Fungal Genomics

at Utrecht University

General Properties

Protein IDOphauB2|7196
Gene name
LocationContig_73:69314..70617
Strand+
Gene length (bp)1303
Transcript length (bp)1119
Coding sequence length (bp)1119
Protein length (aa) 373

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF01370 Epimerase NAD dependent epimerase/dehydratase family 4.5E-47 6 281
PF16363 GDP_Man_Dehyd GDP-mannose 4,6 dehydratase 1.5E-46 7 343
PF01073 3Beta_HSD 3-beta hydroxysteroid dehydrogenase/isomerase family 1.4E-15 7 272
PF02719 Polysacc_synt_2 Polysaccharide biosynthesis protein 7.5E-12 6 129
PF04321 RmlD_sub_bind RmlD substrate binding domain 7.2E-12 5 169
PF00106 adh_short short chain dehydrogenase 1.6E-09 5 129
PF08659 KR KR domain 9.1E-08 4 136
PF07993 NAD_binding_4 Male sterility protein 9.4E-05 8 171

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|P04397|GAL10_YEAST Bifunctional protein GAL10 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=GAL10 PE=1 SV=2 6 356 2.0E-140
sp|Q9HDU3|GAL10_SCHPO Bifunctional protein gal10 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=gal10 PE=3 SV=1 6 356 2.0E-139
sp|Q9Y7X5|UGE1_SCHPO UDP-glucose 4-epimerase uge1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=uge1 PE=1 SV=1 4 355 6.0E-138
sp|P40801|GAL10_PACTA Bifunctional protein GAL10 OS=Pachysolen tannophilus GN=GAL10 PE=2 SV=1 6 356 2.0E-135
sp|P09609|GAL10_KLULA Bifunctional protein GAL10 OS=Kluyveromyces lactis (strain ATCC 8585 / CBS 2359 / DSM 70799 / NBRC 1267 / NRRL Y-1140 / WM37) GN=GAL10 PE=2 SV=2 6 356 3.0E-129
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|P04397|GAL10_YEAST Bifunctional protein GAL10 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=GAL10 PE=1 SV=2 6 356 2.0E-140
sp|Q9HDU3|GAL10_SCHPO Bifunctional protein gal10 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=gal10 PE=3 SV=1 6 356 2.0E-139
sp|Q9Y7X5|UGE1_SCHPO UDP-glucose 4-epimerase uge1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=uge1 PE=1 SV=1 4 355 6.0E-138
sp|P40801|GAL10_PACTA Bifunctional protein GAL10 OS=Pachysolen tannophilus GN=GAL10 PE=2 SV=1 6 356 2.0E-135
sp|P09609|GAL10_KLULA Bifunctional protein GAL10 OS=Kluyveromyces lactis (strain ATCC 8585 / CBS 2359 / DSM 70799 / NBRC 1267 / NRRL Y-1140 / WM37) GN=GAL10 PE=2 SV=2 6 356 3.0E-129
sp|Q8R059|GALE_MOUSE UDP-glucose 4-epimerase OS=Mus musculus GN=Gale PE=1 SV=1 6 355 8.0E-117
sp|P55180|GALE_BACSU UDP-glucose 4-epimerase OS=Bacillus subtilis (strain 168) GN=galE PE=3 SV=1 6 357 7.0E-116
sp|Q5R8D0|GALE_PONAB UDP-glucose 4-epimerase OS=Pongo abelii GN=GALE PE=2 SV=1 6 355 2.0E-115
sp|Q3T105|GALE_BOVIN UDP-glucose 4-epimerase OS=Bos taurus GN=GALE PE=2 SV=2 6 355 3.0E-115
sp|Q14376|GALE_HUMAN UDP-glucose 4-epimerase OS=Homo sapiens GN=GALE PE=1 SV=2 6 355 1.0E-114
sp|P09147|GALE_ECOLI UDP-glucose 4-epimerase OS=Escherichia coli (strain K12) GN=galE PE=1 SV=1 6 355 1.0E-114
sp|Q56093|GALE_SALTI UDP-glucose 4-epimerase OS=Salmonella typhi GN=galE PE=3 SV=2 6 355 2.0E-114
sp|P22715|GALE_SALTY UDP-glucose 4-epimerase OS=Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) GN=galE PE=3 SV=2 6 355 3.0E-114
sp|Q553X7|GALE_DICDI UDP-glucose 4-epimerase OS=Dictyostelium discoideum GN=galE PE=1 SV=1 6 355 3.0E-113
sp|P35673|GALE_ERWAM UDP-glucose 4-epimerase OS=Erwinia amylovora GN=galE PE=3 SV=1 5 354 4.0E-112
sp|P24325|GALE_HAEIN UDP-glucose 4-epimerase OS=Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd) GN=galE PE=3 SV=2 6 356 5.0E-112
sp|Q9F7D4|GALE_YERPE UDP-glucose 4-epimerase OS=Yersinia pestis GN=galE PE=3 SV=1 6 355 1.0E-111
sp|P18645|GALE_RAT UDP-glucose 4-epimerase OS=Rattus norvegicus GN=Gale PE=2 SV=1 6 354 2.0E-110
sp|P56985|GALE_NEIMB UDP-glucose 4-epimerase OS=Neisseria meningitidis serogroup B (strain MC58) GN=galE PE=3 SV=1 6 355 7.0E-109
sp|P56997|GALE_NEIMA UDP-glucose 4-epimerase OS=Neisseria meningitidis serogroup A / serotype 4A (strain Z2491) GN=galE PE=3 SV=1 6 355 2.0E-108
sp|Q9W0P5|GALE_DROME UDP-glucose 4-epimerase OS=Drosophila melanogaster GN=Gale PE=1 SV=1 1 355 3.0E-108
sp|Q9SN58|UGE5_ARATH UDP-glucose 4-epimerase 5 OS=Arabidopsis thaliana GN=UGE5 PE=1 SV=3 1 355 6.0E-108
sp|Q57301|GALE_YEREN UDP-glucose 4-epimerase OS=Yersinia enterocolitica GN=galE PE=3 SV=1 5 355 6.0E-108
sp|Q9CNY5|GALE_PASMU UDP-glucose 4-epimerase OS=Pasteurella multocida (strain Pm70) GN=galE PE=3 SV=1 6 356 1.0E-106
sp|O65781|GALE2_CYATE UDP-glucose 4-epimerase GEPI48 OS=Cyamopsis tetragonoloba PE=2 SV=1 1 355 2.0E-106
sp|P56986|GALE_NEIMC UDP-glucose 4-epimerase OS=Neisseria meningitidis serogroup C GN=galE PE=3 SV=1 6 355 3.0E-106
sp|Q59678|GALE_MANHA UDP-glucose 4-epimerase OS=Mannheimia haemolytica GN=galE PE=3 SV=1 6 356 9.0E-105
sp|Q05026|GALE_NEIGO UDP-glucose 4-epimerase OS=Neisseria gonorrhoeae GN=galE PE=3 SV=1 5 355 2.0E-104
sp|Q9T0A7|UGE2_ARATH UDP-glucose 4-epimerase 2 OS=Arabidopsis thaliana GN=UGE2 PE=1 SV=1 5 352 5.0E-104
sp|Q8LNZ3|UGE1_ORYSJ UDP-glucose 4-epimerase 1 OS=Oryza sativa subsp. japonica GN=UGE-1 PE=2 SV=1 5 355 2.0E-103
sp|Q6K2E1|UGE4_ORYSJ UDP-glucose 4-epimerase 4 OS=Oryza sativa subsp. japonica GN=UGE-4 PE=2 SV=1 5 355 1.0E-101
sp|Q6ZDJ7|UGE2_ORYSJ UDP-glucose 4-epimerase 2 OS=Oryza sativa subsp. japonica GN=UGE-2 PE=2 SV=1 2 355 3.0E-101
sp|Q9C7W7|UGE4_ARATH UDP-glucose 4-epimerase 4 OS=Arabidopsis thaliana GN=UGE4 PE=1 SV=1 3 359 9.0E-100
sp|B0M3E8|UGE1_PEA Bifunctional UDP-glucose 4-epimerase and UDP-xylose 4-epimerase 1 OS=Pisum sativum GN=UGE1 PE=1 SV=2 6 359 9.0E-99
sp|Q43070|GALE1_PEA UDP-glucose 4-epimerase OS=Pisum sativum GN=GALE PE=2 SV=1 6 359 7.0E-98
sp|E8MF10|GALE_BIFL2 UDP-glucose 4-epimerase OS=Bifidobacterium longum subsp. longum (strain ATCC 15707 / DSM 20219 / JCM 1217 / NCTC 11818 / E194b) GN=lnpD PE=1 SV=1 5 356 1.0E-97
sp|Q42605|UGE1_ARATH Bifunctional UDP-glucose 4-epimerase and UDP-xylose 4-epimerase 1 OS=Arabidopsis thaliana GN=UGE1 PE=1 SV=2 5 358 2.0E-94
sp|O65780|GALE1_CYATE UDP-glucose 4-epimerase GEPI42 OS=Cyamopsis tetragonoloba PE=2 SV=1 1 356 4.0E-94
sp|Q652A8|UGE3_ORYSJ UDP-glucose 4-epimerase 3 OS=Oryza sativa subsp. japonica GN=UGE-3 PE=2 SV=1 2 355 5.0E-93
sp|Q8LDN8|UGE3_ARATH Bifunctional UDP-glucose 4-epimerase and UDP-xylose 4-epimerase 3 OS=Arabidopsis thaliana GN=UGE3 PE=1 SV=1 5 359 2.0E-91
sp|Q9KDV3|GALE_BACHD UDP-glucose 4-epimerase OS=Bacillus halodurans (strain ATCC BAA-125 / DSM 18197 / FERM 7344 / JCM 9153 / C-125) GN=galE PE=3 SV=1 6 358 2.0E-76
sp|O84903|GALE_LACCA UDP-glucose 4-epimerase OS=Lactobacillus casei GN=galE PE=3 SV=1 5 355 2.0E-69
sp|P96995|GALE_STRMU UDP-glucose 4-epimerase OS=Streptococcus mutans serotype c (strain ATCC 700610 / UA159) GN=galE PE=3 SV=2 6 355 4.0E-67
sp|P33119|GALE_CORDI UDP-glucose 4-epimerase OS=Corynebacterium diphtheriae (strain ATCC 700971 / NCTC 13129 / Biotype gravis) GN=galE PE=3 SV=2 6 350 1.0E-66
sp|Q45291|GALE_CORGL UDP-glucose 4-epimerase OS=Corynebacterium glutamicum (strain ATCC 13032 / DSM 20300 / JCM 1318 / LMG 3730 / NCIMB 10025) GN=galE PE=3 SV=2 6 347 2.0E-64
sp|Q8H0B2|ARAE3_ORYSJ Probable UDP-arabinose 4-epimerase 3 OS=Oryza sativa subsp. japonica GN=UEL-3 PE=2 SV=1 2 355 3.0E-64
sp|P21977|GALE_STRTR UDP-glucose 4-epimerase OS=Streptococcus thermophilus GN=galE PE=3 SV=1 6 355 1.0E-63
sp|Q7WTB1|GALE_LACHE UDP-glucose 4-epimerase OS=Lactobacillus helveticus GN=galE PE=2 SV=1 6 358 4.0E-63
sp|Q8H0B6|ARAE2_ORYSJ Probable UDP-arabinose 4-epimerase 2 OS=Oryza sativa subsp. japonica GN=UEL-2 PE=2 SV=1 1 355 6.0E-62
sp|Q9SA77|ARAE1_ARATH UDP-arabinose 4-epimerase 1 OS=Arabidopsis thaliana GN=MUR4 PE=1 SV=1 3 355 9.0E-62
sp|Q8H930|ARAE1_ORYSJ Probable UDP-arabinose 4-epimerase 1 OS=Oryza sativa subsp. japonica GN=UEL-1 PE=2 SV=2 3 364 8.0E-61
sp|Q59745|EXOB_RHILT UDP-glucose 4-epimerase OS=Rhizobium leguminosarum bv. trifolii GN=exoB PE=3 SV=1 1 353 4.0E-60
sp|Q9FI17|ARAE4_ARATH Putative UDP-arabinose 4-epimerase 4 OS=Arabidopsis thaliana GN=At5g44480 PE=3 SV=1 3 355 4.0E-60
sp|Q9SUN3|ARAE3_ARATH Probable UDP-arabinose 4-epimerase 3 OS=Arabidopsis thaliana GN=At4g20460 PE=2 SV=3 3 355 1.0E-58
sp|O64749|ARAE2_ARATH Putative UDP-arabinose 4-epimerase 2 OS=Arabidopsis thaliana GN=At2g34850 PE=2 SV=3 3 355 2.0E-58
sp|P13226|GALE_STRLI UDP-glucose 4-epimerase OS=Streptomyces lividans GN=galE PE=3 SV=2 4 355 7.0E-58
sp|P26503|EXOB_RHIME UDP-glucose 4-epimerase OS=Rhizobium meliloti (strain 1021) GN=exoB PE=3 SV=1 1 354 1.0E-56
sp|P56600|GAL10_CANMA Bifunctional protein GAL10 (Fragment) OS=Candida maltosa GN=GAL10 PE=3 SV=1 1 150 3.0E-50
sp|Q59083|EXOB_AZOBR UDP-glucose 4-epimerase OS=Azospirillum brasilense GN=exoB PE=3 SV=1 6 331 7.0E-50
sp|P75517|GALE_MYCPN UDP-glucose 4-epimerase OS=Mycoplasma pneumoniae (strain ATCC 29342 / M129) GN=galE PE=3 SV=1 6 343 6.0E-38
sp|P45602|GALE_KLEPN UDP-glucose 4-epimerase (Fragment) OS=Klebsiella pneumoniae GN=galE PE=3 SV=1 6 134 3.0E-35
sp|Q57664|GALE_METJA Putative UDP-glucose 4-epimerase OS=Methanocaldococcus jannaschii (strain ATCC 43067 / DSM 2661 / JAL-1 / JCM 10045 / NBRC 100440) GN=MJ0211 PE=3 SV=1 6 351 1.0E-29
sp|P47364|GALE_MYCGE UDP-glucose 4-epimerase OS=Mycoplasma genitalium (strain ATCC 33530 / G-37 / NCTC 10195) GN=galE PE=3 SV=1 6 350 6.0E-29
sp|P39630|RMLB_BACSU dTDP-glucose 4,6-dehydratase OS=Bacillus subtilis (strain 168) GN=rfbB PE=1 SV=1 5 351 2.0E-17
sp|O22141|GAE4_ARATH UDP-glucuronate 4-epimerase 4 OS=Arabidopsis thaliana GN=GAE4 PE=1 SV=1 5 347 1.0E-13
sp|Q2SYH7|WBIB_BURTA dTDP-L-rhamnose 4-epimerase OS=Burkholderia thailandensis (strain E264 / ATCC 700388 / DSM 13276 / CIP 106301) GN=wbiB PE=1 SV=1 6 351 2.0E-13
sp|A0QSK6|RMLB_MYCS2 dTDP-glucose 4,6-dehydratase OS=Mycobacterium smegmatis (strain ATCC 700084 / mc(2)155) GN=rmlB PE=1 SV=1 6 356 7.0E-13
sp|P39858|CAPI_STAAU Protein CapI OS=Staphylococcus aureus GN=capI PE=3 SV=1 6 347 8.0E-13
sp|Q9D665|D42E1_MOUSE Short-chain dehydrogenase/reductase family 42E member 1 OS=Mus musculus GN=Sdr42e1 PE=1 SV=1 5 293 3.0E-12
sp|Q9LIS3|GAE6_ARATH UDP-glucuronate 4-epimerase 6 OS=Arabidopsis thaliana GN=GAE6 PE=1 SV=1 5 347 3.0E-12
sp|O81312|GAE3_ARATH UDP-glucuronate 4-epimerase 3 OS=Arabidopsis thaliana GN=GAE3 PE=2 SV=1 5 347 3.0E-12
sp|A6QLW2|TGDS_BOVIN dTDP-D-glucose 4,6-dehydratase OS=Bos taurus GN=TGDS PE=2 SV=1 6 299 9.0E-12
sp|Q9LPC1|GAE2_ARATH UDP-glucuronate 4-epimerase 2 OS=Arabidopsis thaliana GN=GAE2 PE=2 SV=1 5 347 1.0E-11
sp|O95455|TGDS_HUMAN dTDP-D-glucose 4,6-dehydratase OS=Homo sapiens GN=TGDS PE=1 SV=1 6 299 1.0E-11
sp|Q4R7R1|D42E1_MACFA Short-chain dehydrogenase/reductase family 42E member 1 OS=Macaca fascicularis GN=SDR42E1 PE=2 SV=1 5 293 2.0E-11
sp|Q9STI6|GAE5_ARATH UDP-glucuronate 4-epimerase 5 OS=Arabidopsis thaliana GN=GAE5 PE=2 SV=1 5 347 2.0E-11
sp|O06485|YFNG_BACSU Putative sugar dehydratase/epimerase YfnG OS=Bacillus subtilis (strain 168) GN=yfnG PE=3 SV=2 6 347 2.0E-11
sp|P14169|RFBE_SALTI CDP-paratose 2-epimerase OS=Salmonella typhi GN=rfbE PE=1 SV=2 6 138 4.0E-11
sp|Q8VDR7|TGDS_MOUSE dTDP-D-glucose 4,6-dehydratase OS=Mus musculus GN=Tgds PE=2 SV=2 6 356 8.0E-11
sp|Q9M0B6|GAE1_ARATH UDP-glucuronate 4-epimerase 1 OS=Arabidopsis thaliana GN=GAE1 PE=1 SV=1 5 166 9.0E-11
sp|P44914|RMLB_HAEIN dTDP-glucose 4,6-dehydratase OS=Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd) GN=rffG PE=3 SV=1 6 347 2.0E-10
sp|Q04871|YCL2_ECO11 Uncharacterized 37.6 kDa protein in cld 5'region OS=Escherichia coli O111:H- PE=3 SV=1 7 350 3.0E-10
sp|P9WN65|RMLB_MYCTU dTDP-glucose 4,6-dehydratase OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=rmlB PE=1 SV=1 6 358 3.0E-10
sp|P9WN64|RMLB_MYCTO dTDP-glucose 4,6-dehydratase OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) GN=rmlB PE=3 SV=1 6 358 3.0E-10
sp|D4GU72|AGL12_HALVD Low-salt glycan biosynthesis protein Agl12 OS=Haloferax volcanii (strain ATCC 29605 / DSM 3757 / JCM 8879 / NBRC 14742 / NCIMB 2012 / VKM B-1768 / DS2) GN=agl12 PE=3 SV=1 6 345 4.0E-10
sp|A6NKP2|D42E2_HUMAN Putative short-chain dehydrogenase/reductase family 42E member 2 OS=Homo sapiens GN=SDR42E2 PE=3 SV=3 6 292 8.0E-10
sp|Q7BJX9|GNE_PLESH UDP-N-acetylglucosamine 4-epimerase OS=Plesiomonas shigelloides GN=wbgU PE=1 SV=1 5 339 2.0E-09
sp|Q8WUS8|D42E1_HUMAN Short-chain dehydrogenase/reductase family 42E member 1 OS=Homo sapiens GN=SDR42E1 PE=2 SV=2 5 293 2.0E-09
sp|Q58455|Y1055_METJA Uncharacterized protein MJ1055 OS=Methanocaldococcus jannaschii (strain ATCC 43067 / DSM 2661 / JAL-1 / JCM 10045 / NBRC 100440) GN=MJ1055 PE=3 SV=1 1 351 3.0E-09
sp|Q8X7P7|GNU_ECO57 N-acetyl-alpha-D-glucosaminyl-diphospho-ditrans,octacis-undecaprenol 4-epimerase OS=Escherichia coli O157:H7 GN=gnu PE=1 SV=1 6 242 3.0E-09
sp|Q5PQX0|UXS1_RAT UDP-glucuronic acid decarboxylase 1 OS=Rattus norvegicus GN=Uxs1 PE=1 SV=1 6 349 4.0E-09
sp|Q91XL3|UXS1_MOUSE UDP-glucuronic acid decarboxylase 1 OS=Mus musculus GN=Uxs1 PE=1 SV=1 6 349 4.0E-09
sp|P37759|RMLB1_ECOLI dTDP-glucose 4,6-dehydratase 1 OS=Escherichia coli (strain K12) GN=rfbB PE=3 SV=2 6 353 4.0E-09
sp|Q5R885|UXS1_PONAB UDP-glucuronic acid decarboxylase 1 OS=Pongo abelii GN=UXS1 PE=2 SV=1 6 349 5.0E-09
sp|Q8NBZ7|UXS1_HUMAN UDP-glucuronic acid decarboxylase 1 OS=Homo sapiens GN=UXS1 PE=1 SV=1 6 349 5.0E-09
sp|P26391|RMLB_SALTY dTDP-glucose 4,6-dehydratase OS=Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) GN=rfbB PE=1 SV=1 6 353 7.0E-09
sp|B0RVL0|RMLB_XANCB dTDP-glucose 4,6-dehydratase OS=Xanthomonas campestris pv. campestris (strain B100) GN=rfbB PE=3 SV=1 3 351 1.0E-08
sp|Q54WS6|TGDS_DICDI dTDP-D-glucose 4,6-dehydratase OS=Dictyostelium discoideum GN=tgds PE=3 SV=1 1 175 1.0E-08
sp|P55462|RFBB_RHISN Probable dTDP-glucose 4,6-dehydratase OS=Rhizobium sp. (strain NGR234) GN=NGR_a03580 PE=3 SV=1 6 281 1.0E-08
sp|Q31FG4|HLDD_THICR ADP-L-glycero-D-manno-heptose-6-epimerase OS=Thiomicrospira crunogena (strain XCL-2) GN=hldD PE=3 SV=1 6 281 1.0E-08
sp|Q9ZAE8|RMLB_ACTS5 dTDP-glucose 4,6-dehydratase OS=Actinoplanes sp. (strain ATCC 31044 / CBS 674.73 / SE50/110) GN=acbB PE=3 SV=2 6 351 2.0E-08
sp|P37777|RMLB_SHIFL dTDP-glucose 4,6-dehydratase OS=Shigella flexneri GN=rfbB PE=3 SV=2 6 351 3.0E-08
sp|Q04973|VIPB_SALTI Vi polysaccharide biosynthesis protein VipB/TviC OS=Salmonella typhi GN=vipB PE=3 SV=1 7 347 4.0E-08
sp|Q8VZC0|UXS1_ARATH UDP-glucuronic acid decarboxylase 1 OS=Arabidopsis thaliana GN=UXS1 PE=1 SV=1 6 350 4.0E-08
sp|Q32L94|D42E1_BOVIN Short-chain dehydrogenase/reductase family 42E member 1 OS=Bos taurus GN=SDR42E1 PE=2 SV=2 5 293 4.0E-08
sp|Q9L9E8|NOVT_STRNV dTDP-glucose 4,6-dehydratase OS=Streptomyces niveus GN=novT PE=3 SV=1 6 133 5.0E-08
sp|C0QZ84|HLDD_BRAHW ADP-L-glycero-D-manno-heptose-6-epimerase OS=Brachyspira hyodysenteriae (strain ATCC 49526 / WA1) GN=hldD PE=3 SV=1 6 298 5.0E-08
sp|Q6DF08|UXS1_XENTR UDP-glucuronic acid decarboxylase 1 OS=Xenopus tropicalis GN=uxs1 PE=2 SV=1 6 349 6.0E-08
sp|B2JF12|HLDD_BURP8 ADP-L-glycero-D-manno-heptose-6-epimerase OS=Burkholderia phymatum (strain DSM 17167 / STM815) GN=hldD PE=3 SV=1 5 310 8.0E-08
sp|P9WN67|GALE_MYCTU UDP-glucose 4-epimerase OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=galE1 PE=1 SV=1 7 170 1.0E-07
sp|P9WN66|GALE_MYCTO UDP-glucose 4-epimerase OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) GN=galE1 PE=3 SV=1 7 170 1.0E-07
sp|P9WQP7|3BHS_MYCTU 3 beta-hydroxysteroid dehydrogenase/Delta 5-->4-isomerase OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=Rv1106c PE=1 SV=1 3 263 1.0E-07
sp|P9WQP6|3BHS_MYCTO 3 beta-hydroxysteroid dehydrogenase/Delta 5-->4-isomerase OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) GN=MT1137 PE=3 SV=1 3 263 1.0E-07
sp|Q6GMI9|UXS1_DANRE UDP-glucuronic acid decarboxylase 1 OS=Danio rerio GN=uxs1 PE=2 SV=2 6 342 1.0E-07
sp|Q9R1J0|NSDHL_MOUSE Sterol-4-alpha-carboxylate 3-dehydrogenase, decarboxylating OS=Mus musculus GN=Nsdhl PE=1 SV=1 8 280 2.0E-07
sp|B4F132|HLDD_PROMH ADP-L-glycero-D-manno-heptose-6-epimerase OS=Proteus mirabilis (strain HI4320) GN=hldD PE=3 SV=1 6 306 3.0E-07
sp|Q5UR12|TGDS_MIMIV Putative dTDP-D-glucose 4,6-dehydratase OS=Acanthamoeba polyphaga mimivirus GN=MIMI_R141 PE=3 SV=1 6 355 4.0E-07
sp|P55579|Y4NG_RHISN Uncharacterized protein y4nG OS=Rhizobium sp. (strain NGR234) GN=NGR_a02350 PE=3 SV=1 3 293 7.0E-07
sp|Q2NQV7|HLDD_SODGM ADP-L-glycero-D-manno-heptose-6-epimerase OS=Sodalis glossinidius (strain morsitans) GN=hldD PE=3 SV=1 6 288 2.0E-06
sp|Q8S8T4|UXS4_ARATH UDP-glucuronic acid decarboxylase 4 OS=Arabidopsis thaliana GN=UXS4 PE=2 SV=1 6 340 3.0E-06
sp|Q9LZI2|UXS2_ARATH UDP-glucuronic acid decarboxylase 2 OS=Arabidopsis thaliana GN=UXS2 PE=1 SV=1 6 340 4.0E-06
sp|A0R5C5|GALE_MYCS2 UDP-glucose 4-epimerase OS=Mycobacterium smegmatis (strain ATCC 700084 / mc(2)155) GN=MSMEG_6142 PE=1 SV=2 7 353 6.0E-06
[Show less]

GO

GO Term Description Terminal node
GO:0016616 oxidoreductase activity, acting on the CH-OH group of donors, NAD or NADP as acceptor Yes
GO:0006694 steroid biosynthetic process Yes
GO:0003854 3-beta-hydroxy-delta5-steroid dehydrogenase activity Yes
GO:1901360 organic cyclic compound metabolic process No
GO:0016491 oxidoreductase activity No
GO:0008610 lipid biosynthetic process No
GO:0016614 oxidoreductase activity, acting on CH-OH group of donors No
GO:0008150 biological_process No
GO:0033764 steroid dehydrogenase activity, acting on the CH-OH group of donors, NAD or NADP as acceptor No
GO:0003674 molecular_function No
GO:1901576 organic substance biosynthetic process No
GO:0009058 biosynthetic process No
GO:0044238 primary metabolic process No
GO:0006629 lipid metabolic process No
GO:0003824 catalytic activity No
GO:0071704 organic substance metabolic process No
GO:0016229 steroid dehydrogenase activity No
GO:0008152 metabolic process No
GO:1901362 organic cyclic compound biosynthetic process No
GO:0008202 steroid metabolic process No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 25 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >OphauB2|7196
MAVGTVLVTGGTGYIGSFTTLALLQHGYDVVIVDNLYNSSKVAIDRIELICGRRAVFYEADVTDEKALDQVFAKH
PTIDSVIHFAALKAVGESGEIPLEYYRVNVGGSIALLRSMQRNNVTNIVFSSSATVYGDATRFDNMIPIPEHCPI
GPTNTYGRTKSMIEDVITDFIKAQRSNLEKQGKPSEQWNGALLRYFNPCGAHPSGIMGEDPQGVPYNLLPLLGKV
ATGDREKLLVFGDDYPSRDGTAIRDYIHVVDLAKGHLVALNYLRDNKPGVKAWNLGSGRGSTVFEMIKAFSAVVG
RDLAYEVVARRQGDVLDLTANPTLANKELKWKTELTMEKACDDLWRWVKNNPQGYRQEPPAELLEKLKASKA*
Coding >OphauB2|7196
ATGGCTGTGGGCACCGTTCTTGTCACCGGCGGCACGGGCTACATTGGCTCCTTTACCACATTGGCACTGCTCCAG
CACGGCTACGATGTCGTCATTGTCGACAATCTGTACAACTCGTCCAAGGTGGCCATTGACCGCATCGAACTCATC
TGCGGCCGCCGTGCTGTTTTTTACGAGGCCGATGTGACGGACGAGAAGGCTCTTGACCAAGTTTTTGCCAAACAC
CCAACCATTGACAGCGTCATACACTTTGCTGCGCTCAAGGCCGTCGGCGAATCTGGCGAGATACCCCTCGAGTAT
TATCGAGTCAATGTTGGCGGCAGCATCGCTCTGCTGCGGTCTATGCAGCGCAACAACGTCACAAACATTGTCTTC
TCCTCATCTGCCACTGTGTACGGCGACGCCACGCGCTTCGACAATATGATTCCTATTCCGGAGCATTGCCCCATT
GGCCCCACCAACACCTATGGCCGTACCAAGTCCATGATTGAAGACGTCATTACCGATTTTATCAAGGCTCAGCGT
AGCAATCTGGAGAAGCAGGGAAAGCCGTCTGAGCAATGGAACGGTGCTCTCCTCCGATACTTCAACCCATGTGGT
GCCCATCCTAGTGGAATCATGGGTGAGGATCCTCAAGGAGTCCCGTACAATTTGCTGCCTTTGCTCGGCAAAGTT
GCCACTGGTGATCGCGAAAAGCTTCTAGTGTTTGGAGATGACTATCCCTCGCGTGATGGCACAGCTATTCGCGAC
TACATCCATGTTGTTGACTTGGCCAAGGGCCACCTCGTTGCTCTCAACTATCTCCGTGACAATAAGCCGGGAGTC
AAGGCTTGGAATCTCGGCTCAGGCCGTGGCAGCACTGTCTTTGAAATGATCAAGGCCTTTAGCGCCGTTGTTGGA
CGTGACCTTGCATACGAGGTTGTGGCACGCAGACAGGGCGATGTCTTGGACCTTACAGCGAACCCCACATTGGCC
AACAAGGAGCTCAAATGGAAGACTGAGCTGACCATGGAAAAGGCCTGCGACGATCTATGGCGGTGGGTCAAGAAT
AACCCCCAGGGCTATCGCCAAGAGCCTCCGGCGGAACTTTTGGAAAAGTTGAAGGCATCCAAAGCCTAG
Transcript >OphauB2|7196
ATGGCTGTGGGCACCGTTCTTGTCACCGGCGGCACGGGCTACATTGGCTCCTTTACCACATTGGCACTGCTCCAG
CACGGCTACGATGTCGTCATTGTCGACAATCTGTACAACTCGTCCAAGGTGGCCATTGACCGCATCGAACTCATC
TGCGGCCGCCGTGCTGTTTTTTACGAGGCCGATGTGACGGACGAGAAGGCTCTTGACCAAGTTTTTGCCAAACAC
CCAACCATTGACAGCGTCATACACTTTGCTGCGCTCAAGGCCGTCGGCGAATCTGGCGAGATACCCCTCGAGTAT
TATCGAGTCAATGTTGGCGGCAGCATCGCTCTGCTGCGGTCTATGCAGCGCAACAACGTCACAAACATTGTCTTC
TCCTCATCTGCCACTGTGTACGGCGACGCCACGCGCTTCGACAATATGATTCCTATTCCGGAGCATTGCCCCATT
GGCCCCACCAACACCTATGGCCGTACCAAGTCCATGATTGAAGACGTCATTACCGATTTTATCAAGGCTCAGCGT
AGCAATCTGGAGAAGCAGGGAAAGCCGTCTGAGCAATGGAACGGTGCTCTCCTCCGATACTTCAACCCATGTGGT
GCCCATCCTAGTGGAATCATGGGTGAGGATCCTCAAGGAGTCCCGTACAATTTGCTGCCTTTGCTCGGCAAAGTT
GCCACTGGTGATCGCGAAAAGCTTCTAGTGTTTGGAGATGACTATCCCTCGCGTGATGGCACAGCTATTCGCGAC
TACATCCATGTTGTTGACTTGGCCAAGGGCCACCTCGTTGCTCTCAACTATCTCCGTGACAATAAGCCGGGAGTC
AAGGCTTGGAATCTCGGCTCAGGCCGTGGCAGCACTGTCTTTGAAATGATCAAGGCCTTTAGCGCCGTTGTTGGA
CGTGACCTTGCATACGAGGTTGTGGCACGCAGACAGGGCGATGTCTTGGACCTTACAGCGAACCCCACATTGGCC
AACAAGGAGCTCAAATGGAAGACTGAGCTGACCATGGAAAAGGCCTGCGACGATCTATGGCGGTGGGTCAAGAAT
AACCCCCAGGGCTATCGCCAAGAGCCTCCGGCGGAACTTTTGGAAAAGTTGAAGGCATCCAAAGCCTAG
Gene >OphauB2|7196
ATGGCTGTGGGCACCGTTCTTGTCACCGGGTACGATGTTCCATTCAAGAGTGACGAAGCTCCTACTTACTGTGTA
TCCTTGCTTGCAGCGGCACGGGCTACATTGGCTCCTTTACCACATTGGCACTGCTCCAGCACGGCTACGATGTCG
TCATTGTCGACAATCTGTACAACTCGTCCAAGGTGGCCATTGACCGCATCGAACTCATCTGCGGCCGCCGTGCTG
TTTTTTACGAGGCCGATGTGACGGACGAGAAGGCTCTTGACCAAGTTTTTGCCAAACACCCAACCATTGACAGCG
TCATACACTTTGCTGCGCTCAAGGCAAGCCATGTGCCGGTTCCCTGACATGCACCACCACGGCAACTGACTCTCT
GCTAGGCCGTCGGCGAATCTGGCGAGATACCCCTCGAGTATTATCGAGTCAATGTTGGCGGCAGCATCGCTCTGC
TGCGGTCTATGCAGCGCAACAACGTCACAAACATTGTCTTCTCCTCATCTGCCACTGTGTACGGCGACGCCACGC
GCTTCGACAATATGATTCCTATTCCGGAGCATTGCCCCATTGGCCCCACCAACACCTATGGCCGTACCAAGTCCA
TGATTGAAGACGTCATTACCGATTTTATCAAGGCTCAGCGTAGCAATCTGGAGAAGCAGGGAAAGCCGTCTGAGC
AATGGAACGGTGCTCTCCTCCGATACTTCAACCCATGTGGTGCCCATCCTAGTGGAATCATGGGTGAGGATCCTC
AAGGAGTCCCGTACAATTTGCTGCCTTTGCTCGGCAAAGTTGCCACTGGTGATCGCGAAAAGCTTCTAGTGTTTG
GAGATGGTGAGTCCTACTTTTTCATGAATTTGTTCTCGGCGCTTGTCCTGGACTAAACAGACATTGTCTTGTAGA
CTATCCCTCGCGTGATGGCACAGCTATTCGCGACTACATCCATGTTGTTGACTTGGCCAAGGGCCACCTCGTTGC
TCTCAACTATCTCCGTGACAATAAGCCGGGAGTCAAGGCTTGGAATCTCGGCTCAGGCCGTGGCAGCACTGTCTT
TGAAATGATCAAGGCCTTTAGCGCCGTTGTTGGACGTGACCTTGCATACGAGGTTGTGGCACGCAGACAGGGCGA
TGTCTTGGACCTTACAGCGAACCCCACATTGGCCAACAAGGAGCTCAAATGGAAGACTGAGCTGACCATGGAAAA
GGCCTGCGACGATCTATGGCGGTGGGTCAAGAATAACCCCCAGGGCTATCGCCAAGAGCCTCCGGCGGAACTTTT
GGAAAAGTTGAAGGCATCCAAAGCCTAG

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail