Fungal Genomics

at Utrecht University

General Properties

Protein IDOphauB2|7192
Gene name
LocationContig_73:56254..56865
Strand-
Gene length (bp)611
Transcript length (bp)444
Coding sequence length (bp)444
Protein length (aa) 148

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00581 Rhodanese Rhodanese-like domain 5.2E-14 28 129

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|P42937|YCH1_YEAST CDC25-like phosphatase YCH1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=YCH1 PE=1 SV=1 32 146 1.0E-18
sp|Q8GY31|CDC25_ARATH Dual specificity phosphatase Cdc25 OS=Arabidopsis thaliana GN=CDC25 PE=1 SV=1 30 127 4.0E-18
sp|Q336V5|ACR21_ORYSJ Arsenate reductase 2.1 OS=Oryza sativa subsp. japonica GN=ACR2.1 PE=1 SV=1 29 127 8.0E-17
sp|Q10SX6|ACR22_ORYSJ Arsenate reductase 2.2 OS=Oryza sativa subsp. japonica GN=ACR2.2 PE=1 SV=1 29 127 5.0E-16
sp|Q8WZK3|IBP1_SCHPO Dual specificity phosphatase ibp1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=ibp1 PE=1 SV=1 26 138 4.0E-14
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|P42937|YCH1_YEAST CDC25-like phosphatase YCH1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=YCH1 PE=1 SV=1 32 146 1.0E-18
sp|Q8GY31|CDC25_ARATH Dual specificity phosphatase Cdc25 OS=Arabidopsis thaliana GN=CDC25 PE=1 SV=1 30 127 4.0E-18
sp|Q336V5|ACR21_ORYSJ Arsenate reductase 2.1 OS=Oryza sativa subsp. japonica GN=ACR2.1 PE=1 SV=1 29 127 8.0E-17
sp|Q10SX6|ACR22_ORYSJ Arsenate reductase 2.2 OS=Oryza sativa subsp. japonica GN=ACR2.2 PE=1 SV=1 29 127 5.0E-16
sp|Q8WZK3|IBP1_SCHPO Dual specificity phosphatase ibp1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=ibp1 PE=1 SV=1 26 138 4.0E-14
sp|Q03019|TWINE_DROME Cdc25-like protein phosphatase twine OS=Drosophila melanogaster GN=twe PE=1 SV=2 1 131 7.0E-10
sp|P30309|MPI1B_XENLA M-phase inducer phosphatase 1-B OS=Xenopus laevis GN=cdc25-1-b PE=2 SV=1 9 132 1.0E-06
sp|Q29029|MPIP3_PIG M-phase inducer phosphatase 3 OS=Sus scrofa GN=CDC25C PE=3 SV=1 41 132 4.0E-06
[Show less]

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 19 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >OphauB2|7192
MSTASIATLQRMTAQTLSEKILSERETPNPTLAVVDVRDDDYIGGHIRGSINMPSQQLDAMMPTLIRRLKDKKTV
IFHCALSQQRGPSAALRYLRERDAALQGLGERQAAETPQSVYVLDRGFTGWQEKYGEDERLTEGYRKELWQD*
Coding >OphauB2|7192
ATGTCTACCGCGAGCATTGCGACGCTACAGCGCATGACGGCGCAAACGCTGTCGGAAAAGATTCTGTCGGAGCGC
GAGACGCCCAACCCGACACTTGCTGTTGTTGATGTGCGCGACGATGACTATATTGGCGGACATATTCGTGGTTCA
ATCAACATGCCGAGTCAACAGCTCGACGCCATGATGCCCACACTTATCCGTCGCCTCAAGGACAAAAAGACGGTT
ATTTTCCACTGTGCTCTCAGCCAGCAGCGCGGCCCCAGCGCTGCGCTGCGCTACTTACGCGAGCGAGACGCGGCG
CTTCAAGGTTTGGGCGAGCGTCAGGCTGCAGAGACGCCACAGAGTGTCTACGTACTGGACCGAGGGTTTACAGGG
TGGCAGGAAAAGTATGGCGAGGACGAGAGACTTACAGAGGGCTATCGCAAGGAGCTCTGGCAGGACTAG
Transcript >OphauB2|7192
ATGTCTACCGCGAGCATTGCGACGCTACAGCGCATGACGGCGCAAACGCTGTCGGAAAAGATTCTGTCGGAGCGC
GAGACGCCCAACCCGACACTTGCTGTTGTTGATGTGCGCGACGATGACTATATTGGCGGACATATTCGTGGTTCA
ATCAACATGCCGAGTCAACAGCTCGACGCCATGATGCCCACACTTATCCGTCGCCTCAAGGACAAAAAGACGGTT
ATTTTCCACTGTGCTCTCAGCCAGCAGCGCGGCCCCAGCGCTGCGCTGCGCTACTTACGCGAGCGAGACGCGGCG
CTTCAAGGTTTGGGCGAGCGTCAGGCTGCAGAGACGCCACAGAGTGTCTACGTACTGGACCGAGGGTTTACAGGG
TGGCAGGAAAAGTATGGCGAGGACGAGAGACTTACAGAGGGCTATCGCAAGGAGCTCTGGCAGGACTAG
Gene >OphauB2|7192
ATGTCTACCGCGAGCATTGCGACGCTACAGCGCATGACGGCGCAAACGCTGTCGGAAAAGATTCTGTCGGAGCGC
GAGACGCCCAACCCGACACTTGCTGTTGTTGATGTGCGCGACGATGGTGAGCTCTTTCCGAGTCATGCACATCTA
TTATCGAGCGTAGCAAAGACGCCAAGGGGGCAAGATGTAAATACTTACGCCACACTCGCTTTGCCCACTTTGAAA
CTCGACTTGTTGTTGTTGTTGCCACTTGGAGGGAAGCAAGCTGTAGCATGCTGACCTTGTTAGACTATATTGGCG
GACATATTCGTGGTTCAATCAACATGCCGAGTCAACAGCTCGACGCCATGATGCCCACACTTATCCGTCGCCTCA
AGGACAAAAAGACGGTTATTTTCCACTGTGCTCTCAGCCAGCAGCGCGGCCCCAGCGCTGCGCTGCGCTACTTAC
GCGAGCGAGACGCGGCGCTTCAAGGTTTGGGCGAGCGTCAGGCTGCAGAGACGCCACAGAGTGTCTACGTACTGG
ACCGAGGGTTTACAGGGTGGCAGGAAAAGTATGGCGAGGACGAGAGACTTACAGAGGGCTATCGCAAGGAGCTCT
GGCAGGACTAG

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail