Fungal Genomics

at Utrecht University

General Properties

Protein IDOphauB2|7194
Gene name
LocationContig_73:61709..64229
Strand+
Gene length (bp)2520
Transcript length (bp)2418
Coding sequence length (bp)2418
Protein length (aa) 806

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00270 DEAD DEAD/DEAH box helicase 2.6E-45 74 243
PF00271 Helicase_C Helicase conserved C-terminal domain 2.1E-25 280 390
PF13959 DUF4217 Domain of unknown function (DUF4217) 2.4E-23 432 492
PF04851 ResIII Type III restriction enzyme, res subunit 1.6E-07 78 236

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q7RZ35|DBP4_NEUCR ATP-dependent RNA helicase dbp-4 OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=dbp-4 PE=3 SV=1 9 805 0.0E+00
sp|Q4IAS1|DBP4_GIBZE ATP-dependent RNA helicase DBP4 OS=Gibberella zeae (strain PH-1 / ATCC MYA-4620 / FGSC 9075 / NRRL 31084) GN=DBP4 PE=3 SV=1 5 804 0.0E+00
sp|A4RGU2|DBP4_MAGO7 ATP-dependent RNA helicase DBP4 OS=Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958) GN=DBP4 PE=3 SV=1 1 805 0.0E+00
sp|Q2H2J1|DBP4_CHAGB ATP-dependent RNA helicase DBP4 OS=Chaetomium globosum (strain ATCC 6205 / CBS 148.51 / DSM 1962 / NBRC 6347 / NRRL 1970) GN=DBP4 PE=3 SV=1 8 805 0.0E+00
sp|A7ESL8|DBP4_SCLS1 ATP-dependent RNA helicase dbp4 OS=Sclerotinia sclerotiorum (strain ATCC 18683 / 1980 / Ss-1) GN=dbp4 PE=3 SV=1 1 804 0.0E+00
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q7RZ35|DBP4_NEUCR ATP-dependent RNA helicase dbp-4 OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=dbp-4 PE=3 SV=1 9 805 0.0E+00
sp|Q4IAS1|DBP4_GIBZE ATP-dependent RNA helicase DBP4 OS=Gibberella zeae (strain PH-1 / ATCC MYA-4620 / FGSC 9075 / NRRL 31084) GN=DBP4 PE=3 SV=1 5 804 0.0E+00
sp|A4RGU2|DBP4_MAGO7 ATP-dependent RNA helicase DBP4 OS=Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958) GN=DBP4 PE=3 SV=1 1 805 0.0E+00
sp|Q2H2J1|DBP4_CHAGB ATP-dependent RNA helicase DBP4 OS=Chaetomium globosum (strain ATCC 6205 / CBS 148.51 / DSM 1962 / NBRC 6347 / NRRL 1970) GN=DBP4 PE=3 SV=1 8 805 0.0E+00
sp|A7ESL8|DBP4_SCLS1 ATP-dependent RNA helicase dbp4 OS=Sclerotinia sclerotiorum (strain ATCC 18683 / 1980 / Ss-1) GN=dbp4 PE=3 SV=1 1 804 0.0E+00
sp|Q1EB31|DBP4_COCIM ATP-dependent RNA helicase DBP4 OS=Coccidioides immitis (strain RS) GN=DBP4 PE=3 SV=1 8 770 0.0E+00
sp|A2QS00|DBP4_ASPNC ATP-dependent RNA helicase dbp4 OS=Aspergillus niger (strain CBS 513.88 / FGSC A1513) GN=dbp4 PE=3 SV=1 1 803 0.0E+00
sp|Q5BFU1|DBP4_EMENI ATP-dependent RNA helicase dbp4 OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=dbp4 PE=3 SV=1 24 803 0.0E+00
sp|Q0UMB9|DBP4_PHANO ATP-dependent RNA helicase DBP4 OS=Phaeosphaeria nodorum (strain SN15 / ATCC MYA-4574 / FGSC 10173) GN=DBP4 PE=3 SV=1 13 803 0.0E+00
sp|Q2UHB7|DBP4_ASPOR ATP-dependent RNA helicase dbp4 OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) GN=dbp4 PE=3 SV=1 1 803 0.0E+00
sp|A1CTZ2|DBP4_ASPCL ATP-dependent RNA helicase dbp4 OS=Aspergillus clavatus (strain ATCC 1007 / CBS 513.65 / DSM 816 / NCTC 3887 / NRRL 1) GN=dbp4 PE=3 SV=1 1 692 0.0E+00
sp|Q0CMM5|DBP4_ASPTN ATP-dependent RNA helicase dbp4 OS=Aspergillus terreus (strain NIH 2624 / FGSC A1156) GN=dbp4 PE=3 SV=2 14 803 0.0E+00
sp|A1DNF9|DBP4_NEOFI ATP-dependent RNA helicase dbp4 OS=Neosartorya fischeri (strain ATCC 1020 / DSM 3700 / FGSC A1164 / NRRL 181) GN=dbp4 PE=3 SV=1 1 803 0.0E+00
sp|Q4WM60|DBP4_ASPFU ATP-dependent RNA helicase dbp4 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=dbp4 PE=3 SV=1 1 803 0.0E+00
sp|Q9UTP9|DBP4_SCHPO ATP-dependent RNA helicase dbp4 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=dbp4 PE=1 SV=1 35 803 0.0E+00
sp|Q6CGD1|DBP4_YARLI ATP-dependent RNA helicase DBP4 OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=DBP4 PE=3 SV=1 17 694 0.0E+00
sp|Q75C76|DBP4_ASHGO ATP-dependent RNA helicase DBP4 OS=Ashbya gossypii (strain ATCC 10895 / CBS 109.51 / FGSC 9923 / NRRL Y-1056) GN=DBP4 PE=3 SV=2 21 803 0.0E+00
sp|Q6CRF4|DBP4_KLULA ATP-dependent RNA helicase DBP4 OS=Kluyveromyces lactis (strain ATCC 8585 / CBS 2359 / DSM 70799 / NBRC 1267 / NRRL Y-1140 / WM37) GN=DBP4 PE=3 SV=1 18 803 0.0E+00
sp|Q5AF95|DBP4_CANAL ATP-dependent RNA helicase DBP4 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=DBP4 PE=3 SV=1 7 805 0.0E+00
sp|Q6BXG0|DBP4_DEBHA ATP-dependent RNA helicase DBP4 OS=Debaryomyces hansenii (strain ATCC 36239 / CBS 767 / JCM 1990 / NBRC 0083 / IGC 2968) GN=DBP4 PE=3 SV=2 21 805 0.0E+00
sp|A5DLF4|DBP4_PICGU ATP-dependent RNA helicase DBP4 OS=Meyerozyma guilliermondii (strain ATCC 6260 / CBS 566 / DSM 6381 / JCM 1539 / NBRC 10279 / NRRL Y-324) GN=DBP4 PE=3 SV=2 21 803 0.0E+00
sp|A3GGE9|DBP4_PICST ATP-dependent RNA helicase DBP4 OS=Scheffersomyces stipitis (strain ATCC 58785 / CBS 6054 / NBRC 10063 / NRRL Y-11545) GN=DBP4 PE=3 SV=2 10 803 0.0E+00
sp|P20448|DBP4_YEAST ATP-dependent RNA helicase HCA4 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=HCA4 PE=1 SV=2 17 692 0.0E+00
sp|A6ZPU3|DBP4_YEAS7 ATP-dependent RNA helicase DBP4 OS=Saccharomyces cerevisiae (strain YJM789) GN=DBP4 PE=3 SV=1 17 692 0.0E+00
sp|A7TJ71|DBP4_VANPO ATP-dependent RNA helicase DBP4 OS=Vanderwaltozyma polyspora (strain ATCC 22028 / DSM 70294) GN=DBP4 PE=3 SV=1 18 805 0.0E+00
sp|Q6FPT7|DBP4_CANGA ATP-dependent RNA helicase DBP4 OS=Candida glabrata (strain ATCC 2001 / CBS 138 / JCM 3761 / NBRC 0622 / NRRL Y-65) GN=DBP4 PE=3 SV=1 21 689 0.0E+00
sp|A5E3K3|DBP4_LODEL ATP-dependent RNA helicase DBP4 OS=Lodderomyces elongisporus (strain ATCC 11503 / CBS 2605 / JCM 1781 / NBRC 1676 / NRRL YB-4239) GN=DBP4 PE=3 SV=1 7 805 0.0E+00
sp|Q4P5U4|DBP4_USTMA ATP-dependent RNA helicase DBP4 OS=Ustilago maydis (strain 521 / FGSC 9021) GN=DBP4 PE=3 SV=2 21 561 0.0E+00
sp|P0CQ82|DBP4_CRYNJ ATP-dependent RNA helicase DBP4 OS=Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565) GN=DBP4 PE=3 SV=1 17 501 0.0E+00
sp|P0CQ83|DBP4_CRYNB ATP-dependent RNA helicase DBP4 OS=Cryptococcus neoformans var. neoformans serotype D (strain B-3501A) GN=DBP4 PE=3 SV=1 17 501 0.0E+00
sp|Q80Y44|DDX10_MOUSE Probable ATP-dependent RNA helicase DDX10 OS=Mus musculus GN=Ddx10 PE=1 SV=2 14 494 0.0E+00
sp|Q13206|DDX10_HUMAN Probable ATP-dependent RNA helicase DDX10 OS=Homo sapiens GN=DDX10 PE=1 SV=2 49 494 3.0E-176
sp|Q5ZJF6|DDX10_CHICK Probable ATP-dependent RNA helicase DDX10 OS=Gallus gallus GN=DDX10 PE=2 SV=1 49 494 7.0E-175
sp|Q9FFT9|RH32_ARATH DEAD-box ATP-dependent RNA helicase 32 OS=Arabidopsis thaliana GN=RH32 PE=2 SV=1 49 502 2.0E-171
sp|Q54Q94|DDX10_DICDI Probable ATP-dependent RNA helicase ddx10 OS=Dictyostelium discoideum GN=ddx10 PE=3 SV=1 50 560 5.0E-170
sp|Q0D622|RH32_ORYSJ DEAD-box ATP-dependent RNA helicase 32 OS=Oryza sativa subsp. japonica GN=Os07g0517000 PE=2 SV=2 44 511 4.0E-158
sp|Q9NVP1|DDX18_HUMAN ATP-dependent RNA helicase DDX18 OS=Homo sapiens GN=DDX18 PE=1 SV=2 50 490 5.0E-115
sp|Q6C7D2|HAS1_YARLI ATP-dependent RNA helicase HAS1 OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=HAS1 PE=3 SV=1 52 505 2.0E-114
sp|Q8K363|DDX18_MOUSE ATP-dependent RNA helicase DDX18 OS=Mus musculus GN=Ddx18 PE=1 SV=1 50 490 3.0E-114
sp|Q5BBY1|HAS1_EMENI ATP-dependent RNA helicase has1 OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=has1 PE=3 SV=1 19 535 3.0E-114
sp|Q9VD51|DDX18_DROME Probable ATP-dependent RNA helicase pitchoune OS=Drosophila melanogaster GN=pit PE=2 SV=2 4 497 1.0E-112
sp|A1CIQ5|HAS1_ASPCL ATP-dependent RNA helicase has1 OS=Aspergillus clavatus (strain ATCC 1007 / CBS 513.65 / DSM 816 / NCTC 3887 / NRRL 1) GN=has1 PE=3 SV=1 52 497 4.0E-112
sp|Q2UUN6|HAS1_ASPOR ATP-dependent RNA helicase has1 OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) GN=has1 PE=3 SV=2 52 513 5.0E-112
sp|A2Q9T6|HAS1_ASPNC ATP-dependent RNA helicase has1 OS=Aspergillus niger (strain CBS 513.88 / FGSC A1513) GN=has1 PE=3 SV=1 52 535 1.0E-111
sp|Q4WQM4|HAS1_ASPFU ATP-dependent RNA helicase has1 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=has1 PE=3 SV=2 52 518 4.0E-111
sp|Q0UR48|HAS1_PHANO ATP-dependent RNA helicase HAS1 OS=Phaeosphaeria nodorum (strain SN15 / ATCC MYA-4574 / FGSC 10173) GN=HAS1 PE=3 SV=1 44 497 2.0E-110
sp|A1CW14|HAS1_NEOFI ATP-dependent RNA helicase has1 OS=Neosartorya fischeri (strain ATCC 1020 / DSM 3700 / FGSC A1164 / NRRL 181) GN=has1 PE=3 SV=1 52 497 2.0E-110
sp|Q09916|HAS1_SCHPO ATP-dependent RNA helicase has1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=has1 PE=1 SV=1 46 501 5.0E-110
sp|Q03532|HAS1_YEAST ATP-dependent RNA helicase HAS1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=HAS1 PE=1 SV=1 45 509 8.0E-110
sp|Q4IEK8|HAS1_GIBZE ATP-dependent RNA helicase HAS1 OS=Gibberella zeae (strain PH-1 / ATCC MYA-4620 / FGSC 9075 / NRRL 31084) GN=HAS1 PE=3 SV=2 51 513 3.0E-109
sp|Q54S03|DDX18_DICDI Probable ATP-dependent RNA helicase ddx18 OS=Dictyostelium discoideum GN=ddx18 PE=3 SV=1 52 501 1.0E-108
sp|Q1EA54|HAS1_COCIM ATP-dependent RNA helicase HAS1 OS=Coccidioides immitis (strain RS) GN=HAS1 PE=3 SV=1 52 497 4.0E-108
sp|A3LNR6|HAS1_PICST ATP-dependent RNA helicase HAS1 OS=Scheffersomyces stipitis (strain ATCC 58785 / CBS 6054 / NBRC 10063 / NRRL Y-11545) GN=HAS1 PE=3 SV=2 52 504 6.0E-108
sp|Q6FIL3|HAS1_CANGA ATP-dependent RNA helicase HAS1 OS=Candida glabrata (strain ATCC 2001 / CBS 138 / JCM 3761 / NBRC 0622 / NRRL Y-65) GN=HAS1 PE=3 SV=1 20 501 1.0E-107
sp|Q6CXB7|HAS1_KLULA ATP-dependent RNA helicase HAS1 OS=Kluyveromyces lactis (strain ATCC 8585 / CBS 2359 / DSM 70799 / NBRC 1267 / NRRL Y-1140 / WM37) GN=HAS1 PE=3 SV=1 51 510 1.0E-107
sp|A5DID7|HAS1_PICGU ATP-dependent RNA helicase HAS1 OS=Meyerozyma guilliermondii (strain ATCC 6260 / CBS 566 / DSM 6381 / JCM 1539 / NBRC 10279 / NRRL Y-324) GN=HAS1 PE=3 SV=2 40 504 2.0E-107
sp|Q6BH93|HAS1_DEBHA ATP-dependent RNA helicase HAS1 OS=Debaryomyces hansenii (strain ATCC 36239 / CBS 767 / JCM 1990 / NBRC 0083 / IGC 2968) GN=HAS1 PE=3 SV=1 51 504 4.0E-107
sp|P0CQ84|HAS1_CRYNJ ATP-dependent RNA helicase HAS1 OS=Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565) GN=HAS1 PE=3 SV=1 40 497 8.0E-107
sp|P0CQ85|HAS1_CRYNB ATP-dependent RNA helicase HAS1 OS=Cryptococcus neoformans var. neoformans serotype D (strain B-3501A) GN=HAS1 PE=3 SV=1 40 497 8.0E-107
sp|Q74Z73|HAS1_ASHGO ATP-dependent RNA helicase HAS1 OS=Ashbya gossypii (strain ATCC 10895 / CBS 109.51 / FGSC 9923 / NRRL Y-1056) GN=HAS1 PE=3 SV=2 52 501 4.0E-106
sp|A5E2Z9|HAS1_LODEL ATP-dependent RNA helicase HAS1 OS=Lodderomyces elongisporus (strain ATCC 11503 / CBS 2605 / JCM 1781 / NBRC 1676 / NRRL YB-4239) GN=HAS1 PE=3 SV=1 51 504 1.0E-105
sp|Q5AK59|HAS1_CANAL ATP-dependent RNA helicase HAS1 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=HAS1 PE=3 SV=1 52 497 4.0E-105
sp|A4R8B5|HAS1_MAGO7 ATP-dependent RNA helicase HAS1 OS=Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958) GN=HAS1 PE=3 SV=2 47 513 4.0E-105
sp|Q7S2N9|HAS1_NEUCR ATP-dependent RNA helicase has-1 OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=has-1 PE=3 SV=1 50 533 2.0E-103
sp|Q4P6N0|HAS1_USTMA ATP-dependent RNA helicase HAS1 OS=Ustilago maydis (strain 521 / FGSC 9021) GN=HAS1 PE=3 SV=2 52 567 3.0E-101
sp|Q2GMX1|HAS1_CHAGB ATP-dependent RNA helicase HAS1 OS=Chaetomium globosum (strain ATCC 6205 / CBS 148.51 / DSM 1962 / NBRC 6347 / NRRL 1970) GN=HAS1 PE=3 SV=1 51 513 4.0E-100
sp|Q9SB89|RH27_ARATH DEAD-box ATP-dependent RNA helicase 27 OS=Arabidopsis thaliana GN=RH27 PE=2 SV=2 51 492 6.0E-100
sp|Q9LIH9|RH51_ARATH DEAD-box ATP-dependent RNA helicase 51 OS=Arabidopsis thaliana GN=RH51 PE=2 SV=1 50 532 1.0E-98
sp|Q0CZS8|HAS1_ASPTN ATP-dependent RNA helicase has1 OS=Aspergillus terreus (strain NIH 2624 / FGSC A1156) GN=has1 PE=3 SV=1 52 517 2.0E-98
sp|Q84T03|RH27_ORYSJ DEAD-box ATP-dependent RNA helicase 27 OS=Oryza sativa subsp. japonica GN=Os03g0802700 PE=3 SV=1 52 538 4.0E-90
sp|Q0DBS1|RH51_ORYSJ Putative DEAD-box ATP-dependent RNA helicase 51 OS=Oryza sativa subsp. japonica GN=Os06g0535100 PE=3 SV=2 52 538 4.0E-89
sp|Q8SR01|DBP4_ENCCU ATP-dependent RNA helicase DBP4 OS=Encephalitozoon cuniculi (strain GB-M1) GN=DBP4 PE=3 SV=2 52 405 8.0E-87
sp|Q8NHQ9|DDX55_HUMAN ATP-dependent RNA helicase DDX55 OS=Homo sapiens GN=DDX55 PE=1 SV=3 55 492 7.0E-84
sp|Q2NL08|DDX55_BOVIN ATP-dependent RNA helicase DDX55 OS=Bos taurus GN=DDX55 PE=2 SV=1 55 492 3.0E-82
sp|Q6ZPL9|DDX55_MOUSE ATP-dependent RNA helicase DDX55 OS=Mus musculus GN=Ddx55 PE=1 SV=2 55 492 4.0E-82
sp|Q9VHU1|DDX55_DROME Probable ATP-dependent RNA helicase DDX55 homolog OS=Drosophila melanogaster GN=CG9630 PE=2 SV=1 56 492 5.0E-81
sp|Q5ZLN8|DDX55_CHICK ATP-dependent RNA helicase DDX55 OS=Gallus gallus GN=DDX55 PE=2 SV=1 52 492 2.0E-78
sp|Q8JHJ2|DDX55_DANRE ATP-dependent RNA helicase DDX55 OS=Danio rerio GN=ddx55 PE=2 SV=2 52 492 2.0E-76
sp|Q6AZV7|DDX55_XENLA ATP-dependent RNA helicase DDX55 OS=Xenopus laevis GN=ddx55 PE=2 SV=1 59 499 9.0E-75
sp|Q54EC2|DDX55_DICDI Probable ATP-dependent RNA helicase ddx55 OS=Dictyostelium discoideum GN=ddx55 PE=3 SV=1 57 492 5.0E-72
sp|Q761Z9|RH18_ORYSJ DEAD-box ATP-dependent RNA helicase 18 OS=Oryza sativa subsp. japonica GN=Os01g0164500 PE=1 SV=2 57 492 5.0E-72
sp|Q0DBU5|RH31_ORYSJ DEAD-box ATP-dependent RNA helicase 31 OS=Oryza sativa subsp. japonica GN=Os06g0526600 PE=3 SV=2 50 492 1.0E-70
sp|Q9FLB0|RH18_ARATH DEAD-box ATP-dependent RNA helicase 18 OS=Arabidopsis thaliana GN=RH18 PE=2 SV=1 50 492 3.0E-70
sp|Q8GXD6|RH49_ARATH DEAD-box ATP-dependent RNA helicase 49 OS=Arabidopsis thaliana GN=RH49 PE=2 SV=2 46 492 2.0E-68
sp|Q5B5E7|RRP3_EMENI ATP-dependent rRNA helicase rrp3 OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=rrp3 PE=3 SV=1 1 418 7.0E-68
sp|Q94C75|RH25_ARATH DEAD-box ATP-dependent RNA helicase 25 OS=Arabidopsis thaliana GN=RH25 PE=2 SV=2 50 492 7.0E-68
sp|A4RGD1|RRP3_MAGO7 ATP-dependent rRNA helicase RRP3 OS=Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958) GN=RRP3 PE=3 SV=1 47 397 2.0E-67
sp|Q9P6N8|RRP3_SCHPO ATP-dependent rRNA helicase rrp3 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=rrp3 PE=3 SV=1 51 397 3.0E-67
sp|Q4P3U9|RRP3_USTMA ATP-dependent rRNA helicase RRP3 OS=Ustilago maydis (strain 521 / FGSC 9021) GN=RRP3 PE=3 SV=2 52 413 2.0E-66
sp|Q29S22|DDX47_BOVIN Probable ATP-dependent RNA helicase DDX47 OS=Bos taurus GN=DDX47 PE=2 SV=1 29 419 3.0E-66
sp|Q0DLB9|RH17_ORYSJ DEAD-box ATP-dependent RNA helicase 17 OS=Oryza sativa subsp. japonica GN=Os05g0110500 PE=2 SV=2 50 492 7.0E-66
sp|Q6NZQ2|DDX31_MOUSE Probable ATP-dependent RNA helicase DDX31 OS=Mus musculus GN=Ddx31 PE=2 SV=2 72 491 1.0E-65
sp|P34580|DDX47_CAEEL Putative ATP-dependent RNA helicase T26G10.1 OS=Caenorhabditis elegans GN=T26G10.1 PE=3 SV=1 51 397 1.0E-65
sp|Q9H0S4|DDX47_HUMAN Probable ATP-dependent RNA helicase DDX47 OS=Homo sapiens GN=DDX47 PE=1 SV=1 74 418 1.0E-65
sp|Q2H1Q8|RRP3_CHAGB ATP-dependent rRNA helicase RRP3 OS=Chaetomium globosum (strain ATCC 6205 / CBS 148.51 / DSM 1962 / NBRC 6347 / NRRL 1970) GN=RRP3 PE=3 SV=1 2 400 1.0E-65
sp|Q9CWX9|DDX47_MOUSE Probable ATP-dependent RNA helicase DDX47 OS=Mus musculus GN=Ddx47 PE=2 SV=2 74 419 1.0E-65
sp|Q6CH58|RRP3_YARLI ATP-dependent rRNA helicase RRP3 OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=RRP3 PE=3 SV=1 51 400 2.0E-65
sp|Q0UK12|RRP3_PHANO ATP-dependent rRNA helicase RRP3 OS=Phaeosphaeria nodorum (strain SN15 / ATCC MYA-4574 / FGSC 10173) GN=RRP3 PE=3 SV=2 48 423 2.0E-65
sp|Q6BQ61|RRP3_DEBHA ATP-dependent rRNA helicase RRP3 OS=Debaryomyces hansenii (strain ATCC 36239 / CBS 767 / JCM 1990 / NBRC 0083 / IGC 2968) GN=RRP3 PE=3 SV=2 14 418 3.0E-65
sp|Q2UNB7|RRP3_ASPOR ATP-dependent rRNA helicase rrp3 OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) GN=rrp3 PE=3 SV=1 44 418 3.0E-65
sp|Q9FFQ1|RH31_ARATH DEAD-box ATP-dependent RNA helicase 31 OS=Arabidopsis thaliana GN=RH31 PE=2 SV=2 50 492 7.0E-65
sp|Q7RY59|RRP3_NEUCR ATP-dependent rRNA helicase rrp-3 OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=rrp-3 PE=3 SV=1 5 397 8.0E-65
sp|Q7XJN0|RH17_ARATH DEAD-box ATP-dependent RNA helicase 17 OS=Arabidopsis thaliana GN=RH17 PE=2 SV=1 70 492 1.0E-64
sp|A7EML8|RRP3_SCLS1 ATP-dependent rRNA helicase rrp3 OS=Sclerotinia sclerotiorum (strain ATCC 18683 / 1980 / Ss-1) GN=rrp3 PE=3 SV=1 51 400 2.0E-64
sp|A6RMZ2|SPB4_BOTFB ATP-dependent rRNA helicase spb4 OS=Botryotinia fuckeliana (strain B05.10) GN=spb4 PE=3 SV=1 57 549 3.0E-64
sp|Q4IFI0|RRP3_GIBZE ATP-dependent rRNA helicase RRP3 OS=Gibberella zeae (strain PH-1 / ATCC MYA-4620 / FGSC 9075 / NRRL 31084) GN=RRP3 PE=3 SV=1 36 397 6.0E-64
sp|Q9FNM7|RH26_ARATH DEAD-box ATP-dependent RNA helicase 26 OS=Arabidopsis thaliana GN=RH26 PE=1 SV=2 50 492 7.0E-64
sp|Q61R02|DDX55_CAEBR Probable ATP-dependent RNA helicase DDX55 homolog OS=Caenorhabditis briggsae GN=CBG06798 PE=3 SV=1 70 493 8.0E-64
sp|A1D405|RRP3_NEOFI ATP-dependent rRNA helicase rrp3 OS=Neosartorya fischeri (strain ATCC 1020 / DSM 3700 / FGSC A1164 / NRRL 181) GN=rrp3 PE=3 SV=1 40 400 1.0E-63
sp|A7F2S3|SPB4_SCLS1 ATP-dependent rRNA helicase spb4 OS=Sclerotinia sclerotiorum (strain ATCC 18683 / 1980 / Ss-1) GN=spb4 PE=3 SV=1 57 549 2.0E-63
sp|Q4WJE9|RRP3_ASPFU ATP-dependent rRNA helicase rrp3 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=rrp3 PE=3 SV=1 35 400 2.0E-63
sp|Q0UP45|SPB4_PHANO ATP-dependent rRNA helicase SPB4 OS=Phaeosphaeria nodorum (strain SN15 / ATCC MYA-4574 / FGSC 10173) GN=SPB4 PE=3 SV=1 44 498 2.0E-63
sp|Q86B47|Y8611_DROME Probable ATP-dependent RNA helicase CG8611 OS=Drosophila melanogaster GN=CG8611 PE=1 SV=1 5 490 3.0E-63
sp|A6RW56|RRP3_BOTFB ATP-dependent rRNA helicase rrp3 OS=Botryotinia fuckeliana (strain B05.10) GN=rrp3 PE=3 SV=1 51 397 3.0E-63
sp|A2RB17|RRP3_ASPNC ATP-dependent rRNA helicase rrp3 OS=Aspergillus niger (strain CBS 513.88 / FGSC A1513) GN=rrp3 PE=3 SV=1 51 432 5.0E-63
sp|Q9H8H2|DDX31_HUMAN Probable ATP-dependent RNA helicase DDX31 OS=Homo sapiens GN=DDX31 PE=1 SV=2 70 442 5.0E-63
sp|A6QRQ7|RRP3_AJECN ATP-dependent rRNA helicase RRP3 OS=Ajellomyces capsulatus (strain NAm1 / WU24) GN=RRP3 PE=3 SV=1 51 434 5.0E-63
sp|Q0JL73|RH26_ORYSJ DEAD-box ATP-dependent RNA helicase 26 OS=Oryza sativa subsp. japonica GN=Os01g0618500 PE=2 SV=1 50 492 6.0E-63
sp|P34640|DDX55_CAEEL Probable ATP-dependent RNA helicase DDX55 homolog OS=Caenorhabditis elegans GN=ZK512.2 PE=3 SV=2 70 493 1.0E-62
sp|Q4HVW2|SPB4_GIBZE ATP-dependent rRNA helicase SPB4 OS=Gibberella zeae (strain PH-1 / ATCC MYA-4620 / FGSC 9075 / NRRL 31084) GN=SPB4 PE=3 SV=1 56 503 1.0E-62
sp|Q5ACK7|DRS1_CANAL ATP-dependent RNA helicase DRS1 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=DRS1 PE=3 SV=1 38 410 2.0E-62
sp|A5DQF1|RRP3_PICGU ATP-dependent rRNA helicase RRP3 OS=Meyerozyma guilliermondii (strain ATCC 6260 / CBS 566 / DSM 6381 / JCM 1539 / NBRC 10279 / NRRL Y-324) GN=RRP3 PE=3 SV=2 51 397 2.0E-62
sp|O60173|DBP7_SCHPO ATP-dependent RNA helicase dbp7 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=dbp7 PE=3 SV=1 49 490 2.0E-62
sp|Q1E1N5|RRP3_COCIM ATP-dependent rRNA helicase RRP3 OS=Coccidioides immitis (strain RS) GN=RRP3 PE=3 SV=1 13 396 3.0E-62
sp|A2QE29|SPB4_ASPNC ATP-dependent rRNA helicase spb4 OS=Aspergillus niger (strain CBS 513.88 / FGSC A1513) GN=spb4 PE=3 SV=2 57 492 4.0E-62
sp|Q0CIQ3|RRP3_ASPTN ATP-dependent rRNA helicase rrp3 OS=Aspergillus terreus (strain NIH 2624 / FGSC A1156) GN=rrp3 PE=3 SV=2 74 416 4.0E-62
sp|P0A4D8|CSHA_STRR6 DEAD-box ATP-dependent RNA helicase CshA OS=Streptococcus pneumoniae (strain ATCC BAA-255 / R6) GN=cshA PE=3 SV=1 52 438 5.0E-62
sp|P0A4D7|CSHA_STRPN DEAD-box ATP-dependent RNA helicase CshA OS=Streptococcus pneumoniae serotype 4 (strain ATCC BAA-334 / TIGR4) GN=cshA PE=3 SV=1 52 438 5.0E-62
sp|P0CQ92|DRS1_CRYNJ ATP-dependent RNA helicase DRS1 OS=Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565) GN=DRS1 PE=3 SV=1 38 439 7.0E-62
sp|P0CQ93|DRS1_CRYNB ATP-dependent RNA helicase DRS1 OS=Cryptococcus neoformans var. neoformans serotype D (strain B-3501A) GN=DRS1 PE=3 SV=1 38 439 7.0E-62
sp|A5DKW3|DRS1_PICGU ATP-dependent RNA helicase DRS1 OS=Meyerozyma guilliermondii (strain ATCC 6260 / CBS 566 / DSM 6381 / JCM 1539 / NBRC 10279 / NRRL Y-324) GN=DRS1 PE=3 SV=2 46 406 1.0E-61
sp|Q6FW42|DRS1_CANGA ATP-dependent RNA helicase DRS1 OS=Candida glabrata (strain ATCC 2001 / CBS 138 / JCM 3761 / NBRC 0622 / NRRL Y-65) GN=DRS1 PE=3 SV=1 51 400 1.0E-61
sp|Q6CJV1|DRS1_KLULA ATP-dependent RNA helicase DRS1 OS=Kluyveromyces lactis (strain ATCC 8585 / CBS 2359 / DSM 70799 / NBRC 1267 / NRRL Y-1140 / WM37) GN=DRS1 PE=3 SV=1 51 411 2.0E-61
sp|A1CR32|RRP3_ASPCL ATP-dependent rRNA helicase rrp3 OS=Aspergillus clavatus (strain ATCC 1007 / CBS 513.65 / DSM 816 / NCTC 3887 / NRRL 1) GN=rrp3 PE=3 SV=1 51 400 3.0E-61
sp|Q6BTL5|DRS1_DEBHA ATP-dependent RNA helicase DRS1 OS=Debaryomyces hansenii (strain ATCC 36239 / CBS 767 / JCM 1990 / NBRC 0083 / IGC 2968) GN=DRS1 PE=3 SV=1 50 428 4.0E-61
sp|Q6C835|DBP7_YARLI ATP-dependent RNA helicase DBP7 OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=DBP7 PE=3 SV=1 50 504 5.0E-61
sp|Q9ZRZ8|RH28_ARATH DEAD-box ATP-dependent RNA helicase 28 OS=Arabidopsis thaliana GN=RH28 PE=2 SV=1 51 404 5.0E-61
sp|Q5ZBH5|RH25_ORYSJ DEAD-box ATP-dependent RNA helicase 25 OS=Oryza sativa subsp. japonica GN=Os01g0618400 PE=2 SV=1 50 492 5.0E-61
sp|Q2UBZ5|SPB4_ASPOR ATP-dependent rRNA helicase spb4 OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) GN=spb4 PE=3 SV=1 57 492 6.0E-61
sp|Q0CQF3|SPB4_ASPTN ATP-dependent rRNA helicase spb4 OS=Aspergillus terreus (strain NIH 2624 / FGSC A1156) GN=spb4 PE=3 SV=1 57 492 6.0E-61
sp|Q7Y183|RH10_ORYSJ DEAD-box ATP-dependent RNA helicase 10 OS=Oryza sativa subsp. japonica GN=Os03g0669000 PE=2 SV=1 43 423 8.0E-61
sp|P32892|DRS1_YEAST ATP-dependent RNA helicase DRS1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=DRS1 PE=1 SV=2 51 417 1.0E-60
sp|A7A0P8|DRS1_YEAS7 ATP-dependent RNA helicase DRS1 OS=Saccharomyces cerevisiae (strain YJM789) GN=DRS1 PE=3 SV=1 51 417 1.0E-60
sp|A5DGM4|SPB4_PICGU ATP-dependent rRNA helicase SPB4 OS=Meyerozyma guilliermondii (strain ATCC 6260 / CBS 566 / DSM 6381 / JCM 1539 / NBRC 10279 / NRRL Y-324) GN=SPB4 PE=3 SV=2 70 492 1.0E-60
sp|Q54VT4|DDX47_DICDI Probable ATP-dependent RNA helicase ddx47 OS=Dictyostelium discoideum GN=ddx47 PE=3 SV=1 50 413 1.0E-60
sp|A1CL59|SPB4_ASPCL ATP-dependent rRNA helicase spb4 OS=Aspergillus clavatus (strain ATCC 1007 / CBS 513.65 / DSM 816 / NCTC 3887 / NRRL 1) GN=spb4 PE=3 SV=1 56 492 1.0E-60
sp|P0CR00|RRP3_CRYNJ ATP-dependent rRNA helicase RRP3 OS=Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565) GN=RRP3 PE=3 SV=1 44 413 2.0E-60
sp|P0CR01|RRP3_CRYNB ATP-dependent rRNA helicase RRP3 OS=Cryptococcus neoformans var. neoformans serotype D (strain B-3501A) GN=RRP3 PE=3 SV=1 44 413 2.0E-60
sp|A7TJM9|DRS1_VANPO ATP-dependent RNA helicase DRS1 OS=Vanderwaltozyma polyspora (strain ATCC 22028 / DSM 70294) GN=DRS1 PE=3 SV=1 46 411 3.0E-60
sp|Q2YUH3|CSHA_STAAB DEAD-box ATP-dependent RNA helicase CshA OS=Staphylococcus aureus (strain bovine RF122 / ET3-1) GN=cshA PE=3 SV=1 51 442 3.0E-60
sp|Q54TJ4|DDX27_DICDI Probable ATP-dependent RNA helicase ddx27 OS=Dictyostelium discoideum GN=ddx27 PE=3 SV=1 51 400 3.0E-60
sp|A3LSN3|DRS1_PICST ATP-dependent RNA helicase DRS1 OS=Scheffersomyces stipitis (strain ATCC 58785 / CBS 6054 / NBRC 10063 / NRRL Y-11545) GN=DRS1 PE=3 SV=3 50 406 4.0E-60
sp|Q9V3C0|DDX41_DROME ATP-dependent RNA helicase abstrakt OS=Drosophila melanogaster GN=abs PE=1 SV=1 46 414 4.0E-60
sp|Q49Z29|CSHA_STAS1 DEAD-box ATP-dependent RNA helicase CshA OS=Staphylococcus saprophyticus subsp. saprophyticus (strain ATCC 15305 / DSM 20229) GN=cshA PE=3 SV=1 51 438 5.0E-60
sp|Q6K7R9|RH48_ORYSJ DEAD-box ATP-dependent RNA helicase 48 OS=Oryza sativa subsp. japonica GN=Os02g0826100 PE=2 SV=1 19 507 5.0E-60
sp|Q5ACU6|RRP3_CANAL ATP-dependent rRNA helicase RRP3 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=RRP3 PE=3 SV=2 51 397 7.0E-60
sp|Q5L3G9|CSHA_GEOKA DEAD-box ATP-dependent RNA helicase CshA OS=Geobacillus kaustophilus (strain HTA426) GN=cshA PE=3 SV=1 49 413 7.0E-60
sp|Q4L7W0|CSHA_STAHJ DEAD-box ATP-dependent RNA helicase CshA OS=Staphylococcus haemolyticus (strain JCSC1435) GN=cshA PE=3 SV=1 51 438 9.0E-60
sp|Q6GEZ3|CSHA_STAAR DEAD-box ATP-dependent RNA helicase CshA OS=Staphylococcus aureus (strain MRSA252) GN=cshA PE=3 SV=1 51 442 1.0E-59
sp|Q7A0D2|CSHA_STAAW DEAD-box ATP-dependent RNA helicase CshA OS=Staphylococcus aureus (strain MW2) GN=cshA PE=3 SV=1 51 442 1.0E-59
sp|Q6G7M9|CSHA_STAAS DEAD-box ATP-dependent RNA helicase CshA OS=Staphylococcus aureus (strain MSSA476) GN=cshA PE=3 SV=1 51 442 1.0E-59
sp|Q7A4G0|CSHA_STAAN DEAD-box ATP-dependent RNA helicase CshA OS=Staphylococcus aureus (strain N315) GN=cshA PE=1 SV=1 51 442 1.0E-59
sp|Q99SH6|CSHA_STAAM DEAD-box ATP-dependent RNA helicase CshA OS=Staphylococcus aureus (strain Mu50 / ATCC 700699) GN=cshA PE=3 SV=1 51 442 1.0E-59
sp|Q5HEB9|CSHA_STAAC DEAD-box ATP-dependent RNA helicase CshA OS=Staphylococcus aureus (strain COL) GN=cshA PE=3 SV=1 51 442 1.0E-59
sp|Q2FWH5|CSHA_STAA8 DEAD-box ATP-dependent RNA helicase CshA OS=Staphylococcus aureus (strain NCTC 8325) GN=cshA PE=1 SV=1 51 442 1.0E-59
sp|Q2FF45|CSHA_STAA3 DEAD-box ATP-dependent RNA helicase CshA OS=Staphylococcus aureus (strain USA300) GN=cshA PE=3 SV=1 51 442 1.0E-59
sp|Q0INC5|RH28_ORYSJ DEAD-box ATP-dependent RNA helicase 28 OS=Oryza sativa subsp. japonica GN=Os12g0481100 PE=2 SV=2 50 400 2.0E-59
sp|Q55BR9|DDX49_DICDI Probable ATP-dependent RNA helicase ddx49 OS=Dictyostelium discoideum GN=ddx49 PE=3 SV=1 51 402 2.0E-59
sp|P96614|CSHA_BACSU DEAD-box ATP-dependent RNA helicase CshA OS=Bacillus subtilis (strain 168) GN=cshA PE=1 SV=2 51 414 3.0E-59
sp|Q09903|DRS1_SCHPO ATP-dependent RNA helicase drs1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=drs1 PE=3 SV=1 46 397 4.0E-59
sp|A1D699|SPB4_NEOFI ATP-dependent rRNA helicase spb4 OS=Neosartorya fischeri (strain ATCC 1020 / DSM 3700 / FGSC A1164 / NRRL 181) GN=spb4 PE=3 SV=1 57 492 4.0E-59
sp|A3LS22|RRP3_PICST ATP-dependent rRNA helicase RRP3 OS=Scheffersomyces stipitis (strain ATCC 58785 / CBS 6054 / NBRC 10063 / NRRL Y-11545) GN=RRP3 PE=3 SV=3 50 418 5.0E-59
sp|Q4WYJ7|SPB4_ASPFU ATP-dependent rRNA helicase spb4 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=spb4 PE=3 SV=2 57 540 5.0E-59
sp|A6R918|SPB4_AJECN ATP-dependent rRNA helicase SPB4 OS=Ajellomyces capsulatus (strain NAm1 / WU24) GN=SPB4 PE=3 SV=2 39 497 5.0E-59
sp|Q6FKS8|SPB4_CANGA ATP-dependent rRNA helicase SPB4 OS=Candida glabrata (strain ATCC 2001 / CBS 138 / JCM 3761 / NBRC 0622 / NRRL Y-65) GN=SPB4 PE=3 SV=1 52 492 6.0E-59
sp|Q5HME0|CSHA_STAEQ DEAD-box ATP-dependent RNA helicase CshA OS=Staphylococcus epidermidis (strain ATCC 35984 / RP62A) GN=cshA PE=3 SV=1 51 438 6.0E-59
sp|Q8CRP6|CSHA_STAES DEAD-box ATP-dependent RNA helicase CshA OS=Staphylococcus epidermidis (strain ATCC 12228) GN=cshA PE=3 SV=1 51 438 8.0E-59
sp|Q75EW9|RRP3_ASHGO ATP-dependent rRNA helicase RRP3 OS=Ashbya gossypii (strain ATCC 10895 / CBS 109.51 / FGSC 9923 / NRRL Y-1056) GN=RRP3 PE=3 SV=2 1 423 9.0E-59
sp|O74764|SPB4_SCHPO ATP-dependent rRNA helicase spb4 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=spb4 PE=3 SV=1 51 492 1.0E-58
sp|Q5B8F4|SPB4_EMENI ATP-dependent rRNA helicase spb4 OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=spb4 PE=3 SV=1 56 492 1.0E-58
sp|A5E6W6|RRP3_LODEL ATP-dependent rRNA helicase RRP3 OS=Lodderomyces elongisporus (strain ATCC 11503 / CBS 2605 / JCM 1781 / NBRC 1676 / NRRL YB-4239) GN=RRP3 PE=3 SV=1 49 397 2.0E-58
sp|Q2UQI6|DRS1_ASPOR ATP-dependent RNA helicase drs1 OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) GN=drs1 PE=3 SV=2 51 397 2.0E-58
sp|A7TS37|RRP3_VANPO ATP-dependent rRNA helicase RRP3 OS=Vanderwaltozyma polyspora (strain ATCC 22028 / DSM 70294) GN=RRP3 PE=3 SV=1 51 423 3.0E-58
sp|Q81DF9|CSHE_BACCR DEAD-box ATP-dependent RNA helicase CshE OS=Bacillus cereus (strain ATCC 14579 / DSM 31 / JCM 2152 / NBRC 15305 / NCIMB 9373 / NRRL B-3711) GN=cshE PE=2 SV=1 51 435 4.0E-58
sp|Q75F95|DRS1_ASHGO ATP-dependent RNA helicase DRS1 OS=Ashbya gossypii (strain ATCC 10895 / CBS 109.51 / FGSC 9923 / NRRL Y-1056) GN=DRS1 PE=3 SV=1 50 406 4.0E-58
sp|Q1E1R7|SPB4_COCIM ATP-dependent rRNA helicase SPB4 OS=Coccidioides immitis (strain RS) GN=SPB4 PE=3 SV=2 56 492 5.0E-58
sp|Q4I830|DRS1_GIBZE ATP-dependent RNA helicase DRS1 OS=Gibberella zeae (strain PH-1 / ATCC MYA-4620 / FGSC 9075 / NRRL 31084) GN=DRS1 PE=3 SV=1 45 397 5.0E-58
sp|P42305|DBPA_BACSU ATP-dependent RNA helicase DbpA OS=Bacillus subtilis (strain 168) GN=dbpA PE=1 SV=2 49 422 7.0E-58
sp|A6SFV4|DBP8_BOTFB ATP-dependent RNA helicase dbp8 OS=Botryotinia fuckeliana (strain B05.10) GN=dbp8 PE=3 SV=1 12 400 9.0E-58
sp|A6RUH2|DRS1_BOTFB ATP-dependent RNA helicase drs1 OS=Botryotinia fuckeliana (strain B05.10) GN=drs1 PE=3 SV=1 50 397 1.0E-57
sp|A3LWH3|DBP7_PICST ATP-dependent RNA helicase DBP7 OS=Scheffersomyces stipitis (strain ATCC 58785 / CBS 6054 / NBRC 10063 / NRRL Y-11545) GN=DPB7 PE=3 SV=2 44 491 1.0E-57
sp|A4QYM6|DRS1_MAGO7 ATP-dependent RNA helicase DRS1 OS=Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958) GN=DRS1 PE=3 SV=1 39 399 1.0E-57
sp|A7E436|DBP8_SCLS1 ATP-dependent RNA helicase dbp8 OS=Sclerotinia sclerotiorum (strain ATCC 18683 / 1980 / Ss-1) GN=dbp8 PE=3 SV=1 12 400 1.0E-57
sp|Q6HPE6|CSHA_BACHK DEAD-box ATP-dependent RNA helicase CshA OS=Bacillus thuringiensis subsp. konkukian (strain 97-27) GN=cshA PE=3 SV=1 49 438 1.0E-57
sp|Q81VG0|CSHA_BACAN DEAD-box ATP-dependent RNA helicase CshA OS=Bacillus anthracis GN=cshA PE=3 SV=1 49 438 1.0E-57
sp|A0R8U6|CSHA_BACAH DEAD-box ATP-dependent RNA helicase CshA OS=Bacillus thuringiensis (strain Al Hakam) GN=cshA PE=3 SV=1 49 438 1.0E-57
sp|A1A4H6|DDX27_BOVIN Probable ATP-dependent RNA helicase DDX27 OS=Bos taurus GN=DDX27 PE=2 SV=1 51 412 1.0E-57
sp|Q96GQ7|DDX27_HUMAN Probable ATP-dependent RNA helicase DDX27 OS=Homo sapiens GN=DDX27 PE=1 SV=2 51 420 2.0E-57
sp|Q2GV49|SPB4_CHAGB ATP-dependent rRNA helicase SPB4 OS=Chaetomium globosum (strain ATCC 6205 / CBS 148.51 / DSM 1962 / NBRC 6347 / NRRL 1970) GN=SPB4 PE=3 SV=1 57 499 2.0E-57
sp|A7F4L5|DRS1_SCLS1 ATP-dependent RNA helicase drs1 OS=Sclerotinia sclerotiorum (strain ATCC 18683 / 1980 / Ss-1) GN=drs1 PE=3 SV=1 50 397 2.0E-57
sp|Q63GX5|CSHA_BACCZ DEAD-box ATP-dependent RNA helicase CshA OS=Bacillus cereus (strain ZK / E33L) GN=cshA PE=3 SV=1 49 438 2.0E-57
sp|A1CNV8|DRS1_ASPCL ATP-dependent RNA helicase drs1 OS=Aspergillus clavatus (strain ATCC 1007 / CBS 513.65 / DSM 816 / NCTC 3887 / NRRL 1) GN=drs1 PE=3 SV=1 51 402 2.0E-57
sp|Q73EU1|CSHA_BACC1 DEAD-box ATP-dependent RNA helicase CshA OS=Bacillus cereus (strain ATCC 10987 / NRS 248) GN=cshA PE=3 SV=1 49 413 2.0E-57
sp|P0C2N8|DRS1_NEUCR ATP-dependent RNA helicase drs1 OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=drh-11 PE=3 SV=1 45 399 2.0E-57
sp|Q81IT9|CSHA_BACCR DEAD-box ATP-dependent RNA helicase CshA OS=Bacillus cereus (strain ATCC 14579 / DSM 31 / JCM 2152 / NBRC 15305 / NCIMB 9373 / NRRL B-3711) GN=cshA PE=2 SV=2 49 438 2.0E-57
sp|Q65N62|CSHA_BACLD DEAD-box ATP-dependent RNA helicase CshA OS=Bacillus licheniformis (strain ATCC 14580 / DSM 13 / JCM 2505 / NBRC 12200 / NCIMB 9375 / NRRL NRS-1264 / Gibson 46) GN=cshA PE=3 SV=1 51 414 2.0E-57
sp|A1D1R8|DRS1_NEOFI ATP-dependent RNA helicase drs1 OS=Neosartorya fischeri (strain ATCC 1020 / DSM 3700 / FGSC A1164 / NRRL 181) GN=drs1 PE=3 SV=1 51 397 3.0E-57
sp|Q0V1Z7|DRS1_PHANO ATP-dependent RNA helicase DRS1 OS=Phaeosphaeria nodorum (strain SN15 / ATCC MYA-4574 / FGSC 10173) GN=DRS1 PE=3 SV=1 49 399 3.0E-57
sp|Q10202|DBP3_SCHPO ATP-dependent RNA helicase dbp3 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=dbp3 PE=3 SV=1 39 453 4.0E-57
sp|Q4WRV2|DRS1_ASPFU ATP-dependent RNA helicase drs1 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=drs1 PE=3 SV=1 51 397 4.0E-57
sp|Q1E2B2|DRS1_COCIM ATP-dependent RNA helicase DRS1 OS=Coccidioides immitis (strain RS) GN=DRS1 PE=3 SV=1 45 397 5.0E-57
sp|Q6FNK8|RRP3_CANGA ATP-dependent rRNA helicase RRP3 OS=Candida glabrata (strain ATCC 2001 / CBS 138 / JCM 3761 / NBRC 0622 / NRRL Y-65) GN=RRP3 PE=3 SV=1 51 423 6.0E-57
sp|Q0CZN5|DRS1_ASPTN ATP-dependent RNA helicase drs1 OS=Aspergillus terreus (strain NIH 2624 / FGSC A1156) GN=drs1 PE=3 SV=1 51 397 6.0E-57
sp|A6ZSX1|RRP3_YEAS7 ATP-dependent rRNA helicase RRP3 OS=Saccharomyces cerevisiae (strain YJM789) GN=RRP3 PE=3 SV=1 51 423 6.0E-57
sp|P38712|RRP3_YEAST ATP-dependent rRNA helicase RRP3 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=RRP3 PE=1 SV=2 51 423 9.0E-57
sp|Q6CT85|RRP3_KLULA ATP-dependent rRNA helicase RRP3 OS=Kluyveromyces lactis (strain ATCC 8585 / CBS 2359 / DSM 70799 / NBRC 1267 / NRRL Y-1140 / WM37) GN=RRP3 PE=3 SV=1 53 423 1.0E-56
sp|Q8GY84|RH10_ARATH DEAD-box ATP-dependent RNA helicase 10 OS=Arabidopsis thaliana GN=RH10 PE=2 SV=2 42 418 1.0E-56
sp|Q921N6|DDX27_MOUSE Probable ATP-dependent RNA helicase DDX27 OS=Mus musculus GN=Ddx27 PE=1 SV=3 51 412 1.0E-56
sp|Q7ZY47|DDX42_XENLA ATP-dependent RNA helicase DDX42 OS=Xenopus laevis GN=ddx42 PE=2 SV=1 49 406 2.0E-56
sp|A5DY34|DRS1_LODEL ATP-dependent RNA helicase DRS1 OS=Lodderomyces elongisporus (strain ATCC 11503 / CBS 2605 / JCM 1781 / NBRC 1676 / NRRL YB-4239) GN=DRS1 PE=3 SV=1 37 406 2.0E-56
sp|Q4I662|DBP8_GIBZE ATP-dependent RNA helicase DBP8 OS=Gibberella zeae (strain PH-1 / ATCC MYA-4620 / FGSC 9075 / NRRL 31084) GN=DBP8 PE=3 SV=1 46 400 3.0E-56
sp|P25808|SPB4_YEAST ATP-dependent rRNA helicase SPB4 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=SPB4 PE=1 SV=1 52 492 3.0E-56
sp|A7A237|SPB4_YEAS7 ATP-dependent rRNA helicase SPB4 OS=Saccharomyces cerevisiae (strain YJM789) GN=SPB4 PE=3 SV=1 52 492 3.0E-56
sp|Q9Z6C9|CSHA_LACRE ATP-dependent RNA helicase CshA OS=Lactobacillus reuteri GN=cshA PE=3 SV=1 52 406 4.0E-56
sp|Q9P7C7|PRP11_SCHPO Pre-mRNA-processing ATP-dependent RNA helicase prp11 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=prp11 PE=3 SV=1 48 443 4.0E-56
sp|A5DAR2|DBP7_PICGU ATP-dependent RNA helicase DBP7 OS=Meyerozyma guilliermondii (strain ATCC 6260 / CBS 566 / DSM 6381 / JCM 1539 / NBRC 10279 / NRRL Y-324) GN=DBP7 PE=3 SV=3 24 511 5.0E-56
sp|Q8SR49|SPB4_ENCCU ATP-dependent rRNA helicase SPB4 OS=Encephalitozoon cuniculi (strain GB-M1) GN=SPB4 PE=3 SV=1 70 496 6.0E-56
sp|Q810A7|DDX42_MOUSE ATP-dependent RNA helicase DDX42 OS=Mus musculus GN=Ddx42 PE=1 SV=3 48 406 6.0E-56
sp|Q86XP3|DDX42_HUMAN ATP-dependent RNA helicase DDX42 OS=Homo sapiens GN=DDX42 PE=1 SV=1 48 406 8.0E-56
sp|A2QAX7|DRS1_ASPNC ATP-dependent RNA helicase drs1 OS=Aspergillus niger (strain CBS 513.88 / FGSC A1513) GN=drs1 PE=3 SV=1 51 397 8.0E-56
sp|Q6BY27|DBP2_DEBHA ATP-dependent RNA helicase DBP2 OS=Debaryomyces hansenii (strain ATCC 36239 / CBS 767 / JCM 1990 / NBRC 0083 / IGC 2968) GN=DBP2 PE=3 SV=1 48 400 8.0E-56
sp|Q9UJV9|DDX41_HUMAN Probable ATP-dependent RNA helicase DDX41 OS=Homo sapiens GN=DDX41 PE=1 SV=2 48 413 1.0E-55
sp|Q91VN6|DDX41_MOUSE Probable ATP-dependent RNA helicase DDX41 OS=Mus musculus GN=Ddx41 PE=1 SV=2 48 413 2.0E-55
sp|Q814I2|DBPA_BACCR ATP-dependent RNA helicase DbpA OS=Bacillus cereus (strain ATCC 14579 / DSM 31 / JCM 2152 / NBRC 15305 / NCIMB 9373 / NRRL B-3711) GN=dbpA PE=2 SV=1 51 404 2.0E-55
sp|Q8W4R3|RH30_ARATH DEAD-box ATP-dependent RNA helicase 30 OS=Arabidopsis thaliana GN=RH30 PE=2 SV=2 48 400 2.0E-55
sp|Q1E9T9|DBP7_COCIM ATP-dependent RNA helicase DBP7 OS=Coccidioides immitis (strain RS) GN=DBP7 PE=3 SV=1 29 519 2.0E-55
sp|Q4WV71|DBP7_ASPFU ATP-dependent RNA helicase dbp7 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=dbp7 PE=3 SV=1 11 490 2.0E-55
sp|Q5R7D1|DDX42_PONAB ATP-dependent RNA helicase DDX42 OS=Pongo abelii GN=DDX42 PE=2 SV=1 48 406 2.0E-55
sp|Q873H9|SPB4_NEUCR ATP-dependent rRNA helicase spb-4 OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=spb-4 PE=3 SV=1 56 492 3.0E-55
sp|Q59S50|DBP7_CANAL ATP-dependent RNA helicase DBP7 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=DBP7 PE=3 SV=1 44 491 5.0E-55
sp|Q6C193|SPB4_YARLI ATP-dependent rRNA helicase SPB4 OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=SPB4 PE=3 SV=1 50 506 5.0E-55
sp|Q9Y6V7|DDX49_HUMAN Probable ATP-dependent RNA helicase DDX49 OS=Homo sapiens GN=DDX49 PE=1 SV=1 49 400 6.0E-55
sp|Q8Y8N0|CSHA_LISMO ATP-dependent RNA helicase CshA OS=Listeria monocytogenes serovar 1/2a (strain ATCC BAA-679 / EGD-e) GN=cshA PE=2 SV=1 49 413 7.0E-55
sp|Q553B1|DDX46_DICDI ATP-dependent RNA helicase ddx46 OS=Dictyostelium discoideum GN=helB1 PE=2 SV=1 48 430 8.0E-55
sp|Q4FZF3|DDX49_MOUSE Probable ATP-dependent RNA helicase DDX49 OS=Mus musculus GN=Ddx49 PE=2 SV=1 49 400 9.0E-55
sp|A7TK63|DBP8_VANPO ATP-dependent RNA helicase DBP8 OS=Vanderwaltozyma polyspora (strain ATCC 22028 / DSM 70294) GN=DBP8 PE=3 SV=1 52 402 1.0E-54
sp|Q755N4|DBP2_ASHGO ATP-dependent RNA helicase DBP2 OS=Ashbya gossypii (strain ATCC 10895 / CBS 109.51 / FGSC 9923 / NRRL Y-1056) GN=DBP2 PE=3 SV=2 48 400 2.0E-54
sp|Q5F485|DDX42_CHICK ATP-dependent RNA helicase DDX42 OS=Gallus gallus GN=DDX42 PE=2 SV=1 48 406 2.0E-54
sp|Q9SQV1|RH40_ARATH DEAD-box ATP-dependent RNA helicase 40 OS=Arabidopsis thaliana GN=RH40 PE=2 SV=1 47 420 2.0E-54
sp|A1DE84|DBP7_NEOFI ATP-dependent RNA helicase dbp7 OS=Neosartorya fischeri (strain ATCC 1020 / DSM 3700 / FGSC A1164 / NRRL 181) GN=dbp7 PE=3 SV=1 11 490 2.0E-54
sp|Q4P9P3|DRS1_USTMA ATP-dependent RNA helicase DRS1 OS=Ustilago maydis (strain 521 / FGSC 9021) GN=DRS1 PE=3 SV=1 50 567 3.0E-54
sp|Q0U8V9|DBP8_PHANO ATP-dependent RNA helicase DBP8 OS=Phaeosphaeria nodorum (strain SN15 / ATCC MYA-4574 / FGSC 10173) GN=DBP8 PE=3 SV=1 50 400 5.0E-54
sp|Q6CN92|SPB4_KLULA ATP-dependent rRNA helicase SPB4 OS=Kluyveromyces lactis (strain ATCC 8585 / CBS 2359 / DSM 70799 / NBRC 1267 / NRRL Y-1140 / WM37) GN=SPB4 PE=3 SV=1 63 492 8.0E-54
sp|Q5BGX6|DBP7_EMENI ATP-dependent RNA helicase dbp7 OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=dbp7 PE=3 SV=1 11 510 8.0E-54
sp|Q6FLF3|DBP2_CANGA ATP-dependent RNA helicase DBP2 OS=Candida glabrata (strain ATCC 2001 / CBS 138 / JCM 3761 / NBRC 0622 / NRRL Y-65) GN=DBP2 PE=3 SV=1 48 436 9.0E-54
sp|Q84UQ1|RH42_ORYSJ DEAD-box ATP-dependent RNA helicase 42 OS=Oryza sativa subsp. japonica GN=Os08g0159900 PE=2 SV=1 48 405 1.0E-53
sp|Q750F8|SPB4_ASHGO ATP-dependent rRNA helicase SPB4 OS=Ashbya gossypii (strain ATCC 10895 / CBS 109.51 / FGSC 9923 / NRRL Y-1056) GN=SPB4 PE=3 SV=2 54 500 1.0E-53
sp|Q4HZ68|DBP7_GIBZE ATP-dependent RNA helicase DBP7 OS=Gibberella zeae (strain PH-1 / ATCC MYA-4620 / FGSC 9075 / NRRL 31084) GN=DBP7 PE=3 SV=1 25 418 1.0E-53
sp|Q6C4D4|DBP2_YARLI ATP-dependent RNA helicase DBP2 OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=DBP2 PE=3 SV=1 48 400 2.0E-53
sp|A2YV85|RH29_ORYSI DEAD-box ATP-dependent RNA helicase 29 OS=Oryza sativa subsp. indica GN=OsI_028228 PE=2 SV=2 52 400 2.0E-53
sp|Q6CIV2|DBP2_KLULA ATP-dependent RNA helicase DBP2 OS=Kluyveromyces lactis (strain ATCC 8585 / CBS 2359 / DSM 70799 / NBRC 1267 / NRRL Y-1140 / WM37) GN=DBP2 PE=3 SV=1 36 400 2.0E-53
sp|A3BT52|RH29_ORYSJ DEAD-box ATP-dependent RNA helicase 29 OS=Oryza sativa subsp. japonica GN=Os08g0416100 PE=2 SV=2 52 400 2.0E-53
sp|A6RSH5|DBP7_BOTFB ATP-dependent RNA helicase dbp7 OS=Botryotinia fuckeliana (strain B05.10) GN=dbp7 PE=3 SV=1 30 490 3.0E-53
sp|Q58083|H669_METJA Probable ATP-dependent RNA helicase MJ0669 OS=Methanocaldococcus jannaschii (strain ATCC 43067 / DSM 2661 / JAL-1 / JCM 10045 / NBRC 100440) GN=MJ0669 PE=1 SV=1 51 417 3.0E-53
sp|Q59LU0|DBP2_CANAL ATP-dependent RNA helicase DBP2 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=DBP2 PE=3 SV=2 48 400 4.0E-53
sp|Q4P9E5|SPB4_USTMA ATP-dependent rRNA helicase SPB4 OS=Ustilago maydis (strain 521 / FGSC 9021) GN=SPB4 PE=3 SV=2 56 492 4.0E-53
sp|O49289|RH29_ARATH Putative DEAD-box ATP-dependent RNA helicase 29 OS=Arabidopsis thaliana GN=RH29 PE=3 SV=1 52 409 6.0E-53
sp|Q55804|CRHR_SYNY3 RNA helicase CrhR OS=Synechocystis sp. (strain PCC 6803 / Kazusa) GN=crhR PE=1 SV=1 49 437 6.0E-53
sp|Q4TVV3|DDX46_DANRE Probable ATP-dependent RNA helicase DDX46 OS=Danio rerio GN=ddx46 PE=2 SV=1 48 400 7.0E-53
sp|A1CB55|DBP7_ASPCL ATP-dependent RNA helicase dbp7 OS=Aspergillus clavatus (strain ATCC 1007 / CBS 513.65 / DSM 816 / NCTC 3887 / NRRL 1) GN=dbp7 PE=3 SV=1 11 509 7.0E-53
sp|O22907|RH24_ARATH DEAD-box ATP-dependent RNA helicase 24 OS=Arabidopsis thaliana GN=RH24 PE=1 SV=2 48 389 8.0E-53
sp|A5DLE0|DBP8_PICGU ATP-dependent RNA helicase DBP8 OS=Meyerozyma guilliermondii (strain ATCC 6260 / CBS 566 / DSM 6381 / JCM 1539 / NBRC 10279 / NRRL Y-324) GN=DBP8 PE=3 SV=2 51 406 8.0E-53
sp|Q5QMN3|RH20_ORYSJ DEAD-box ATP-dependent RNA helicase 20 OS=Oryza sativa subsp. japonica GN=Os01g0197200 PE=3 SV=2 19 400 9.0E-53
sp|A7F8V8|DBP7_SCLS1 ATP-dependent RNA helicase dbp7 OS=Sclerotinia sclerotiorum (strain ATCC 18683 / 1980 / Ss-1) GN=dbp7 PE=3 SV=1 30 490 9.0E-53
sp|Q8L4E9|RH36_ORYSJ DEAD-box ATP-dependent RNA helicase 36 OS=Oryza sativa subsp. japonica GN=Os07g0633500 PE=3 SV=1 50 413 1.0E-52
sp|Q0E3X4|RH35A_ORYSJ DEAD-box ATP-dependent RNA helicase 35A OS=Oryza sativa subsp. japonica GN=Os02g0150100 PE=2 SV=2 48 414 1.0E-52
sp|Q8H0U8|RH42_ARATH DEAD-box ATP-dependent RNA helicase 42 OS=Arabidopsis thaliana GN=RH42 PE=1 SV=2 48 419 1.0E-52
sp|A5DL80|DBP2_PICGU ATP-dependent RNA helicase DBP2 OS=Meyerozyma guilliermondii (strain ATCC 6260 / CBS 566 / DSM 6381 / JCM 1539 / NBRC 10279 / NRRL Y-324) GN=DBP2 PE=3 SV=3 16 407 2.0E-52
sp|Q9C718|RH20_ARATH DEAD-box ATP-dependent RNA helicase 20 OS=Arabidopsis thaliana GN=RH20 PE=2 SV=1 28 400 2.0E-52
sp|O80792|RH33_ARATH Putative DEAD-box ATP-dependent RNA helicase 33 OS=Arabidopsis thaliana GN=RH33 PE=3 SV=1 52 492 2.0E-52
sp|P24783|DBP2_YEAST ATP-dependent RNA helicase DBP2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=DBP2 PE=1 SV=1 36 400 2.0E-52
sp|A6ZRX0|DBP2_YEAS7 ATP-dependent RNA helicase DBP2 OS=Saccharomyces cerevisiae (strain YJM789) GN=DBP2 PE=3 SV=1 36 400 2.0E-52
sp|Q9C8S9|RH48_ARATH Probable DEAD-box ATP-dependent RNA helicase 48 OS=Arabidopsis thaliana GN=RH48 PE=3 SV=1 52 404 3.0E-52
sp|A3LX02|SPB4_PICST ATP-dependent rRNA helicase SPB4 OS=Scheffersomyces stipitis (strain ATCC 58785 / CBS 6054 / NBRC 10063 / NRRL Y-11545) GN=SPB4 PE=3 SV=2 56 492 3.0E-52
sp|Q54CD8|DDX54_DICDI ATP-dependent RNA helicase ddx54 OS=Dictyostelium discoideum GN=helA PE=3 SV=1 52 409 3.0E-52
sp|P0C2N7|DRS1_CHAGB ATP-dependent RNA helicase DRS1 OS=Chaetomium globosum (strain ATCC 6205 / CBS 148.51 / DSM 1962 / NBRC 6347 / NRRL 1970) GN=DRS1 PE=3 SV=1 45 399 5.0E-52
sp|Q9LYJ9|RH46_ARATH DEAD-box ATP-dependent RNA helicase 46 OS=Arabidopsis thaliana GN=RH46 PE=2 SV=2 48 420 7.0E-52
sp|Q3MSQ8|DDX4_PELLE Probable ATP-dependent RNA helicase DDX4 OS=Pelophylax lessonae GN=ddx4 PE=2 SV=1 49 418 7.0E-52
sp|Q8H136|RH14_ARATH DEAD-box ATP-dependent RNA helicase 14 OS=Arabidopsis thaliana GN=RH14 PE=1 SV=2 48 420 8.0E-52
sp|Q0CF43|DBP7_ASPTN ATP-dependent RNA helicase dbp7 OS=Aspergillus terreus (strain NIH 2624 / FGSC A1156) GN=dbp7 PE=3 SV=2 44 490 8.0E-52
sp|Q9VHP0|DDX3_DROME ATP-dependent RNA helicase bel OS=Drosophila melanogaster GN=bel PE=1 SV=1 49 401 9.0E-52
sp|Q5VQL1|RH14_ORYSJ DEAD-box ATP-dependent RNA helicase 14 OS=Oryza sativa subsp. japonica GN=Os01g0172200 PE=2 SV=1 47 400 1.0E-51
sp|A1C5V3|DBP3_ASPCL ATP-dependent RNA helicase dbp3 OS=Aspergillus clavatus (strain ATCC 1007 / CBS 513.65 / DSM 816 / NCTC 3887 / NRRL 1) GN=dbp3 PE=3 SV=1 44 436 1.0E-51
sp|Q5A4E2|DED1_CANAL ATP-dependent RNA helicase DED1 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=DED1 PE=3 SV=1 40 418 1.0E-51
sp|O25029|RHPA_HELPY DEAD-box ATP-dependent RNA helicase RhpA OS=Helicobacter pylori (strain ATCC 700392 / 26695) GN=rhpA PE=1 SV=1 51 410 2.0E-51
sp|Q6FQZ0|DBP8_CANGA ATP-dependent RNA helicase DBP8 OS=Candida glabrata (strain ATCC 2001 / CBS 138 / JCM 3761 / NBRC 0622 / NRRL Y-65) GN=DBP8 PE=3 SV=1 51 423 2.0E-51
sp|B9XXL6|RHPA_HELP8 DEAD-box ATP-dependent RNA helicase RhpA OS=Helicobacter pylori (strain B128) GN=rhpA PE=1 SV=1 51 410 2.0E-51
sp|Q6CSZ7|DHH1_KLULA ATP-dependent RNA helicase DHH1 OS=Kluyveromyces lactis (strain ATCC 8585 / CBS 2359 / DSM 70799 / NBRC 1267 / NRRL Y-1140 / WM37) GN=DHH1 PE=3 SV=1 51 410 3.0E-51
sp|Q5B3H7|DBP8_EMENI ATP-dependent RNA helicase dbp8 OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=dbp8 PE=3 SV=1 51 400 3.0E-51
sp|Q59N29|SPB4_CANAL ATP-dependent rRNA helicase SPB41 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=SPB4 PE=3 SV=1 70 492 3.0E-51
sp|A3LQW7|DBP2_PICST ATP-dependent RNA helicase DBP2 OS=Scheffersomyces stipitis (strain ATCC 58785 / CBS 6054 / NBRC 10063 / NRRL Y-11545) GN=DBP2 PE=3 SV=1 48 384 3.0E-51
sp|Q59NP8|SPB42_CANAL ATP-dependent rRNA helicase SPB42 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=SPB42 PE=3 SV=1 70 492 3.0E-51
sp|Q2GZU7|DBP7_CHAGB ATP-dependent RNA helicase DBP7 OS=Chaetomium globosum (strain ATCC 6205 / CBS 148.51 / DSM 1962 / NBRC 6347 / NRRL 1970) GN=DBP7 PE=3 SV=1 74 407 3.0E-51
sp|A7ESL7|DBP10_SCLS1 ATP-dependent RNA helicase dbp10 OS=Sclerotinia sclerotiorum (strain ATCC 18683 / 1980 / Ss-1) GN=dbp10 PE=3 SV=2 52 394 3.0E-51
sp|A2RA55|DBP7_ASPNC ATP-dependent RNA helicase dbp7 OS=Aspergillus niger (strain CBS 513.88 / FGSC A1513) GN=dbp7 PE=3 SV=1 11 490 4.0E-51
sp|A5DU73|PRP28_LODEL Pre-mRNA-splicing ATP-dependent RNA helicase PRP28 OS=Lodderomyces elongisporus (strain ATCC 11503 / CBS 2605 / JCM 1781 / NBRC 1676 / NRRL YB-4239) GN=PRP28 PE=3 SV=1 57 424 4.0E-51
sp|Q5JKF2|RH40_ORYSJ DEAD-box ATP-dependent RNA helicase 40 OS=Oryza sativa subsp. japonica GN=Os01g0549400 PE=2 SV=2 47 400 5.0E-51
sp|Q6C799|DBP8_YARLI ATP-dependent RNA helicase DBP8 OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=DBP8 PE=3 SV=1 51 397 5.0E-51
sp|Q1DZK8|DBP3_COCIM ATP-dependent RNA helicase DBP3 OS=Coccidioides immitis (strain RS) GN=DBP3 PE=3 SV=2 13 436 5.0E-51
sp|Q2UST1|MS116_ASPOR ATP-dependent RNA helicase mss116, mitochondrial OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) GN=mss116 PE=3 SV=1 57 499 5.0E-51
sp|Q7S873|DBP7_NEUCR ATP-dependent RNA helicase dbp-7 OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=dbp-7 PE=3 SV=1 28 419 6.0E-51
sp|A1SAL1|RHLB_SHEAM ATP-dependent RNA helicase RhlB OS=Shewanella amazonensis (strain ATCC BAA-1098 / SB2B) GN=rhlB PE=3 SV=1 52 399 6.0E-51
sp|Q4WP13|DED1_ASPFU ATP-dependent RNA helicase ded1 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=ded1 PE=3 SV=1 48 418 7.0E-51
sp|Q2H0R2|DBP10_CHAGB ATP-dependent RNA helicase DBP10 OS=Chaetomium globosum (strain ATCC 6205 / CBS 148.51 / DSM 1962 / NBRC 6347 / NRRL 1970) GN=DBP10 PE=3 SV=1 52 423 8.0E-51
sp|Q1EB38|DBP10_COCIM ATP-dependent RNA helicase DBP10 OS=Coccidioides immitis (strain RS) GN=DBP10 PE=3 SV=1 52 394 9.0E-51
sp|Q6CLR3|DED1_KLULA ATP-dependent RNA helicase DED1 OS=Kluyveromyces lactis (strain ATCC 8585 / CBS 2359 / DSM 70799 / NBRC 1267 / NRRL Y-1140 / WM37) GN=DED1 PE=3 SV=1 48 401 9.0E-51
sp|Q5Z6G5|RH35B_ORYSJ DEAD-box ATP-dependent RNA helicase 35B OS=Oryza sativa subsp. japonica GN=Os06g0697200 PE=3 SV=1 48 409 1.0E-50
sp|Q9HGM5|DBP8_SCHPO ATP-dependent RNA helicase dbp8 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=dbp8 PE=3 SV=1 51 397 1.0E-50
sp|A7TJS7|SPB4_VANPO ATP-dependent rRNA helicase SPB4 OS=Vanderwaltozyma polyspora (strain ATCC 22028 / DSM 70294) GN=SPB4 PE=3 SV=1 54 492 1.0E-50
sp|A7TGU7|DHH1_VANPO ATP-dependent RNA helicase DHH1 OS=Vanderwaltozyma polyspora (strain ATCC 22028 / DSM 70294) GN=DHH1 PE=3 SV=1 44 410 1.0E-50
sp|Q10MH8|RH24_ORYSJ DEAD-box ATP-dependent RNA helicase 24 OS=Oryza sativa subsp. japonica GN=Os03g0308500 PE=2 SV=1 14 393 1.0E-50
sp|Q5BFU7|DBP10_EMENI ATP-dependent RNA helicase dbp10 OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=dbp10 PE=3 SV=1 52 394 1.0E-50
sp|Q2UMH8|DBP3_ASPOR ATP-dependent RNA helicase dbp3 OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) GN=dbp3 PE=3 SV=1 48 436 1.0E-50
sp|Q501J6|DDX17_MOUSE Probable ATP-dependent RNA helicase DDX17 OS=Mus musculus GN=Ddx17 PE=1 SV=1 19 404 1.0E-50
sp|A5E2I8|SPB4_LODEL ATP-dependent rRNA helicase SPB4 OS=Lodderomyces elongisporus (strain ATCC 11503 / CBS 2605 / JCM 1781 / NBRC 1676 / NRRL YB-4239) GN=SPB4 PE=3 SV=1 64 492 1.0E-50
sp|A5AA68|DBP8_ASPNC ATP-dependent RNA helicase dbp8 OS=Aspergillus niger (strain CBS 513.88 / FGSC A1513) GN=dbp8 PE=3 SV=1 51 400 1.0E-50
sp|P25888|RHLE_ECOLI ATP-dependent RNA helicase RhlE OS=Escherichia coli (strain K12) GN=rhlE PE=1 SV=3 51 418 1.0E-50
sp|Q8RXK6|RH8_ARATH DEAD-box ATP-dependent RNA helicase 8 OS=Arabidopsis thaliana GN=RH8 PE=2 SV=1 52 418 2.0E-50
sp|Q8NJM2|DBP10_ASPFU ATP-dependent RNA helicase dbp10 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=dbp10 PE=3 SV=1 52 394 2.0E-50
sp|A2QI25|DED1_ASPNC ATP-dependent RNA helicase ded1 OS=Aspergillus niger (strain CBS 513.88 / FGSC A1513) GN=ded1 PE=3 SV=1 48 401 2.0E-50
sp|Q6CB69|DED1_YARLI ATP-dependent RNA helicase DED1 OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=DED1 PE=3 SV=1 48 418 2.0E-50
sp|Q4IP34|PRP5_GIBZE Pre-mRNA-processing ATP-dependent RNA helicase PRP5 OS=Gibberella zeae (strain PH-1 / ATCC MYA-4620 / FGSC 9075 / NRRL 31084) GN=PRP5 PE=3 SV=2 48 433 2.0E-50
sp|Q09719|DBP10_SCHPO ATP-dependent RNA helicase dbp10 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=dbp10 PE=1 SV=1 50 396 2.0E-50
sp|Q6FQU5|DHH1_CANGA ATP-dependent RNA helicase DHH1 OS=Candida glabrata (strain ATCC 2001 / CBS 138 / JCM 3761 / NBRC 0622 / NRRL Y-65) GN=DHH1 PE=3 SV=1 50 410 2.0E-50
sp|P24784|DBP1_YEAST ATP-dependent RNA helicase DBP1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=DBP1 PE=1 SV=2 48 418 2.0E-50
sp|Q9SA27|RH36_ARATH DEAD-box ATP-dependent RNA helicase 36 OS=Arabidopsis thaliana GN=RH36 PE=2 SV=1 46 397 2.0E-50
sp|A6ZP47|DED1_YEAS7 ATP-dependent RNA helicase DED1 OS=Saccharomyces cerevisiae (strain YJM789) GN=DED1 PE=3 SV=1 48 412 3.0E-50
sp|A1CXK7|DED1_NEOFI ATP-dependent RNA helicase ded1 OS=Neosartorya fischeri (strain ATCC 1020 / DSM 3700 / FGSC A1164 / NRRL 181) GN=ded1 PE=3 SV=1 48 418 3.0E-50
sp|Q75BS4|DHH1_ASHGO ATP-dependent RNA helicase DHH1 OS=Ashbya gossypii (strain ATCC 10895 / CBS 109.51 / FGSC 9923 / NRRL Y-1056) GN=DHH1 PE=3 SV=1 50 444 3.0E-50
sp|Q6CEB8|DRS1_YARLI ATP-dependent RNA helicase DRS1 OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=DRS1 PE=3 SV=1 51 411 3.0E-50
sp|P06634|DED1_YEAST ATP-dependent RNA helicase DED1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=DED1 PE=1 SV=2 48 412 3.0E-50
sp|A1DNG2|DBP10_NEOFI ATP-dependent RNA helicase dbp10 OS=Neosartorya fischeri (strain ATCC 1020 / DSM 3700 / FGSC A1164 / NRRL 181) GN=dbp10 PE=3 SV=1 52 394 3.0E-50
sp|A6ZWD3|DBP1_YEAS7 ATP-dependent RNA helicase DBP1 OS=Saccharomyces cerevisiae (strain YJM789) GN=DBP1 PE=3 SV=1 48 406 3.0E-50
sp|P39517|DHH1_YEAST ATP-dependent RNA helicase DHH1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=DHH1 PE=1 SV=1 50 410 3.0E-50
sp|A6ZXG9|DHH1_YEAS7 ATP-dependent RNA helicase DHH1 OS=Saccharomyces cerevisiae (strain YJM789) GN=DHH1 PE=3 SV=1 50 410 3.0E-50
sp|Q54KG1|DDX41_DICDI Probable ATP-dependent RNA helicase ddx41 OS=Dictyostelium discoideum GN=ddx41 PE=1 SV=1 21 401 3.0E-50
sp|Q9Y7C4|ROK1_CANAL ATP-dependent RNA helicase CHR1 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=CHR1 PE=3 SV=1 48 410 3.0E-50
sp|A1CH78|DED1_ASPCL ATP-dependent RNA helicase ded1 OS=Aspergillus clavatus (strain ATCC 1007 / CBS 513.65 / DSM 816 / NCTC 3887 / NRRL 1) GN=ded1 PE=3 SV=1 48 418 4.0E-50
sp|A5DZE6|DED1_LODEL ATP-dependent RNA helicase DED1 OS=Lodderomyces elongisporus (strain ATCC 11503 / CBS 2605 / JCM 1781 / NBRC 1676 / NRRL YB-4239) GN=DED1 PE=3 SV=1 48 418 5.0E-50
sp|Q6FP38|DBP1_CANGA ATP-dependent RNA helicase DBP1 OS=Candida glabrata (strain ATCC 2001 / CBS 138 / JCM 3761 / NBRC 0622 / NRRL Y-65) GN=DBP1 PE=3 SV=1 40 430 5.0E-50
sp|P93008|RH21_ARATH DEAD-box ATP-dependent RNA helicase 21 OS=Arabidopsis thaliana GN=RH21 PE=2 SV=1 48 400 5.0E-50
sp|Q879Y6|RHLB_XYLFT ATP-dependent RNA helicase RhlB OS=Xylella fastidiosa (strain Temecula1 / ATCC 700964) GN=rhlB PE=3 SV=1 48 399 5.0E-50
sp|Q6CXW0|DBP8_KLULA ATP-dependent RNA helicase DBP8 OS=Kluyveromyces lactis (strain ATCC 8585 / CBS 2359 / DSM 70799 / NBRC 1267 / NRRL Y-1140 / WM37) GN=DBP8 PE=3 SV=1 50 425 6.0E-50
sp|P46942|DB10_NICSY ATP-dependent RNA helicase-like protein DB10 OS=Nicotiana sylvestris PE=2 SV=1 47 400 6.0E-50
sp|Q9LU46|RH35_ARATH DEAD-box ATP-dependent RNA helicase 35 OS=Arabidopsis thaliana GN=RH35 PE=2 SV=1 48 414 6.0E-50
sp|A5DQS0|DED1_PICGU ATP-dependent RNA helicase DED1 OS=Meyerozyma guilliermondii (strain ATCC 6260 / CBS 566 / DSM 6381 / JCM 1539 / NBRC 10279 / NRRL Y-324) GN=DED1 PE=3 SV=3 40 418 7.0E-50
sp|Q6BSM3|SPB4_DEBHA ATP-dependent rRNA helicase SPB4 OS=Debaryomyces hansenii (strain ATCC 36239 / CBS 767 / JCM 1990 / NBRC 0083 / IGC 2968) GN=SPB4 PE=3 SV=1 64 492 8.0E-50
sp|P16381|DDX3L_MOUSE Putative ATP-dependent RNA helicase Pl10 OS=Mus musculus GN=D1Pas1 PE=1 SV=1 49 401 8.0E-50
sp|P24346|DDX3_XENLA Putative ATP-dependent RNA helicase an3 OS=Xenopus laevis GN=an3 PE=2 SV=1 49 401 8.0E-50
sp|Q0UWA6|DED1_PHANO ATP-dependent RNA helicase DED1 OS=Phaeosphaeria nodorum (strain SN15 / ATCC MYA-4574 / FGSC 10173) GN=DED1 PE=3 SV=1 48 401 9.0E-50
sp|Q6BJX6|DHH1_DEBHA ATP-dependent RNA helicase DHH1 OS=Debaryomyces hansenii (strain ATCC 36239 / CBS 767 / JCM 1990 / NBRC 0083 / IGC 2968) GN=DHH1 PE=3 SV=2 51 410 9.0E-50
sp|A6QXC1|DBP3_AJECN ATP-dependent RNA helicase DBP3 OS=Ajellomyces capsulatus (strain NAm1 / WU24) GN=DBP3 PE=3 SV=1 2 409 9.0E-50
sp|Q757U8|DBP10_ASHGO ATP-dependent RNA helicase DBP10 OS=Ashbya gossypii (strain ATCC 10895 / CBS 109.51 / FGSC 9923 / NRRL Y-1056) GN=DBP10 PE=3 SV=1 30 451 9.0E-50
sp|Q2UGK3|DED1_ASPOR ATP-dependent RNA helicase ded1 OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) GN=ded1 PE=3 SV=1 48 401 1.0E-49
sp|Q92841|DDX17_HUMAN Probable ATP-dependent RNA helicase DDX17 OS=Homo sapiens GN=DDX17 PE=1 SV=2 19 404 1.0E-49
sp|Q8K4L0|DDX54_MOUSE ATP-dependent RNA helicase DDX54 OS=Mus musculus GN=Ddx54 PE=1 SV=1 29 404 1.0E-49
sp|Q4WXW1|DBP8_ASPFU ATP-dependent RNA helicase dbp8 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=dbp8 PE=3 SV=1 50 400 1.0E-49
sp|A7TNT1|DBP7_VANPO ATP-dependent RNA helicase DBP7 OS=Vanderwaltozyma polyspora (strain ATCC 22028 / DSM 70294) GN=DBP7 PE=3 SV=1 42 502 1.0E-49
sp|P09052|VASA1_DROME ATP-dependent RNA helicase vasa, isoform A OS=Drosophila melanogaster GN=vas PE=1 SV=3 48 405 1.0E-49
sp|A3LWX3|DHH1_PICST ATP-dependent RNA helicase DHH1 OS=Scheffersomyces stipitis (strain ATCC 58785 / CBS 6054 / NBRC 10063 / NRRL Y-11545) GN=DHH1 PE=3 SV=1 51 410 1.0E-49
sp|A5DZT7|DBP10_LODEL ATP-dependent RNA helicase DBP10 OS=Lodderomyces elongisporus (strain ATCC 11503 / CBS 2605 / JCM 1781 / NBRC 1676 / NRRL YB-4239) GN=DBP10 PE=3 SV=1 30 404 2.0E-49
sp|Q7XMK8|RH6_ORYSJ DEAD-box ATP-dependent RNA helicase 6 OS=Oryza sativa subsp. japonica GN=Os04g0533000 PE=2 SV=1 52 397 2.0E-49
sp|Q7S9J4|DBP10_NEUCR ATP-dependent RNA helicase dbp-10 OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=dbp-10 PE=3 SV=1 52 396 2.0E-49
sp|Q62780|DDX46_RAT Probable ATP-dependent RNA helicase DDX46 OS=Rattus norvegicus GN=Ddx46 PE=1 SV=1 48 400 2.0E-49
sp|A4R8G3|DBP8_MAGO7 ATP-dependent RNA helicase DBP8 OS=Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958) GN=DBP8 PE=3 SV=3 50 400 2.0E-49
sp|Q7L014|DDX46_HUMAN Probable ATP-dependent RNA helicase DDX46 OS=Homo sapiens GN=DDX46 PE=1 SV=2 48 400 2.0E-49
sp|Q0CMM8|DBP10_ASPTN ATP-dependent RNA helicase dbp10 OS=Aspergillus terreus (strain NIH 2624 / FGSC A1156) GN=dbp10 PE=3 SV=1 52 394 3.0E-49
sp|Q1E0Z3|DBP8_COCIM ATP-dependent RNA helicase DBP8 OS=Coccidioides immitis (strain RS) GN=DBP8 PE=3 SV=1 50 400 3.0E-49
sp|C8V8H4|DED1_EMENI ATP-dependent RNA helicase ded1 OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=ded1 PE=3 SV=1 48 401 3.0E-49
sp|Q7RYZ7|DBP8_NEUCR ATP-dependent RNA helicase dbp-8 OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=dbp-8 PE=3 SV=1 21 400 3.0E-49
sp|A4RHF1|DED1_MAGO7 ATP-dependent RNA helicase DED1 OS=Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958) GN=DED1 PE=3 SV=2 48 412 3.0E-49
sp|Q4HZ42|DBP10_GIBZE ATP-dependent RNA helicase DBP10 OS=Gibberella zeae (strain PH-1 / ATCC MYA-4620 / FGSC 9075 / NRRL 31084) GN=DBP10 PE=3 SV=1 51 394 3.0E-49
sp|Q569Z5|DDX46_MOUSE Probable ATP-dependent RNA helicase DDX46 OS=Mus musculus GN=Ddx46 PE=1 SV=2 48 400 3.0E-49
sp|Q4X195|DBP2_ASPFU ATP-dependent RNA helicase dbp2 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=dbp2 PE=3 SV=2 24 400 3.0E-49
sp|Q12S35|RHLB_SHEDO ATP-dependent RNA helicase RhlB OS=Shewanella denitrificans (strain OS217 / ATCC BAA-1090 / DSM 15013) GN=rhlB PE=3 SV=1 52 399 3.0E-49
sp|Q2UE66|DBP7_ASPOR ATP-dependent RNA helicase dbp7 OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) GN=dbp7 PE=3 SV=1 44 490 4.0E-49
sp|Q6BGU8|DBP8_DEBHA ATP-dependent RNA helicase DBP8 OS=Debaryomyces hansenii (strain ATCC 36239 / CBS 767 / JCM 1990 / NBRC 0083 / IGC 2968) GN=DBP8 PE=3 SV=2 51 409 4.0E-49
sp|Q6CT49|PRP28_KLULA Pre-mRNA-splicing ATP-dependent RNA helicase PRP28 OS=Kluyveromyces lactis (strain ATCC 8585 / CBS 2359 / DSM 70799 / NBRC 1267 / NRRL Y-1140 / WM37) GN=PRP28 PE=3 SV=1 48 412 4.0E-49
sp|P0CR08|SPB4_CRYNJ ATP-dependent rRNA helicase SPB4 OS=Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565) GN=SPB4 PE=3 SV=1 51 518 4.0E-49
sp|P0CR09|SPB4_CRYNB ATP-dependent rRNA helicase SPB4 OS=Cryptococcus neoformans var. neoformans serotype D (strain B-3501A) GN=SPB4 PE=3 SV=1 51 518 4.0E-49
sp|Q54IV3|DDX42_DICDI Probable ATP-dependent RNA helicase ddx42 OS=Dictyostelium discoideum GN=ddx42 PE=3 SV=1 47 402 4.0E-49
sp|Q4WRP2|MS116_ASPFU ATP-dependent RNA helicase mss116, mitochondrial OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=mss116 PE=3 SV=1 69 413 4.0E-49
sp|A1CKJ0|DBP8_ASPCL ATP-dependent RNA helicase dbp8 OS=Aspergillus clavatus (strain ATCC 1007 / CBS 513.65 / DSM 816 / NCTC 3887 / NRRL 1) GN=dbp8 PE=3 SV=1 50 400 5.0E-49
sp|A6QUM7|DBP10_AJECN ATP-dependent RNA helicase DBP10 OS=Ajellomyces capsulatus (strain NAm1 / WU24) GN=DBP10 PE=3 SV=1 52 394 5.0E-49
sp|Q6BP45|ROK1_DEBHA ATP-dependent RNA helicase ROK1 OS=Debaryomyces hansenii (strain ATCC 36239 / CBS 767 / JCM 1990 / NBRC 0083 / IGC 2968) GN=ROK1 PE=3 SV=2 48 410 5.0E-49
sp|P0CQ76|DBP2_CRYNJ ATP-dependent RNA helicase DBP2-A OS=Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565) GN=DBP2 PE=3 SV=1 48 404 5.0E-49
sp|P0CQ77|DBP2_CRYNB ATP-dependent RNA helicase DBP2-A OS=Cryptococcus neoformans var. neoformans serotype D (strain B-3501A) GN=DBP2 PE=3 SV=1 48 404 5.0E-49
sp|A5DIX5|ROK1_PICGU ATP-dependent RNA helicase ROK1 OS=Meyerozyma guilliermondii (strain ATCC 6260 / CBS 566 / DSM 6381 / JCM 1539 / NBRC 10279 / NRRL Y-324) GN=ROK1 PE=3 SV=2 48 400 5.0E-49
sp|Q5B0J9|DBP2_EMENI ATP-dependent RNA helicase dbp2 OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=dbp2 PE=3 SV=1 24 400 5.0E-49
sp|Q4IF76|DBP2_GIBZE ATP-dependent RNA helicase DBP2 OS=Gibberella zeae (strain PH-1 / ATCC MYA-4620 / FGSC 9075 / NRRL 31084) GN=DBP2 PE=3 SV=1 48 397 6.0E-49
sp|Q6C7X8|DBP10_YARLI ATP-dependent RNA helicase DBP10 OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=DBP10 PE=3 SV=1 34 396 6.0E-49
sp|Q3BNH8|RHLB_XANC5 ATP-dependent RNA helicase RhlB OS=Xanthomonas campestris pv. vesicatoria (strain 85-10) GN=rhlB PE=3 SV=1 50 423 6.0E-49
sp|A1CTZ6|DBP10_ASPCL ATP-dependent RNA helicase dbp10 OS=Aspergillus clavatus (strain ATCC 1007 / CBS 513.65 / DSM 816 / NCTC 3887 / NRRL 1) GN=dbp10 PE=3 SV=1 52 394 6.0E-49
sp|O00571|DDX3X_HUMAN ATP-dependent RNA helicase DDX3X OS=Homo sapiens GN=DDX3X PE=1 SV=3 49 401 6.0E-49
sp|Q1DJF0|DED1_COCIM ATP-dependent RNA helicase DED1 OS=Coccidioides immitis (strain RS) GN=DED1 PE=3 SV=2 48 401 6.0E-49
sp|Q6BU54|DED1_DEBHA ATP-dependent RNA helicase DED1 OS=Debaryomyces hansenii (strain ATCC 36239 / CBS 767 / JCM 1990 / NBRC 0083 / IGC 2968) GN=DED1 PE=3 SV=1 48 401 6.0E-49
sp|A1DGZ7|DBP2_NEOFI ATP-dependent RNA helicase dbp2 OS=Neosartorya fischeri (strain ATCC 1020 / DSM 3700 / FGSC A1164 / NRRL 181) GN=dbp2 PE=3 SV=1 24 400 6.0E-49
sp|Q6H7S2|RH8_ORYSJ DEAD-box ATP-dependent RNA helicase 8 OS=Oryza sativa subsp. japonica GN=Os02g0641800 PE=2 SV=2 52 415 6.0E-49
sp|A1D6X9|DBP8_NEOFI ATP-dependent RNA helicase dbp8 OS=Neosartorya fischeri (strain ATCC 1020 / DSM 3700 / FGSC A1164 / NRRL 181) GN=dbp8 PE=3 SV=1 50 400 6.0E-49
sp|Q26696|DDX17_TRYBB Putative DEAD-box RNA helicase HEL64 OS=Trypanosoma brucei brucei GN=HEL64 PE=3 SV=1 3 404 7.0E-49
sp|Q8PFZ3|RHLB_XANAC ATP-dependent RNA helicase RhlB OS=Xanthomonas axonopodis pv. citri (strain 306) GN=rhlB PE=3 SV=1 50 423 7.0E-49
sp|Q5R6D8|DDX46_PONAB Probable ATP-dependent RNA helicase DDX46 OS=Pongo abelii GN=DDX46 PE=2 SV=1 48 400 8.0E-49
sp|Q61496|DDX4_MOUSE Probable ATP-dependent RNA helicase DDX4 OS=Mus musculus GN=Ddx4 PE=1 SV=2 49 412 9.0E-49
sp|Q109G2|RH12_ORYSJ DEAD-box ATP-dependent RNA helicase 12 OS=Oryza sativa subsp. japonica GN=Os10g0503700 PE=2 SV=2 52 420 9.0E-49
sp|P24782|DBP2_SCHPO ATP-dependent RNA helicase dbp2 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=dbp2 PE=2 SV=2 48 400 1.0E-48
sp|B8CHZ1|RHLB_SHEPW ATP-dependent RNA helicase RhlB OS=Shewanella piezotolerans (strain WP3 / JCM 13877) GN=rhlB PE=3 SV=1 52 399 1.0E-48
sp|Q62167|DDX3X_MOUSE ATP-dependent RNA helicase DDX3X OS=Mus musculus GN=Ddx3x PE=1 SV=3 49 401 1.0E-48
sp|A7EJY3|DED1_SCLS1 ATP-dependent RNA helicase ded1 OS=Sclerotinia sclerotiorum (strain ATCC 18683 / 1980 / Ss-1) GN=ded1 PE=3 SV=1 48 401 1.0E-48
sp|Q2U070|DBP2_ASPOR ATP-dependent RNA helicase dbp2 OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) GN=dbp2 PE=3 SV=1 48 400 1.0E-48
sp|Q12389|DBP10_YEAST ATP-dependent RNA helicase DBP10 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=DBP10 PE=1 SV=2 51 448 2.0E-48
sp|A4QSS5|DBP2_MAGO7 ATP-dependent RNA helicase DBP2 OS=Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958) GN=DBP2 PE=3 SV=1 48 400 2.0E-48
sp|P0A9P8|DEAD_SHIFL ATP-dependent RNA helicase DeaD OS=Shigella flexneri GN=deaD PE=3 SV=2 50 484 2.0E-48
sp|P0A9P6|DEAD_ECOLI ATP-dependent RNA helicase DeaD OS=Escherichia coli (strain K12) GN=deaD PE=1 SV=2 50 484 2.0E-48
sp|P0A9P7|DEAD_ECOL6 ATP-dependent RNA helicase DeaD OS=Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC) GN=deaD PE=3 SV=2 50 484 2.0E-48
sp|O01836|GLH3_CAEEL ATP-dependent RNA helicase glh-3 OS=Caenorhabditis elegans GN=glh-3 PE=1 SV=1 48 412 2.0E-48
sp|Q1DHB2|PRP5_COCIM Pre-mRNA-processing ATP-dependent RNA helicase PRP5 OS=Coccidioides immitis (strain RS) GN=PRP5 PE=3 SV=1 48 405 2.0E-48
sp|Q9P6U9|DED1_NEUCR ATP-dependent RNA helicase ded1 OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=drh-9 PE=3 SV=1 40 401 2.0E-48
sp|Q5GUR8|RHLB_XANOR ATP-dependent RNA helicase RhlB OS=Xanthomonas oryzae pv. oryzae (strain KACC10331 / KXO85) GN=rhlB PE=3 SV=2 50 423 2.0E-48
sp|A5DLR3|DBP10_PICGU ATP-dependent RNA helicase DBP10 OS=Meyerozyma guilliermondii (strain ATCC 6260 / CBS 566 / DSM 6381 / JCM 1539 / NBRC 10279 / NRRL Y-324) GN=DBP10 PE=3 SV=2 51 404 2.0E-48
sp|Q8XA87|DEAD_ECO57 ATP-dependent RNA helicase DeaD OS=Escherichia coli O157:H7 GN=deaD PE=3 SV=3 50 484 2.0E-48
sp|A1CHL3|PRP28_ASPCL Pre-mRNA-splicing ATP-dependent RNA helicase prp28 OS=Aspergillus clavatus (strain ATCC 1007 / CBS 513.65 / DSM 816 / NCTC 3887 / NRRL 1) GN=prp28 PE=3 SV=1 47 422 2.0E-48
sp|P57453|DEAD_BUCAI ATP-dependent RNA helicase DeaD OS=Buchnera aphidicola subsp. Acyrthosiphon pisum (strain APS) GN=deaD PE=3 SV=1 50 484 2.0E-48
sp|Q2R1M8|RH52C_ORYSJ DEAD-box ATP-dependent RNA helicase 52C OS=Oryza sativa subsp. japonica GN=Os11g0599500 PE=3 SV=1 48 401 2.0E-48
sp|Q0UY62|DBP3_PHANO ATP-dependent RNA helicase DBP3 OS=Phaeosphaeria nodorum (strain SN15 / ATCC MYA-4574 / FGSC 10173) GN=DBP3 PE=3 SV=1 45 436 2.0E-48
sp|B1KQF6|RHLB_SHEWM ATP-dependent RNA helicase RhlB OS=Shewanella woodyi (strain ATCC 51908 / MS32) GN=rhlB PE=3 SV=1 52 399 3.0E-48
sp|Q9BUQ8|DDX23_HUMAN Probable ATP-dependent RNA helicase DDX23 OS=Homo sapiens GN=DDX23 PE=1 SV=3 47 400 3.0E-48
sp|A1C6C4|DBP2_ASPCL ATP-dependent RNA helicase dbp2 OS=Aspergillus clavatus (strain ATCC 1007 / CBS 513.65 / DSM 816 / NCTC 3887 / NRRL 1) GN=dbp2 PE=3 SV=1 48 400 3.0E-48
sp|Q2HBE7|DED1_CHAGB ATP-dependent RNA helicase DED1 OS=Chaetomium globosum (strain ATCC 6205 / CBS 148.51 / DSM 1962 / NBRC 6347 / NRRL 1970) GN=DED1 PE=3 SV=1 48 401 3.0E-48
sp|Q2UHC1|DBP10_ASPOR ATP-dependent RNA helicase dbp10 OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) GN=dbp10 PE=3 SV=1 52 394 3.0E-48
sp|Q8SR63|RRP3_ENCCU ATP-dependent rRNA helicase RRP3 OS=Encephalitozoon cuniculi (strain GB-M1) GN=RRP3 PE=3 SV=1 52 397 3.0E-48
sp|Q754J2|DBP7_ASHGO ATP-dependent RNA helicase DBP7 OS=Ashbya gossypii (strain ATCC 10895 / CBS 109.51 / FGSC 9923 / NRRL Y-1056) GN=DBP7 PE=3 SV=1 70 491 3.0E-48
sp|Q8P4D4|RHLB_XANCP ATP-dependent RNA helicase RhlB OS=Xanthomonas campestris pv. campestris (strain ATCC 33913 / DSM 3586 / NCPPB 528 / LMG 568 / P 25) GN=rhlB PE=3 SV=1 51 425 3.0E-48
sp|B0RWT6|RHLB_XANCB ATP-dependent RNA helicase RhlB OS=Xanthomonas campestris pv. campestris (strain B100) GN=rhlB PE=3 SV=1 51 425 3.0E-48
sp|Q4UPY5|RHLB_XANC8 ATP-dependent RNA helicase RhlB OS=Xanthomonas campestris pv. campestris (strain 8004) GN=rhlB PE=3 SV=1 51 425 3.0E-48
sp|A6SEH9|DED1_BOTFB ATP-dependent RNA helicase ded1 OS=Botryotinia fuckeliana (strain B05.10) GN=ded1 PE=3 SV=1 48 401 3.0E-48
sp|A2QC74|DBP2_ASPNC ATP-dependent RNA helicase dbp2 OS=Aspergillus niger (strain CBS 513.88 / FGSC A1513) GN=dbp2 PE=3 SV=1 48 400 4.0E-48
sp|Q1DP69|DBP2_COCIM ATP-dependent RNA helicase DBP2 OS=Coccidioides immitis (strain RS) GN=DBP2 PE=3 SV=2 26 400 4.0E-48
sp|P34689|GLH1_CAEEL ATP-dependent RNA helicase glh-1 OS=Caenorhabditis elegans GN=glh-1 PE=1 SV=3 48 412 4.0E-48
sp|A5DIP0|DHH1_PICGU ATP-dependent RNA helicase DHH1 OS=Meyerozyma guilliermondii (strain ATCC 6260 / CBS 566 / DSM 6381 / JCM 1539 / NBRC 10279 / NRRL Y-324) GN=DHH1 PE=3 SV=1 44 400 4.0E-48
sp|A1SZG4|RHLB_PSYIN ATP-dependent RNA helicase RhlB OS=Psychromonas ingrahamii (strain 37) GN=rhlB PE=3 SV=1 50 399 4.0E-48
sp|A6ZXU0|DBP10_YEAS7 ATP-dependent RNA helicase DBP10 OS=Saccharomyces cerevisiae (strain YJM789) GN=DBP10 PE=3 SV=1 51 448 4.0E-48
sp|Q54CE0|DDX17_DICDI Probable ATP-dependent RNA helicase ddx17 OS=Dictyostelium discoideum GN=ddx17 PE=3 SV=1 48 424 4.0E-48
sp|Q8TFK8|DED1_CANGA ATP-dependent RNA helicase DED1 OS=Candida glabrata (strain ATCC 2001 / CBS 138 / JCM 3761 / NBRC 0622 / NRRL Y-65) GN=DED1 PE=3 SV=1 49 418 4.0E-48
sp|Q5AAW3|DHH1_CANAL ATP-dependent RNA helicase DHH1 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=DHH1 PE=3 SV=1 51 410 5.0E-48
sp|A4R5B8|DBP10_MAGO7 ATP-dependent RNA helicase DBP10 OS=Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958) GN=DBP10 PE=3 SV=1 52 394 5.0E-48
sp|Q07886|DDX49_DROME Probable ATP-dependent RNA helicase Dbp45A OS=Drosophila melanogaster GN=Dbp45A PE=2 SV=2 57 397 5.0E-48
sp|Q5W5U4|DDX4_BOVIN Probable ATP-dependent RNA helicase DDX4 OS=Bos taurus GN=DDX4 PE=2 SV=1 39 401 5.0E-48
sp|P33906|DEAD_KLEPN ATP-dependent RNA helicase DeaD OS=Klebsiella pneumoniae GN=deaD PE=3 SV=3 50 484 6.0E-48
sp|A6RY31|DHH1_BOTFB ATP-dependent RNA helicase dhh1 OS=Botryotinia fuckeliana (strain B05.10) GN=dhh1 PE=3 SV=1 52 397 6.0E-48
sp|Q4HW67|DHH1_GIBZE ATP-dependent RNA helicase DHH1 OS=Gibberella zeae (strain PH-1 / ATCC MYA-4620 / FGSC 9075 / NRRL 31084) GN=DHH1 PE=3 SV=1 52 401 6.0E-48
sp|P54824|DDX6_XENLA ATP-dependent RNA helicase ddx6 OS=Xenopus laevis GN=ddx6 PE=1 SV=2 45 397 6.0E-48
sp|A3LQ01|DED1_PICST ATP-dependent RNA helicase DED1 OS=Scheffersomyces stipitis (strain ATCC 58785 / CBS 6054 / NBRC 10063 / NRRL Y-11545) GN=DED1 PE=3 SV=3 40 401 6.0E-48
sp|Q1K8F7|CYT19_NEUCR ATP-dependent RNA helicase cyt-19, mitochondrial OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=cyt-19 PE=1 SV=1 2 421 6.0E-48
sp|Q7SBC6|DBP2_NEUCR ATP-dependent RNA helicase dbp2 OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=drh-1 PE=3 SV=2 48 400 8.0E-48
sp|A3GHW9|ROK1_PICST ATP-dependent RNA helicase ROK1 OS=Scheffersomyces stipitis (strain ATCC 58785 / CBS 6054 / NBRC 10063 / NRRL Y-11545) GN=ROK1 PE=3 SV=1 48 400 8.0E-48
sp|A6R3L3|DED1_AJECN ATP-dependent RNA helicase DED1 OS=Ajellomyces capsulatus (strain NAm1 / WU24) GN=DED1 PE=3 SV=1 49 405 8.0E-48
sp|Q54E49|DDX6_DICDI Probable ATP-dependent RNA helicase ddx6 OS=Dictyostelium discoideum GN=ddx6 PE=3 SV=1 16 397 8.0E-48
sp|Q9NQI0|DDX4_HUMAN Probable ATP-dependent RNA helicase DDX4 OS=Homo sapiens GN=DDX4 PE=1 SV=2 49 401 9.0E-48
sp|Q5RC67|DDX23_PONAB Probable ATP-dependent RNA helicase DDX23 OS=Pongo abelii GN=DDX23 PE=2 SV=1 47 400 1.0E-47
sp|Q75B50|DED1_ASHGO ATP-dependent RNA helicase DED1 OS=Ashbya gossypii (strain ATCC 10895 / CBS 109.51 / FGSC 9923 / NRRL Y-1056) GN=DED1 PE=3 SV=2 48 401 1.0E-47
sp|A2QRY2|DBP10_ASPNC ATP-dependent RNA helicase dbp10 OS=Aspergillus niger (strain CBS 513.88 / FGSC A1513) GN=dbp10 PE=3 SV=1 52 394 1.0E-47
sp|Q6CX73|FAL1_KLULA ATP-dependent RNA helicase FAL1 OS=Kluyveromyces lactis (strain ATCC 8585 / CBS 2359 / DSM 70799 / NBRC 1267 / NRRL Y-1140 / WM37) GN=FAL1 PE=3 SV=1 51 420 1.0E-47
sp|Q8K9H6|DEAD_BUCAP ATP-dependent RNA helicase DeaD OS=Buchnera aphidicola subsp. Schizaphis graminum (strain Sg) GN=deaD PE=3 SV=1 50 438 1.0E-47
sp|Q2UKX3|DBP8_ASPOR ATP-dependent RNA helicase dbp8 OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) GN=dbp8 PE=3 SV=1 41 400 1.0E-47
sp|Q0CL13|DBP3_ASPTN ATP-dependent RNA helicase dbp3 OS=Aspergillus terreus (strain NIH 2624 / FGSC A1156) GN=dbp3 PE=3 SV=1 48 436 1.0E-47
sp|A6RGE3|DBP2_AJECN ATP-dependent RNA helicase DBP2 OS=Ajellomyces capsulatus (strain NAm1 / WU24) GN=DBP2 PE=3 SV=1 48 400 1.0E-47
sp|Q088J2|RHLB_SHEFN ATP-dependent RNA helicase RhlB OS=Shewanella frigidimarina (strain NCIMB 400) GN=rhlB PE=3 SV=1 52 399 1.0E-47
sp|A1DG51|DBP3_NEOFI ATP-dependent RNA helicase dbp3 OS=Neosartorya fischeri (strain ATCC 1020 / DSM 3700 / FGSC A1164 / NRRL 181) GN=dbp3 PE=3 SV=1 44 401 1.0E-47
sp|Q5N7W4|RH30_ORYSJ DEAD-box ATP-dependent RNA helicase 30 OS=Oryza sativa subsp. japonica GN=Os01g0911100 PE=2 SV=2 16 400 2.0E-47
sp|A6VKC3|RHLB_ACTSZ ATP-dependent RNA helicase RhlB OS=Actinobacillus succinogenes (strain ATCC 55618 / 130Z) GN=rhlB PE=3 SV=1 52 399 2.0E-47
sp|A7TEF4|FAL1_VANPO ATP-dependent RNA helicase FAL1 OS=Vanderwaltozyma polyspora (strain ATCC 22028 / DSM 70294) GN=FAL1 PE=3 SV=1 51 422 2.0E-47
sp|Q5BDW4|PRP5_EMENI Pre-mRNA-processing ATP-dependent RNA helicase prp5 OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=prp5 PE=3 SV=1 48 405 2.0E-47
sp|Q6GWX0|DDX4_PIG Probable ATP-dependent RNA helicase DDX4 OS=Sus scrofa GN=DDX4 PE=2 SV=1 49 401 2.0E-47
sp|Q9SZB4|RH43_ARATH Putative DEAD-box ATP-dependent RNA helicase 43 OS=Arabidopsis thaliana GN=RH43 PE=3 SV=1 48 414 2.0E-47
sp|Q0CNX1|DBP8_ASPTN ATP-dependent RNA helicase dbp8 OS=Aspergillus terreus (strain NIH 2624 / FGSC A1156) GN=dbp8 PE=3 SV=1 50 400 2.0E-47
sp|Q6Z4K6|RH52B_ORYSJ DEAD-box ATP-dependent RNA helicase 52B OS=Oryza sativa subsp. japonica GN=PL10B PE=2 SV=1 48 404 2.0E-47
sp|Q4R5S7|DDX4_MACFA Probable ATP-dependent RNA helicase DDX4 OS=Macaca fascicularis GN=DDX4 PE=2 SV=1 49 401 2.0E-47
sp|Q64060|DDX4_RAT Probable ATP-dependent RNA helicase DDX4 OS=Rattus norvegicus GN=Ddx4 PE=1 SV=1 49 409 2.0E-47
sp|Q0UG00|MS116_PHANO ATP-dependent RNA helicase MSS116, mitochondrial OS=Phaeosphaeria nodorum (strain SN15 / ATCC MYA-4574 / FGSC 10173) GN=MSS116 PE=3 SV=1 12 465 2.0E-47
sp|Q4I7K4|DED1_GIBZE ATP-dependent RNA helicase DED1 OS=Gibberella zeae (strain PH-1 / ATCC MYA-4620 / FGSC 9075 / NRRL 31084) GN=DED1 PE=3 SV=1 48 401 2.0E-47
sp|Q6GVM6|DDX3Y_PANTR ATP-dependent RNA helicase DDX3Y OS=Pan troglodytes GN=DDX3Y PE=2 SV=1 49 401 2.0E-47
sp|P44701|SRMB_HAEIN ATP-dependent RNA helicase SrmB OS=Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd) GN=srmB PE=3 SV=1 49 401 2.0E-47
sp|Q5RF43|DDX3Y_PONAB ATP-dependent RNA helicase DDX3Y OS=Pongo abelii GN=DDX3Y PE=2 SV=1 49 401 2.0E-47
sp|A7ENE0|PRP5_SCLS1 Pre-mRNA-processing ATP-dependent RNA helicase prp5 OS=Sclerotinia sclerotiorum (strain ATCC 18683 / 1980 / Ss-1) GN=prp5 PE=3 SV=1 48 438 2.0E-47
sp|Q09181|DHH1_SCHPO Putative ATP-dependent RNA helicase ste13 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=ste13 PE=3 SV=1 20 400 3.0E-47
sp|Q2H720|DBP2_CHAGB ATP-dependent RNA helicase DBP2 OS=Chaetomium globosum (strain ATCC 6205 / CBS 148.51 / DSM 1962 / NBRC 6347 / NRRL 1970) GN=DBP2 PE=3 SV=1 47 400 3.0E-47
sp|Q12099|FAL1_YEAST ATP-dependent RNA helicase FAL1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=FAL1 PE=1 SV=1 50 404 3.0E-47
sp|A6ZXY5|FAL1_YEAS7 ATP-dependent RNA helicase FAL1 OS=Saccharomyces cerevisiae (strain YJM789) GN=FAL1 PE=3 SV=1 50 404 3.0E-47
sp|B0TJ29|RHLB_SHEHH ATP-dependent RNA helicase RhlB OS=Shewanella halifaxensis (strain HAW-EB4) GN=rhlB PE=3 SV=1 52 399 3.0E-47
sp|Q6CQA1|MS116_KLULA ATP-dependent RNA helicase MSS116, mitochondrial OS=Kluyveromyces lactis (strain ATCC 8585 / CBS 2359 / DSM 70799 / NBRC 1267 / NRRL Y-1140 / WM37) GN=MSS116 PE=3 SV=1 23 400 3.0E-47
sp|P0CQ82|DBP4_CRYNJ ATP-dependent RNA helicase DBP4 OS=Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565) GN=DBP4 PE=3 SV=1 531 647 5.0E-07
sp|P0CQ83|DBP4_CRYNB ATP-dependent RNA helicase DBP4 OS=Cryptococcus neoformans var. neoformans serotype D (strain B-3501A) GN=DBP4 PE=3 SV=1 531 647 5.0E-07
sp|Q4P5U4|DBP4_USTMA ATP-dependent RNA helicase DBP4 OS=Ustilago maydis (strain 521 / FGSC 9021) GN=DBP4 PE=3 SV=2 577 690 4.0E-06
[Show less]

GO

GO Term Description Terminal node
GO:0003676 nucleic acid binding Yes
GO:0005524 ATP binding Yes
GO:0016787 hydrolase activity Yes
GO:0003677 DNA binding Yes
GO:0017076 purine nucleotide binding No
GO:0005488 binding No
GO:0003674 molecular_function No
GO:0035639 purine ribonucleoside triphosphate binding No
GO:0000166 nucleotide binding No
GO:0043167 ion binding No
GO:0032553 ribonucleotide binding No
GO:0097367 carbohydrate derivative binding No
GO:0003824 catalytic activity No
GO:0043168 anion binding No
GO:0097159 organic cyclic compound binding No
GO:1901265 nucleoside phosphate binding No
GO:0032555 purine ribonucleotide binding No
GO:1901363 heterocyclic compound binding No
GO:0032559 adenyl ribonucleotide binding No
GO:0036094 small molecule binding No
GO:0030554 adenyl nucleotide binding No

Deeploc

Deeploc data not available for this genome

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

No expression data available for this genome

Orthologs

Orthofinder run ID4
Orthogroup3282
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|6684
Ophiocordyceps australis map64 (Brazil) OphauB2|7194 (this protein)
Ophiocordyceps camponoti-floridani Ophcf2|06324
Ophiocordyceps camponoti-rufipedis Ophun1|3008
Ophiocordyceps kimflemingae Ophio5|6794
Ophiocordyceps subramaniannii Hirsu2|6011

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >OphauB2|7194
MASLPKKREKKTPKPSRTELRQQKRKREVEDVESLETAIAALDPKTSPVTSFADLPLSQQTLAGLRASHFQTLTD
VQQHAIPLALKSRDVLAAAKTGSGKTLAFLVPVLERLYRARWTEYDGLGALIISPTRELAVQTFEVLRKIGRSHV
FSAGLVIGGKSLSEEAERIARMNILVCTPGRMLQHLDQTAGLDIDNLQMLVMDEADRIMDLGFQADVDALVNHLP
AHRQTLLFSATQSKKVSDLARLSLKDPEYVSVHEAASSATPTSLQQHYIITPLPEKLDTLYGFLKSNLKSKILVF
LSSGKQVRFVYESFRHMQPGIPLLHLHGRQKQGARLEITSRFTSAKHSCLIATDVVARGIDFPAVDWVIQVDCPE
DVDTYIHRVGRTARYQSKGRAVLFMDPSEEDGMLKRLEHKKIPIQRVNVKQAKKRSIKEQLQSLCFKFPDLKYLG
QKAFISYSRAIYLQKDKQVFRFDELDLDAFAASMGLAGTPQIRFQKGEDAKKLKNAPRRAMSSGSESEMDLDGPY
DSQPKKEKKKEVRTKYDKMFERQNQDVLSSHYTKLIQGGTGDFQDAAAETLNDGDDFLAVKRHIAPDDAAIETLP
NGVKVLHGLGGKDAYVIDSKRREKALKSKKKMLKFKGGASKLVFDDEGVPHPAYELQHKADFDKLGDAHELHQKF
IADESRRVREADRDDAQRIRDRKREKREKQRAAERGLGGDDFASAPRLVAAGGEDEDALALMRELPVAGAAADDD
DDKERPRKRTKKWFQDGTDAMIAAKSRPANKVLRVTEQPETLQDFETLAMGLLDN*
Coding >OphauB2|7194
ATGGCGTCTTTACCCAAGAAGCGAGAAAAAAAGACACCCAAGCCCAGCAGGACTGAGCTGCGACAGCAAAAACGC
AAGCGAGAAGTCGAAGACGTCGAATCTCTCGAGACGGCCATTGCCGCTCTAGACCCCAAAACATCCCCCGTTACC
AGCTTTGCCGACCTGCCTCTATCGCAACAGACACTGGCCGGCCTCCGCGCCTCGCACTTTCAAACCCTGACAGAC
GTGCAGCAGCACGCAATTCCCCTGGCGCTCAAGAGCCGCGATGTGCTGGCAGCCGCCAAGACTGGAAGCGGCAAG
ACGCTTGCCTTTCTCGTACCCGTCCTCGAACGGCTGTACCGCGCTCGCTGGACAGAGTACGATGGCCTGGGCGCC
CTGATTATTTCGCCGACGCGTGAGCTAGCTGTACAGACATTCGAGGTGCTGAGAAAAATCGGGCGCAGCCATGTC
TTTTCGGCGGGGCTCGTCATTGGCGGCAAGAGCTTGAGCGAGGAGGCTGAGCGGATAGCGCGCATGAATATTCTG
GTCTGTACGCCAGGCCGGATGCTGCAGCACTTGGACCAGACGGCGGGCTTGGATATCGATAATTTGCAGATGCTG
GTGATGGATGAGGCTGACCGCATCATGGATCTCGGCTTCCAGGCTGACGTGGATGCCTTGGTTAATCATCTTCCA
GCCCACCGCCAAACACTGCTCTTTAGCGCCACTCAGAGCAAAAAAGTGTCTGATTTGGCTCGCCTCAGTCTCAAA
GATCCAGAATACGTCTCTGTCCATGAGGCAGCTTCTTCCGCAACTCCAACAAGCCTTCAACAACACTACATCATT
ACTCCGCTGCCCGAAAAGCTCGATACCCTCTACGGCTTCCTCAAGTCCAACCTCAAGAGCAAAATCCTCGTCTTT
CTCAGCTCCGGGAAGCAGGTTCGCTTCGTGTACGAAAGCTTCCGACACATGCAGCCCGGCATTCCGCTTCTCCAT
CTCCACGGCCGCCAGAAACAAGGCGCGCGCCTCGAAATCACGTCTCGCTTCACCTCGGCCAAGCACTCGTGTCTC
ATTGCCACGGATGTGGTTGCCCGCGGTATCGACTTTCCTGCCGTGGATTGGGTCATTCAGGTAGACTGTCCAGAG
GATGTTGACACGTATATCCATCGTGTTGGACGGACGGCTCGCTATCAAAGTAAAGGCCGCGCCGTCTTGTTTATG
GACCCCAGTGAAGAGGATGGCATGCTCAAGCGGCTCGAGCACAAGAAGATTCCCATTCAAAGAGTAAATGTCAAG
CAAGCCAAGAAGCGCTCCATCAAGGAGCAACTGCAAAGTCTCTGCTTCAAGTTTCCCGACTTGAAATATCTAGGA
CAAAAGGCCTTTATTAGCTACTCACGAGCCATATATCTGCAAAAGGACAAGCAAGTCTTTCGCTTTGACGAATTG
GATCTTGACGCCTTTGCTGCCAGCATGGGCCTTGCCGGCACACCACAGATTCGATTCCAAAAGGGCGAGGATGCC
AAGAAGCTCAAAAATGCTCCTCGAAGAGCCATGTCGAGCGGATCAGAATCTGAAATGGATCTCGACGGCCCCTAC
GATAGCCAACCCAAAAAAGAAAAGAAGAAGGAGGTGCGCACAAAATACGACAAGATGTTTGAACGGCAAAATCAA
GACGTCTTGTCAAGCCACTACACCAAGCTCATTCAAGGCGGTACAGGCGACTTTCAGGACGCCGCTGCAGAAACG
CTTAACGACGGCGACGACTTTTTAGCCGTCAAGCGCCATATTGCTCCCGACGACGCAGCCATCGAAACCCTGCCC
AACGGCGTCAAAGTCCTTCATGGCCTCGGGGGCAAAGACGCCTACGTTATTGACTCGAAGCGCCGCGAAAAAGCG
CTCAAGTCGAAAAAGAAGATGCTCAAATTCAAGGGCGGCGCATCCAAGCTCGTATTTGACGACGAGGGCGTCCCT
CACCCTGCCTATGAGCTCCAGCACAAGGCCGACTTTGACAAGCTGGGCGACGCGCACGAGCTGCACCAGAAATTT
ATTGCCGACGAGTCGCGGCGCGTGCGCGAGGCGGATCGCGACGACGCCCAGCGCATCCGAGATCGCAAACGCGAA
AAGAGGGAGAAGCAGCGAGCGGCGGAGCGAGGGCTTGGCGGCGACGACTTTGCTTCGGCGCCGAGGTTGGTGGCG
GCGGGCGGAGAGGACGAGGATGCGCTGGCGCTCATGAGGGAGCTGCCGGTGGCGGGCGCAGCGGCTGATGATGAT
GACGACAAGGAGCGGCCGCGCAAACGCACCAAAAAGTGGTTCCAAGATGGTACAGATGCAATGATTGCCGCAAAG
AGCCGCCCCGCCAACAAGGTACTCAGGGTGACGGAACAGCCAGAGACGCTGCAAGATTTCGAGACTCTGGCCATG
GGGCTGCTGGACAATTAG
Transcript >OphauB2|7194
ATGGCGTCTTTACCCAAGAAGCGAGAAAAAAAGACACCCAAGCCCAGCAGGACTGAGCTGCGACAGCAAAAACGC
AAGCGAGAAGTCGAAGACGTCGAATCTCTCGAGACGGCCATTGCCGCTCTAGACCCCAAAACATCCCCCGTTACC
AGCTTTGCCGACCTGCCTCTATCGCAACAGACACTGGCCGGCCTCCGCGCCTCGCACTTTCAAACCCTGACAGAC
GTGCAGCAGCACGCAATTCCCCTGGCGCTCAAGAGCCGCGATGTGCTGGCAGCCGCCAAGACTGGAAGCGGCAAG
ACGCTTGCCTTTCTCGTACCCGTCCTCGAACGGCTGTACCGCGCTCGCTGGACAGAGTACGATGGCCTGGGCGCC
CTGATTATTTCGCCGACGCGTGAGCTAGCTGTACAGACATTCGAGGTGCTGAGAAAAATCGGGCGCAGCCATGTC
TTTTCGGCGGGGCTCGTCATTGGCGGCAAGAGCTTGAGCGAGGAGGCTGAGCGGATAGCGCGCATGAATATTCTG
GTCTGTACGCCAGGCCGGATGCTGCAGCACTTGGACCAGACGGCGGGCTTGGATATCGATAATTTGCAGATGCTG
GTGATGGATGAGGCTGACCGCATCATGGATCTCGGCTTCCAGGCTGACGTGGATGCCTTGGTTAATCATCTTCCA
GCCCACCGCCAAACACTGCTCTTTAGCGCCACTCAGAGCAAAAAAGTGTCTGATTTGGCTCGCCTCAGTCTCAAA
GATCCAGAATACGTCTCTGTCCATGAGGCAGCTTCTTCCGCAACTCCAACAAGCCTTCAACAACACTACATCATT
ACTCCGCTGCCCGAAAAGCTCGATACCCTCTACGGCTTCCTCAAGTCCAACCTCAAGAGCAAAATCCTCGTCTTT
CTCAGCTCCGGGAAGCAGGTTCGCTTCGTGTACGAAAGCTTCCGACACATGCAGCCCGGCATTCCGCTTCTCCAT
CTCCACGGCCGCCAGAAACAAGGCGCGCGCCTCGAAATCACGTCTCGCTTCACCTCGGCCAAGCACTCGTGTCTC
ATTGCCACGGATGTGGTTGCCCGCGGTATCGACTTTCCTGCCGTGGATTGGGTCATTCAGGTAGACTGTCCAGAG
GATGTTGACACGTATATCCATCGTGTTGGACGGACGGCTCGCTATCAAAGTAAAGGCCGCGCCGTCTTGTTTATG
GACCCCAGTGAAGAGGATGGCATGCTCAAGCGGCTCGAGCACAAGAAGATTCCCATTCAAAGAGTAAATGTCAAG
CAAGCCAAGAAGCGCTCCATCAAGGAGCAACTGCAAAGTCTCTGCTTCAAGTTTCCCGACTTGAAATATCTAGGA
CAAAAGGCCTTTATTAGCTACTCACGAGCCATATATCTGCAAAAGGACAAGCAAGTCTTTCGCTTTGACGAATTG
GATCTTGACGCCTTTGCTGCCAGCATGGGCCTTGCCGGCACACCACAGATTCGATTCCAAAAGGGCGAGGATGCC
AAGAAGCTCAAAAATGCTCCTCGAAGAGCCATGTCGAGCGGATCAGAATCTGAAATGGATCTCGACGGCCCCTAC
GATAGCCAACCCAAAAAAGAAAAGAAGAAGGAGGTGCGCACAAAATACGACAAGATGTTTGAACGGCAAAATCAA
GACGTCTTGTCAAGCCACTACACCAAGCTCATTCAAGGCGGTACAGGCGACTTTCAGGACGCCGCTGCAGAAACG
CTTAACGACGGCGACGACTTTTTAGCCGTCAAGCGCCATATTGCTCCCGACGACGCAGCCATCGAAACCCTGCCC
AACGGCGTCAAAGTCCTTCATGGCCTCGGGGGCAAAGACGCCTACGTTATTGACTCGAAGCGCCGCGAAAAAGCG
CTCAAGTCGAAAAAGAAGATGCTCAAATTCAAGGGCGGCGCATCCAAGCTCGTATTTGACGACGAGGGCGTCCCT
CACCCTGCCTATGAGCTCCAGCACAAGGCCGACTTTGACAAGCTGGGCGACGCGCACGAGCTGCACCAGAAATTT
ATTGCCGACGAGTCGCGGCGCGTGCGCGAGGCGGATCGCGACGACGCCCAGCGCATCCGAGATCGCAAACGCGAA
AAGAGGGAGAAGCAGCGAGCGGCGGAGCGAGGGCTTGGCGGCGACGACTTTGCTTCGGCGCCGAGGTTGGTGGCG
GCGGGCGGAGAGGACGAGGATGCGCTGGCGCTCATGAGGGAGCTGCCGGTGGCGGGCGCAGCGGCTGATGATGAT
GACGACAAGGAGCGGCCGCGCAAACGCACCAAAAAGTGGTTCCAAGATGGTACAGATGCAATGATTGCCGCAAAG
AGCCGCCCCGCCAACAAGGTACTCAGGGTGACGGAACAGCCAGAGACGCTGCAAGATTTCGAGACTCTGGCCATG
GGGCTGCTGGACAATTAG
Gene >OphauB2|7194
ATGGCGTCTTTACCCAAGAAGCGAGAAAAAAAGACACCCAAGCCCAGCAGGACTGAGCTGCGACAGCAAAAACGC
AAGCGAGAAGTCGAAGACGTCGAATCTCTCGAGACGGCCATTGCCGCTCTAGTAAGTCATCATGACCAACTTGAC
CAGCCATGGGCCAGGCCAAAGCAAGGCCCAATATCCTACTTGTGCACACTCTCTGACCCCAAGCCTTTCTTGTTG
TAGGACCCCAAAACATCCCCCGTTACCAGCTTTGCCGACCTGCCTCTATCGCAACAGACACTGGCCGGCCTCCGC
GCCTCGCACTTTCAAACCCTGACAGACGTGCAGCAGCACGCAATTCCCCTGGCGCTCAAGAGCCGCGATGTGCTG
GCAGCCGCCAAGACTGGAAGCGGCAAGACGCTTGCCTTTCTCGTACCCGTCCTCGAACGGCTGTACCGCGCTCGC
TGGACAGAGTACGATGGCCTGGGCGCCCTGATTATTTCGCCGACGCGTGAGCTAGCTGTACAGACATTCGAGGTG
CTGAGAAAAATCGGGCGCAGCCATGTCTTTTCGGCGGGGCTCGTCATTGGCGGCAAGAGCTTGAGCGAGGAGGCT
GAGCGGATAGCGCGCATGAATATTCTGGTCTGTACGCCAGGCCGGATGCTGCAGCACTTGGACCAGACGGCGGGC
TTGGATATCGATAATTTGCAGATGCTGGTGATGGATGAGGCTGACCGCATCATGGATCTCGGCTTCCAGGCTGAC
GTGGATGCCTTGGTTAATCATCTTCCAGCCCACCGCCAAACACTGCTCTTTAGCGCCACTCAGAGCAAAAAAGTG
TCTGATTTGGCTCGCCTCAGTCTCAAAGATCCAGAATACGTCTCTGTCCATGAGGCAGCTTCTTCCGCAACTCCA
ACAAGCCTTCAACAACACTACATCATTACTCCGCTGCCCGAAAAGCTCGATACCCTCTACGGCTTCCTCAAGTCC
AACCTCAAGAGCAAAATCCTCGTCTTTCTCAGCTCCGGGAAGCAGGTTCGCTTCGTGTACGAAAGCTTCCGACAC
ATGCAGCCCGGCATTCCGCTTCTCCATCTCCACGGCCGCCAGAAACAAGGCGCGCGCCTCGAAATCACGTCTCGC
TTCACCTCGGCCAAGCACTCGTGTCTCATTGCCACGGATGTGGTTGCCCGCGGTATCGACTTTCCTGCCGTGGAT
TGGGTCATTCAGGTAGACTGTCCAGAGGATGTTGACACGTATATCCATCGTGTTGGACGGACGGCTCGCTATCAA
AGTAAAGGCCGCGCCGTCTTGTTTATGGACCCCAGTGAAGAGGATGGCATGCTCAAGCGGCTCGAGCACAAGAAG
ATTCCCATTCAAAGAGTAAATGTCAAGCAAGCCAAGAAGCGCTCCATCAAGGAGCAACTGCAAAGTCTCTGCTTC
AAGTTTCCCGACTTGAAATATCTAGGACAAAAGGCCTTTATTAGCTACTCACGAGCCATATATCTGCAAAAGGAC
AAGCAAGTCTTTCGCTTTGACGAATTGGATCTTGACGCCTTTGCTGCCAGCATGGGCCTTGCCGGCACACCACAG
ATTCGATTCCAAAAGGGCGAGGATGCCAAGAAGCTCAAAAATGCTCCTCGAAGAGCCATGTCGAGCGGATCAGAA
TCTGAAATGGATCTCGACGGCCCCTACGATAGCCAACCCAAAAAAGAAAAGAAGAAGGAGGTGCGCACAAAATAC
GACAAGATGTTTGAACGGCAAAATCAAGACGTCTTGTCAAGCCACTACACCAAGCTCATTCAAGGCGGTACAGGC
GACTTTCAGGACGCCGCTGCAGAAACGCTTAACGACGGCGACGACTTTTTAGCCGTCAAGCGCCATATTGCTCCC
GACGACGCAGCCATCGAAACCCTGCCCAACGGCGTCAAAGTCCTTCATGGCCTCGGGGGCAAAGACGCCTACGTT
ATTGACTCGAAGCGCCGCGAAAAAGCGCTCAAGTCGAAAAAGAAGATGCTCAAATTCAAGGGCGGCGCATCCAAG
CTCGTATTTGACGACGAGGGCGTCCCTCACCCTGCCTATGAGCTCCAGCACAAGGCCGACTTTGACAAGCTGGGC
GACGCGCACGAGCTGCACCAGAAATTTATTGCCGACGAGTCGCGGCGCGTGCGCGAGGCGGATCGCGACGACGCC
CAGCGCATCCGAGATCGCAAACGCGAAAAGAGGGAGAAGCAGCGAGCGGCGGAGCGAGGGCTTGGCGGCGACGAC
TTTGCTTCGGCGCCGAGGTTGGTGGCGGCGGGCGGAGAGGACGAGGATGCGCTGGCGCTCATGAGGGAGCTGCCG
GTGGCGGGCGCAGCGGCTGATGATGATGACGACAAGGAGCGGCCGCGCAAACGCACCAAAAAGTGGTTCCAAGAT
GGTACAGATGCAATGATTGCCGCAAAGAGCCGCCCCGCCAACAAGGTACTCAGGGTGACGGAACAGCCAGAGACG
CTGCAAGATTTCGAGACTCTGGCCATGGGGCTGCTGGACAATTAG

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail