Fungal Genomics

at Utrecht University

General Properties

Protein IDOphauB2|7179
Gene name
LocationContig_73:29012..29799
Strand-
Gene length (bp)787
Transcript length (bp)669
Coding sequence length (bp)669
Protein length (aa) 223

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF06703 SPC25 Microsomal signal peptidase 25 kDa subunit (SPC25) 1.0E-48 14 165

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q04969|SPC2_YEAST Signal peptidase complex subunit SPC2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=SPC2 PE=1 SV=1 1 149 1.0E-14
sp|Q9UTQ9|SPC2_SCHPO Signal peptidase complex subunit spc2 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=spc2 PE=3 SV=1 10 159 6.0E-13
sp|Q9XWW1|SPCS2_CAEEL Probable signal peptidase complex subunit 2 OS=Caenorhabditis elegans GN=hpo-21 PE=1 SV=1 7 156 6.0E-08
sp|Q5RAY6|SPCS2_PONAB Signal peptidase complex subunit 2 OS=Pongo abelii GN=SPCS2 PE=2 SV=1 4 159 5.0E-06
sp|Q9CYN2|SPCS2_MOUSE Signal peptidase complex subunit 2 OS=Mus musculus GN=Spcs2 PE=1 SV=1 4 159 5.0E-06
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q04969|SPC2_YEAST Signal peptidase complex subunit SPC2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=SPC2 PE=1 SV=1 1 149 1.0E-14
sp|Q9UTQ9|SPC2_SCHPO Signal peptidase complex subunit spc2 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=spc2 PE=3 SV=1 10 159 6.0E-13
sp|Q9XWW1|SPCS2_CAEEL Probable signal peptidase complex subunit 2 OS=Caenorhabditis elegans GN=hpo-21 PE=1 SV=1 7 156 6.0E-08
sp|Q5RAY6|SPCS2_PONAB Signal peptidase complex subunit 2 OS=Pongo abelii GN=SPCS2 PE=2 SV=1 4 159 5.0E-06
sp|Q9CYN2|SPCS2_MOUSE Signal peptidase complex subunit 2 OS=Mus musculus GN=Spcs2 PE=1 SV=1 4 159 5.0E-06
sp|Q28250|SPCS2_CANLF Signal peptidase complex subunit 2 OS=Canis lupus familiaris GN=SPCS2 PE=1 SV=1 4 159 5.0E-06
sp|Q4R512|SPCS2_MACFA Signal peptidase complex subunit 2 OS=Macaca fascicularis GN=SPCS2 PE=2 SV=1 4 159 6.0E-06
sp|Q15005|SPCS2_HUMAN Signal peptidase complex subunit 2 OS=Homo sapiens GN=SPCS2 PE=1 SV=3 4 159 6.0E-06
sp|Q5BJI9|SPCS2_DANRE Probable signal peptidase complex subunit 2 OS=Danio rerio GN=spcs2 PE=2 SV=1 4 163 9.0E-06
sp|Q5M8Y1|SPCS2_XENTR Probable signal peptidase complex subunit 2 OS=Xenopus tropicalis GN=spcs2 PE=2 SV=1 4 159 9.0E-06
[Show less]

GO

GO Term Description Terminal node
GO:0006465 signal peptide processing Yes
GO:0016021 integral component of membrane Yes
GO:0005787 signal peptidase complex Yes
GO:1905368 peptidase complex No
GO:0043603 cellular amide metabolic process No
GO:0043170 macromolecule metabolic process No
GO:0005575 cellular_component No
GO:0008150 biological_process No
GO:0034641 cellular nitrogen compound metabolic process No
GO:0006508 proteolysis No
GO:1902494 catalytic complex No
GO:0031224 intrinsic component of membrane No
GO:0006807 nitrogen compound metabolic process No
GO:0016485 protein processing No
GO:0110165 cellular anatomical entity No
GO:0006518 peptide metabolic process No
GO:0051604 protein maturation No
GO:0140534 endoplasmic reticulum protein-containing complex No
GO:0071704 organic substance metabolic process No
GO:0044237 cellular metabolic process No
GO:0008152 metabolic process No
GO:0009987 cellular process No
GO:0044238 primary metabolic process No
GO:0032991 protein-containing complex No
GO:0098796 membrane protein complex No
GO:0019538 protein metabolic process No
GO:1901564 organonitrogen compound metabolic process No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 33 0.5

Transmembrane Domains

Domain # Start End Length
1 43 61 18
2 71 90 19

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >OphauB2|7179
MASPDKINPYNLADLKNTSDDTIPNYLNSLKFRQSNYLIDVRLALGYSSILIAAACGLWDYKFGFESTKLYTAIA
VALYTILDCALIFWLSEVEKGTVYQGFAPSGEQITIASATKKNDPTYRLAITIKSRGEATTLDIAKPFAEWFDET
GRFVTPPFQQMLASSVPIIGKLDPKRVKLASQKMLDDNPDLFDAALATKKQDEGISTAASVKETKAEKRRKA*
Coding >OphauB2|7179
ATGGCTAGCCCCGACAAAATCAACCCCTATAACCTCGCTGACCTCAAAAACACATCCGACGACACCATTCCCAAC
TATCTGAATTCTCTAAAATTTCGCCAGTCAAACTATTTAATTGACGTTCGTCTTGCTCTGGGATACTCCTCAATC
CTCATTGCTGCTGCTTGCGGTCTCTGGGACTATAAATTCGGCTTTGAGAGTACTAAGCTCTATACTGCCATCGCG
GTCGCCCTATACACCATTCTCGACTGTGCTTTAATATTTTGGCTTTCTGAGGTGGAAAAAGGGACCGTATATCAA
GGTTTTGCGCCTTCTGGGGAACAGATTACCATTGCGAGTGCCACAAAGAAGAACGATCCGACCTATCGCCTCGCC
ATTACTATAAAGTCTCGTGGAGAAGCAACTACTTTGGACATTGCCAAACCCTTTGCCGAGTGGTTCGACGAGACG
GGTCGTTTTGTGACTCCACCATTCCAGCAGATGCTTGCTTCTAGCGTTCCTATCATTGGCAAGCTCGATCCTAAA
CGTGTCAAGCTCGCTTCACAAAAAATGCTTGACGATAATCCAGATTTATTTGATGCAGCACTTGCGACAAAGAAG
CAAGACGAGGGCATCTCGACGGCAGCGAGTGTGAAAGAAACAAAGGCGGAGAAGCGACGGAAAGCATAG
Transcript >OphauB2|7179
ATGGCTAGCCCCGACAAAATCAACCCCTATAACCTCGCTGACCTCAAAAACACATCCGACGACACCATTCCCAAC
TATCTGAATTCTCTAAAATTTCGCCAGTCAAACTATTTAATTGACGTTCGTCTTGCTCTGGGATACTCCTCAATC
CTCATTGCTGCTGCTTGCGGTCTCTGGGACTATAAATTCGGCTTTGAGAGTACTAAGCTCTATACTGCCATCGCG
GTCGCCCTATACACCATTCTCGACTGTGCTTTAATATTTTGGCTTTCTGAGGTGGAAAAAGGGACCGTATATCAA
GGTTTTGCGCCTTCTGGGGAACAGATTACCATTGCGAGTGCCACAAAGAAGAACGATCCGACCTATCGCCTCGCC
ATTACTATAAAGTCTCGTGGAGAAGCAACTACTTTGGACATTGCCAAACCCTTTGCCGAGTGGTTCGACGAGACG
GGTCGTTTTGTGACTCCACCATTCCAGCAGATGCTTGCTTCTAGCGTTCCTATCATTGGCAAGCTCGATCCTAAA
CGTGTCAAGCTCGCTTCACAAAAAATGCTTGACGATAATCCAGATTTATTTGATGCAGCACTTGCGACAAAGAAG
CAAGACGAGGGCATCTCGACGGCAGCGAGTGTGAAAGAAACAAAGGCGGAGAAGCGACGGAAAGCATAG
Gene >OphauB2|7179
ATGGCTAGCCCCGACAAAATCAACCCCTATAACCTCGCTGGTACGTAATTGCGCTTCCCTGGAGACAGACCGCAC
AGCTTACAGAGCTCCTTCCAGACCTCAAAAACACATCCGACGACACCATTCCCAACTATCTGAATTCTCTAAAAT
TTCGCCAGTCAAACTATTTAATTGACGTTCGTCTTGCTCTGGGATACTCCTCAATCCTCATTGCTGCTGCTTGCG
GTCTCTGGGACTATAAATTCGGCTTTGAGAGTACTAAGCTCTATACTGCCATCGCGGTCGCCCTATACACCATTC
TCGACTGTGCTTTAATATTTTGGCTTTCTGAGGTGGAAAAAGGGACCGTATATCAAGGTTTTGCGCCTTCTGGGG
AACAGGTGCGTGTCGCTTTCCGAATTTCCCTTGGGCCATGCGCGACTAACACTCTTCCTCGTGCCAGATTACCAT
TGCGAGTGCCACAAAGAAGAACGATCCGACCTATCGCCTCGCCATTACTATAAAGTCTCGTGGAGAAGCAACTAC
TTTGGACATTGCCAAACCCTTTGCCGAGTGGTTCGACGAGACGGGTCGTTTTGTGACTCCACCATTCCAGCAGAT
GCTTGCTTCTAGCGTTCCTATCATTGGCAAGCTCGATCCTAAACGTGTCAAGCTCGCTTCACAAAAAATGCTTGA
CGATAATCCAGATTTATTTGATGCAGCACTTGCGACAAAGAAGCAAGACGAGGGCATCTCGACGGCAGCGAGTGT
GAAAGAAACAAAGGCGGAGAAGCGACGGAAAGCATAG

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail