACCGGCACGCTGATTTTGTGAAGAAGGACTTGGTCAAG
CTTGAAGCAGCGAGCAACGCCACAGCTATTGCTCTCCAGGCCGAGCCATCCGAGTCGTTTGAAGACTATCTTGGA
GAGCTCGATGAGGCCGACTTTTGCGTCCCAGGGGACGGTCATCCAGATGAAGTCACGCTGCCCAACCTAGGTCCA
GCCCAAGGTCCCAATGACAAGGCCAGCACCAATCAGCAAGCCACGAACCGGCAACTCAGTCGCACTGCATCGACA
GGTAGCATCGGCCGGCCGCTACAAGGACCAAATGCTCCAAATCGAACGTCAGCAACTAACCACGACGCTCAGGGC
CGAGAAGGCCCCAACAGTATGGCTCAGCCTCTGCCACGACCGGCGCCGCAGCAAACTGGCAACGTTTCTGAGCCC
GTTTCCTTCTTTTCAGCCAGATCCGTCAATATAAAGTTGGAAGAGAGCAATGCTGGCGGAAAGCCCGTCTATTAG
Gene >OphauB2|7218
ATGCCTGCGTAAGGGTTACTTCTTGCGCGTCTTGCCTATGTCTTTTTGGGAGACGCGTTGCTGATAGTCAAGAGC
TTCAGACCAGGCCAACAACACACACCATGGATGAACCCCTTTGAAGAGGCCAAACCTCGCATATCAGAATGGACG
GCCAAGGAAATCGCAACCATATCGTCCAAGCTTGACAAGCAATTAGGGCCCGAGTATATATCATCCAGGGCTGGT
CCGGGCGGCTCCAGAGTTCATTATCTGACGGCAGAAAAATGCATCGGTCTAGCCAACGAGGTTTTTGGCTTCAAC
GGCTGGTCGTCATCCATTCAAAATATCCAGGTCGACTTTGCCGATGAGAATCCACAGACACAGCGCGTCAGCATT
GGCCTTTCTGTTATTGTCCGAGTCACCTTGCGAGACGGTACATACCACGAAGACATTGGCTACGGATCAATAGAA
AATGCAAGGGGAAAGGCCATGGCGTTTGAAAAGGCGAAAAAGGAGGGCACTACGGACGGATTGAAGCGTGCTCTG
CGGAGCTTTGGCAATGTGCTGGGTAACTGCATATACGACCAAGGATACGTCAAACAAGTTACCAAGGTCAAGGCG
CAGCCAGTCAAGAAGTTTGACGAGTACAATCTTCACCGGCACGCTGATTTTGTGAAGAAGGACTTGGTCAAGCTT
GAAGCAGCGAGCAACGCCACAGCTATTGCTCTCCAGGCCGAGCCATCCGAGTCGTTTGAAGACTATCTTGGAGGT
ATGCTCTCGTCGGATGCGTTTCATGATATCGAGGCTGAAGAGTCATAGAGCTCGATGAGGCCGACTTTTGCGTCC
CAGGGGACGGTCATCCAGATGAAGTCACGCTGCCCAACCTAGGTCCAGCCCAAGGTCCCAATGACAAGGCCAGCA
CCAATCAGCAAGCCACGAACCGGCAACTCAGTCGCACTGCATCGACAGGTAGCATCGGCCGGCCGCTACAAGGAC
CAAATGCTCCAAATCGAACGTCAGCAACTAACCACGACGCTCAGGGCCGAGAAGGCCCCAACAGTATGGCTCAGC
CTCTGCCACGACCGGCGCCGCAGCAAACTGGCAACGTTTCTGAGCCCGTTTCCTTCTTTTCAGCCAGATCCGTCA
ATATAAAGTTGGAAGAGAGCAATGCTGGTCAGCTTGCTAGCCCCCAACGGCAACTTTTCAACCCCAAGGCGGAAA
GCCCGTCTATTAG

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail