Fungal Genomics

at Utrecht University

General Properties

Protein IDOphauB2|7212
Gene name
LocationContig_74:23184..23927
Strand+
Gene length (bp)743
Transcript length (bp)690
Coding sequence length (bp)690
Protein length (aa) 230

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF06687 SUR7 SUR7/PalI family 3.3E-18 11 188

Swissprot hits

Swissprot ID Swissprot Description Start End E-value
sp|Q51MB1|PALI_MAGO7 pH-response regulator protein palI/RIM9 OS=Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958) GN=RIM9 PE=3 SV=1 51 212 1.0E-08
sp|Q08157|YOL19_YEAST Uncharacterized membrane protein YOL019W OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=YOL019W PE=1 SV=1 16 206 4.0E-08

GO

GO Term Description Terminal node
GO:0005886 plasma membrane Yes
GO:0110165 cellular anatomical entity No
GO:0016020 membrane No
GO:0005575 cellular_component No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
Yes 1 - 31 0.45

Transmembrane Domains

Domain # Start End Length
1 10 32 22
2 106 128 22
3 133 155 22
4 175 197 22

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >OphauB2|7212
MGVGTFIHHIGTALLLVSLVLLIVVDVTAPVVNKRAIMRVHLGNTVPGTQVTFGTFGYCHRGLRDSDQCSHSRIG
YNPAAVMSSIDGSRFSKGAERSAKLLTRIMVLHPIATFLCFIALLLCLAAGMLGSFLAAIFAALAFLTTLIAMIC
DFVLFSIVKHDVNKNGRSRARWSSGIWLMLVSAICTLLASAIVFATCCVRRSSKRRTTHNKETWTETTPVTRRPF
WQRR*
Coding >OphauB2|7212
ATGGGTGTCGGCACCTTTATCCACCACATTGGCACAGCCCTGCTGCTTGTGTCCCTGGTGCTGCTCATCGTTGTC
GACGTGACTGCGCCTGTCGTCAACAAGCGAGCCATTATGCGTGTCCATCTGGGCAACACGGTTCCTGGCACCCAA
GTCACCTTTGGCACCTTTGGCTACTGCCATCGCGGCCTTCGCGACTCGGATCAGTGCTCCCACTCGCGCATCGGC
TACAACCCTGCTGCCGTCATGTCGAGCATCGACGGCTCCAGATTCAGCAAAGGCGCTGAACGCAGCGCCAAGCTG
CTCACCCGCATCATGGTGCTGCATCCCATTGCCACCTTTTTGTGCTTCATCGCCCTGCTCCTCTGCCTCGCCGCC
GGCATGCTGGGCTCTTTTCTCGCCGCCATCTTTGCCGCCCTGGCCTTCCTCACCACCCTCATTGCCATGATTTGC
GACTTTGTCCTCTTCAGCATCGTCAAGCACGACGTCAACAAGAACGGCCGCAGCCGGGCCCGCTGGAGCTCGGGC
ATCTGGCTCATGCTCGTCTCTGCCATTTGCACCCTCCTGGCTTCAGCCATTGTCTTTGCCACGTGCTGTGTGAGA
CGCTCAAGCAAGCGTCGCACAACACACAACAAGGAGACGTGGACCGAAACCACTCCCGTCACGCGCCGCCCATTC
TGGCAGCGCCGCTAA
Transcript >OphauB2|7212
ATGGGTGTCGGCACCTTTATCCACCACATTGGCACAGCCCTGCTGCTTGTGTCCCTGGTGCTGCTCATCGTTGTC
GACGTGACTGCGCCTGTCGTCAACAAGCGAGCCATTATGCGTGTCCATCTGGGCAACACGGTTCCTGGCACCCAA
GTCACCTTTGGCACCTTTGGCTACTGCCATCGCGGCCTTCGCGACTCGGATCAGTGCTCCCACTCGCGCATCGGC
TACAACCCTGCTGCCGTCATGTCGAGCATCGACGGCTCCAGATTCAGCAAAGGCGCTGAACGCAGCGCCAAGCTG
CTCACCCGCATCATGGTGCTGCATCCCATTGCCACCTTTTTGTGCTTCATCGCCCTGCTCCTCTGCCTCGCCGCC
GGCATGCTGGGCTCTTTTCTCGCCGCCATCTTTGCCGCCCTGGCCTTCCTCACCACCCTCATTGCCATGATTTGC
GACTTTGTCCTCTTCAGCATCGTCAAGCACGACGTCAACAAGAACGGCCGCAGCCGGGCCCGCTGGAGCTCGGGC
ATCTGGCTCATGCTCGTCTCTGCCATTTGCACCCTCCTGGCTTCAGCCATTGTCTTTGCCACGTGCTGTGTGAGA
CGCTCAAGCAAGCGTCGCACAACACACAACAAGGAGACGTGGACCGAAACCACTCCCGTCACGCGCCGCCCATTC
TGGCAGCGCCGCTAA
Gene >OphauB2|7212
ATGGGTGTCGGCACCTTTATCCACCACATTGGCACAGCCCTGCTGCTTGTGTCCCTGGTGCTGCTCATCGTTGTC
GACGTGACTGCGCCTGTCGTCAACAAGCGAGCCATTATGCGTGTCCATCTGGGCAACACGGTTCCTGGCACCCAA
GTCACCTTTGGCACCTTTGGCTACTGCCATCGCGGCCTTCGGTAAGCCGACTTGTCGCTCCTCATCATGACTCGA
TACTGACGCTCCCGCACAGCGACTCGGATCAGTGCTCCCACTCGCGCATCGGCTACAACCCTGCTGCCGTCATGT
CGAGCATCGACGGCTCCAGATTCAGCAAAGGCGCTGAACGCAGCGCCAAGCTGCTCACCCGCATCATGGTGCTGC
ATCCCATTGCCACCTTTTTGTGCTTCATCGCCCTGCTCCTCTGCCTCGCCGCCGGCATGCTGGGCTCTTTTCTCG
CCGCCATCTTTGCCGCCCTGGCCTTCCTCACCACCCTCATTGCCATGATTTGCGACTTTGTCCTCTTCAGCATCG
TCAAGCACGACGTCAACAAGAACGGCCGCAGCCGGGCCCGCTGGAGCTCGGGCATCTGGCTCATGCTCGTCTCTG
CCATTTGCACCCTCCTGGCTTCAGCCATTGTCTTTGCCACGTGCTGTGTGAGACGCTCAAGCAAGCGTCGCACAA
CACACAACAAGGAGACGTGGACCGAAACCACTCCCGTCACGCGCCGCCCATTCTGGCAGCGCCGCTAA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail