Fungal Genomics

at Utrecht University

General Properties

Protein IDOphauB2|7181
Gene name
LocationContig_73:31102..31937
Strand-
Gene length (bp)835
Transcript length (bp)579
Coding sequence length (bp)579
Protein length (aa) 193

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF08292 RNA_pol_Rbc25 RNA polymerase III subunit Rpc25 2.3E-29 83 190
PF03876 SHS2_Rpb7-N SHS2 domain found in N terminus of Rpb7p/Rpc25p/MJ0397 7.6E-09 8 64

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|O94285|RPC8_SCHPO DNA-directed RNA polymerase III subunit rpc8 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=rpc25 PE=1 SV=1 1 190 7.0E-48
sp|P35718|RPC8_YEAST DNA-directed RNA polymerase III subunit RPC8 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=RPC25 PE=1 SV=1 1 191 6.0E-43
sp|Q9Y535|RPC8_HUMAN DNA-directed RNA polymerase III subunit RPC8 OS=Homo sapiens GN=POLR3H PE=1 SV=1 1 192 1.0E-42
sp|Q2T9X1|RPC8_BOVIN DNA-directed RNA polymerase III subunit RPC8 OS=Bos taurus GN=POLR3H PE=2 SV=1 1 192 2.0E-40
sp|Q9D2C6|RPC8_MOUSE DNA-directed RNA polymerase III subunit RPC8 OS=Mus musculus GN=Polr3h PE=1 SV=2 1 192 1.0E-39
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|O94285|RPC8_SCHPO DNA-directed RNA polymerase III subunit rpc8 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=rpc25 PE=1 SV=1 1 190 7.0E-48
sp|P35718|RPC8_YEAST DNA-directed RNA polymerase III subunit RPC8 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=RPC25 PE=1 SV=1 1 191 6.0E-43
sp|Q9Y535|RPC8_HUMAN DNA-directed RNA polymerase III subunit RPC8 OS=Homo sapiens GN=POLR3H PE=1 SV=1 1 192 1.0E-42
sp|Q2T9X1|RPC8_BOVIN DNA-directed RNA polymerase III subunit RPC8 OS=Bos taurus GN=POLR3H PE=2 SV=1 1 192 2.0E-40
sp|Q9D2C6|RPC8_MOUSE DNA-directed RNA polymerase III subunit RPC8 OS=Mus musculus GN=Polr3h PE=1 SV=2 1 192 1.0E-39
sp|Q557J3|RPC8_DICDI DNA-directed RNA polymerase III subunit rpc8 OS=Dictyostelium discoideum GN=polr3h-1 PE=2 SV=1 1 190 2.0E-29
sp|Q8LE42|NRPD7_ARATH DNA-directed RNA polymerase IV subunit 7 OS=Arabidopsis thaliana GN=NRPD7 PE=1 SV=1 30 186 6.0E-07
[Show less]

GO

GO Term Description Terminal node
GO:0006351 transcription, DNA-templated Yes
GO:0044249 cellular biosynthetic process No
GO:0043170 macromolecule metabolic process No
GO:0006725 cellular aromatic compound metabolic process No
GO:0034654 nucleobase-containing compound biosynthetic process No
GO:0008150 biological_process No
GO:0009059 macromolecule biosynthetic process No
GO:0034641 cellular nitrogen compound metabolic process No
GO:1901576 organic substance biosynthetic process No
GO:0018130 heterocycle biosynthetic process No
GO:0006807 nitrogen compound metabolic process No
GO:1901360 organic cyclic compound metabolic process No
GO:0019438 aromatic compound biosynthetic process No
GO:0044271 cellular nitrogen compound biosynthetic process No
GO:0090304 nucleic acid metabolic process No
GO:0006139 nucleobase-containing compound metabolic process No
GO:0071704 organic substance metabolic process No
GO:0032774 RNA biosynthetic process No
GO:0044237 cellular metabolic process No
GO:0008152 metabolic process No
GO:1901362 organic cyclic compound biosynthetic process No
GO:0009987 cellular process No
GO:0097659 nucleic acid-templated transcription No
GO:0044238 primary metabolic process No
GO:0009058 biosynthetic process No
GO:0046483 heterocycle metabolic process No
GO:0016070 RNA metabolic process No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 16 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >OphauB2|7181
MFILTKLSDLVQIQPKDFSKHSIVAIEDNINAKYANKVIQKIGLCISLYDLLWSSEGLIGHGNGLVNVNVEFRLI
VFRPFKGEVMFGRISSSTPTGINIKTDFFDDIVVPYDELPEGAEYSHNDQLWIWNMEDTRLFFDLHEIVRFQVID
EEWHDQTPTGPSQADDSPAKTPYRIKATMAGDGLGPCLWWDS*
Coding >OphauB2|7181
ATGTTCATTCTCACCAAATTGTCCGATCTAGTACAGATCCAGCCCAAAGATTTTTCCAAACATAGCATCGTTGCC
ATCGAAGACAACATTAATGCGAAGTACGCTAACAAGGTTATCCAGAAAATTGGACTATGTATATCCTTGTACGAT
TTGTTGTGGTCATCCGAGGGACTTATTGGGCATGGAAATGGCTTGGTCAACGTCAATGTCGAATTTCGCCTCATC
GTTTTTCGCCCCTTTAAAGGCGAGGTAATGTTTGGCCGAATTAGCAGCTCTACTCCCACAGGCATCAATATAAAG
ACCGACTTTTTCGATGATATCGTTGTCCCGTATGACGAGCTGCCCGAGGGGGCTGAATATAGCCATAACGACCAG
CTGTGGATATGGAATATGGAAGACACCAGACTCTTTTTTGACTTGCATGAAATTGTCCGCTTCCAAGTCATTGAC
GAAGAGTGGCATGATCAGACACCAACAGGGCCGTCACAAGCTGATGATTCTCCTGCCAAAACACCCTACCGGATC
AAAGCCACCATGGCAGGTGATGGGCTAGGGCCTTGCTTGTGGTGGGACAGCTAA
Transcript >OphauB2|7181
ATGTTCATTCTCACCAAATTGTCCGATCTAGTACAGATCCAGCCCAAAGATTTTTCCAAACATAGCATCGTTGCC
ATCGAAGACAACATTAATGCGAAGTACGCTAACAAGGTTATCCAGAAAATTGGACTATGTATATCCTTGTACGAT
TTGTTGTGGTCATCCGAGGGACTTATTGGGCATGGAAATGGCTTGGTCAACGTCAATGTCGAATTTCGCCTCATC
GTTTTTCGCCCCTTTAAAGGCGAGGTAATGTTTGGCCGAATTAGCAGCTCTACTCCCACAGGCATCAATATAAAG
ACCGACTTTTTCGATGATATCGTTGTCCCGTATGACGAGCTGCCCGAGGGGGCTGAATATAGCCATAACGACCAG
CTGTGGATATGGAATATGGAAGACACCAGACTCTTTTTTGACTTGCATGAAATTGTCCGCTTCCAAGTCATTGAC
GAAGAGTGGCATGATCAGACACCAACAGGGCCGTCACAAGCTGATGATTCTCCTGCCAAAACACCCTACCGGATC
AAAGCCACCATGGCAGGTGATGGGCTAGGGCCTTGCTTGTGGTGGGACAGCTAA
Gene >OphauB2|7181
ATGTTCATTCTCGTAAGAACACTCACAATCCAAATCTTGCGTTTTCTATACAAGCTCACAAAATATTTTTTCCTT
TTAATTAAAAAAGACCAAATTGTCCGATCTAGTACAGATCCAGCCCAAAGATTTTTCCAAACATAGCATCGTTGC
CATCGAAGACAACATTAATGCGAAGTACGCTAACAAGGTGAGCACTGCTAGCCCTCCCCTTCTTCTACCACACTT
TCACTTATTGCTTGACTGGGCAGGTTATCCAGAAAATTGGACTATGTATATCCTTGTACGATTTGTTGTGGTCAT
CCGAGGGACTTATTGGGCATGGAAATGGCTTGGTCAACGTCAATGGTACCTGTGCCATTTACTTGGGTCGTACAA
AGAGGCATCCAACTAACTGACCATAATAGTCGAATTTCGCCTCATCGTTTTTCGCCCCTTTAAAGGCGAGGTAAT
GTTTGGCCGAATTAGCAGCTCTACTCCCACAGGCATCAATATAAAGACCGACTTTTTCGATGATATCGTTGTCCC
GTATGACGAGCTGCCCGAGGGGGCTGAATAGTGAGTTTTTTTCCAGGGTTTCATCACCTGCAGTCTCAGTGGCCA
ATAATCTTGCTGCAGTAGCCATAACGACCAGCTGTGGATATGGAATATGGAAGACACCAGACTCTTTTTTGACTT
GCATGAAATTGTCCGCTTCCAAGTCATTGACGAAGAGTGGCATGATCAGACACCAACAGGGCCGTCACAAGCTGA
TGATTCTCCTGCCAAAACACCCTACCGGATCAAAGCCACCATGGCAGGTGATGGGCTAGGGCCTTGCTTGTGGTG
GGACAGCTAA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail