Fungal Genomics

at Utrecht University

General Properties

Protein IDOphauB2|7170
Gene name
LocationContig_73:9790..11711
Strand-
Gene length (bp)1921
Transcript length (bp)1674
Coding sequence length (bp)1674
Protein length (aa) 558

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00728 Glyco_hydro_20 Glycosyl hydrolase family 20, catalytic domain 1.9E-38 192 287
PF00728 Glyco_hydro_20 Glycosyl hydrolase family 20, catalytic domain 1.1E-41 288 507
PF14845 Glycohydro_20b2 beta-acetyl hexosaminidase like 2.8E-25 20 165
PF02838 Glyco_hydro_20b Glycosyl hydrolase family 20, domain 2 3.2E-07 18 169

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|D4AUH6|HEX1_ARTBC Beta-hexosaminidase ARB_07893 OS=Arthroderma benhamiae (strain ATCC MYA-4681 / CBS 112371) GN=ARB_07893 PE=1 SV=1 19 557 4.0E-122
sp|Q9SYK0|HEXO2_ARATH Beta-hexosaminidase 2 OS=Arabidopsis thaliana GN=HEXO2 PE=1 SV=1 4 549 6.0E-75
sp|E9DFH0|HEX1_COCPS Beta-hexosaminidase 1 OS=Coccidioides posadasii (strain RMSCC 757 / Silveira) GN=HEX1 PE=1 SV=1 8 549 6.0E-66
sp|D4AYT4|HEX2_ARTBC Probable beta-hexosaminidase ARB_01353 OS=Arthroderma benhamiae (strain ATCC MYA-4681 / CBS 112371) GN=ARB_01353 PE=1 SV=1 107 557 1.0E-64
sp|P43077|HEX1_CANAX Beta-hexosaminidase OS=Candida albicans GN=HEX1 PE=1 SV=1 68 557 2.0E-61
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|D4AUH6|HEX1_ARTBC Beta-hexosaminidase ARB_07893 OS=Arthroderma benhamiae (strain ATCC MYA-4681 / CBS 112371) GN=ARB_07893 PE=1 SV=1 19 557 4.0E-122
sp|Q9SYK0|HEXO2_ARATH Beta-hexosaminidase 2 OS=Arabidopsis thaliana GN=HEXO2 PE=1 SV=1 4 549 6.0E-75
sp|E9DFH0|HEX1_COCPS Beta-hexosaminidase 1 OS=Coccidioides posadasii (strain RMSCC 757 / Silveira) GN=HEX1 PE=1 SV=1 8 549 6.0E-66
sp|D4AYT4|HEX2_ARTBC Probable beta-hexosaminidase ARB_01353 OS=Arthroderma benhamiae (strain ATCC MYA-4681 / CBS 112371) GN=ARB_01353 PE=1 SV=1 107 557 1.0E-64
sp|P43077|HEX1_CANAX Beta-hexosaminidase OS=Candida albicans GN=HEX1 PE=1 SV=1 68 557 2.0E-61
sp|Q8WSF3|FDL_DROME Probable beta-hexosaminidase fdl OS=Drosophila melanogaster GN=fdl PE=1 SV=1 130 555 2.0E-57
sp|Q6AXR4|HEXB_RAT Beta-hexosaminidase subunit beta OS=Rattus norvegicus GN=Hexb PE=2 SV=1 4 554 1.0E-55
sp|P49010|HEXC_BOMMO Chitooligosaccharidolytic beta-N-acetylglucosaminidase OS=Bombyx mori PE=1 SV=1 130 555 7.0E-54
sp|A7WM73|HEXO1_ARATH Beta-hexosaminidase 1 OS=Arabidopsis thaliana GN=HEXO1 PE=1 SV=1 4 549 1.0E-53
sp|P20060|HEXB_MOUSE Beta-hexosaminidase subunit beta OS=Mus musculus GN=Hexb PE=1 SV=2 8 552 6.0E-52
sp|P49614|HEXB_FELCA Beta-hexosaminidase subunit beta OS=Felis catus GN=HEXB PE=2 SV=2 17 553 4.0E-50
sp|P07686|HEXB_HUMAN Beta-hexosaminidase subunit beta OS=Homo sapiens GN=HEXB PE=1 SV=3 16 551 7.0E-49
sp|Q8L7S6|HEXO3_ARATH Beta-hexosaminidase 3 OS=Arabidopsis thaliana GN=HEXO3 PE=1 SV=1 3 542 7.0E-48
sp|P13723|HEXA1_DICDI Beta-hexosaminidase subunit A1 OS=Dictyostelium discoideum GN=hexa1 PE=1 SV=1 115 547 2.0E-46
sp|Q29548|HEXB_PIG Beta-hexosaminidase subunit beta OS=Sus scrofa GN=HEXB PE=1 SV=2 132 552 5.0E-46
sp|P29416|HEXA_MOUSE Beta-hexosaminidase subunit alpha OS=Mus musculus GN=Hexa PE=1 SV=2 71 549 9.0E-45
sp|Q54K55|HEXB1_DICDI Beta-hexosaminidase subunit B1 OS=Dictyostelium discoideum GN=hexb1 PE=3 SV=1 132 543 1.0E-44
sp|Q0V8R6|HEXA_BOVIN Beta-hexosaminidase subunit alpha OS=Bos taurus GN=HEXA PE=2 SV=1 126 547 2.0E-44
sp|P06865|HEXA_HUMAN Beta-hexosaminidase subunit alpha OS=Homo sapiens GN=HEXA PE=1 SV=2 133 549 6.0E-44
sp|Q641X3|HEXA_RAT Beta-hexosaminidase subunit alpha OS=Rattus norvegicus GN=Hexa PE=2 SV=1 133 549 6.0E-44
sp|Q5RC84|HEXA_PONAB Beta-hexosaminidase subunit alpha OS=Pongo abelii GN=HEXA PE=3 SV=1 133 549 7.0E-44
sp|Q54SC9|HEXA2_DICDI Beta-hexosaminidase subunit A2 OS=Dictyostelium discoideum GN=hexa2 PE=3 SV=1 58 548 8.0E-41
sp|Q54K56|HEXB2_DICDI Beta-hexosaminidase subunit B2 OS=Dictyostelium discoideum GN=hexb2 PE=3 SV=1 18 542 3.0E-39
sp|Q22492|HEXA_CAEEL Beta-hexosaminidase A OS=Caenorhabditis elegans GN=hex-1 PE=1 SV=1 98 541 1.0E-38
sp|Q86M34|HEXB_ENTHI Beta-hexosaminidase subunit beta OS=Entamoeba histolytica GN=HEXB PE=1 SV=1 110 506 1.0E-35
sp|Q619W7|HEXA_CAEBR Beta-hexosaminidase A OS=Caenorhabditis briggsae GN=hex-1 PE=3 SV=2 98 541 1.0E-35
sp|P49009|HEXA_ENTHI Beta-hexosaminidase subunit alpha OS=Entamoeba histolytica GN=HEXA PE=1 SV=2 125 506 2.0E-29
sp|P96155|HEX1_VIBFU Beta-hexosaminidase OS=Vibrio furnissii GN=exo I PE=1 SV=1 131 501 2.0E-28
sp|P49008|HEXA_PORGI Beta-hexosaminidase OS=Porphyromonas gingivalis (strain ATCC BAA-308 / W83) GN=nahA PE=3 SV=2 132 506 5.0E-28
sp|Q7WUL4|HEX20_CELFI Beta-N-acetylhexosaminidase OS=Cellulomonas fimi GN=hex20 PE=1 SV=1 132 510 2.0E-23
sp|Q54468|CHB_SERMA Chitobiase OS=Serratia marcescens GN=chb PE=1 SV=1 120 366 4.0E-22
sp|P13670|CHB_VIBHA N,N'-diacetylchitobiase OS=Vibrio harveyi GN=chb PE=1 SV=1 134 286 7.0E-21
sp|Q04786|HEX_VIBVL Beta-hexosaminidase OS=Vibrio vulnificus GN=hex PE=3 SV=1 123 286 2.0E-16
sp|P49007|HEXB_PSEO7 Beta-hexosaminidase B OS=Pseudoalteromonas piscicida GN=nag096 PE=3 SV=1 135 301 4.0E-12
[Show less]

GO

GO Term Description Terminal node
GO:0005975 carbohydrate metabolic process Yes
GO:0004553 hydrolase activity, hydrolyzing O-glycosyl compounds Yes
GO:0003824 catalytic activity No
GO:0044238 primary metabolic process No
GO:0016798 hydrolase activity, acting on glycosyl bonds No
GO:0003674 molecular_function No
GO:0016787 hydrolase activity No
GO:0008152 metabolic process No
GO:0008150 biological_process No
GO:0071704 organic substance metabolic process No

Deeploc

Deeploc data not available for this genome

SignalP

SignalP signal predicted Location Score
Yes 1 - 19 0.999733

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

CAZyme category E-value Start End
GH20 1.5E-77 184 507

Secondary Metabolism

(None)

Expression data

No expression data available for this genome

Orthologs

Orthofinder run ID4
Orthogroup299
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|3143
Ophiocordyceps australis map64 (Brazil) OphauB2|2608
Ophiocordyceps australis map64 (Brazil) OphauB2|7170 (this protein)
Ophiocordyceps camponoti-floridani Ophcf2|04392
Ophiocordyceps camponoti-floridani Ophcf2|06719
Ophiocordyceps camponoti-rufipedis Ophun1|3912
Ophiocordyceps kimflemingae Ophio5|3678
Ophiocordyceps kimflemingae Ophio5|5955
Ophiocordyceps subramaniannii Hirsu2|10290
Ophiocordyceps subramaniannii Hirsu2|5838

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >OphauB2|7170
MSPMITLIVATFALSPAVALWPVPQELETGQDVLFINREIEVTYNDENLSHDADYKPPRGSNFTGKDVVQSGVSR
ALKGILDENFVPWKLRPRNSDFEPNADGDKTMIKNIKITQSEPDKPETFKPQAGDVDESYSLAISQGGEVTLECK
TSTGCLYGLESFVQLFYKHSSMSEPMSYTPYAPIVVEDGPMFPHRGLIMDVARNWYPIEDIYRTLDAMSWNKMNR
LHLHLTNTQSWPIEIPALPELAEKGAYSKGLTYSPDDIASIFEYATYRGISVIMEVDMPNHIEPPCGAFQMNNSK
VYDFVTTLFDDLLPRILPYSAYMHTGGDEIYANDSAIDPTVQSNDTAVIAPLLDRFSNFTHTKVQEGGLTQVVWE
DFITNWNQTLASDVVVQAWLGDDSVKSLINKGYKVIDSNLNFYYLDCGRGQWINYANGESFQKAYPFKDYCDPVK
NWRLIYSHDPRAGLSGEAAERVLGGEVAAWSEMMDGINFDTTVWPRAAAAAEVWWSGRLDSSGQNRSQLDAAPRL
SEMRERMVARGVRAFPVQMVYCTQGNKTECSL*
Coding >OphauB2|7170
ATGTCGCCCATGATTACATTAATAGTTGCCACGTTTGCGCTAAGTCCGGCCGTGGCACTATGGCCAGTACCACAG
GAACTCGAGACGGGACAGGACGTCCTCTTTATCAACCGGGAAATTGAGGTTACGTATAATGACGAGAATCTGTCT
CATGACGCCGATTACAAGCCACCGCGTGGCTCGAACTTCACTGGCAAGGATGTCGTCCAGTCTGGAGTCTCCCGT
GCTCTCAAGGGCATCCTTGACGAAAACTTTGTTCCTTGGAAGTTGCGCCCGCGTAACTCAGACTTTGAACCCAAC
GCCGACGGCGACAAGACGATGATTAAAAACATCAAAATTACACAGTCCGAGCCAGACAAGCCCGAAACGTTTAAA
CCACAAGCTGGAGACGTTGATGAGTCTTACTCGCTCGCTATTTCGCAAGGAGGCGAGGTTACTCTCGAATGCAAA
ACTTCAACGGGCTGTCTGTATGGCTTGGAGTCTTTTGTCCAACTTTTCTACAAGCACAGCAGCATGTCCGAGCCA
ATGAGCTATACGCCTTATGCCCCTATTGTCGTCGAGGATGGACCCATGTTTCCCCATCGCGGCCTGATTATGGAT
GTGGCCCGTAACTGGTATCCGATTGAAGATATCTATAGGACTCTCGATGCCATGTCGTGGAATAAGATGAACCGG
TTGCATCTACACCTTACTAATACACAGTCGTGGCCAATCGAGATACCAGCTCTTCCCGAACTAGCCGAAAAGGGT
GCATATAGCAAGGGCTTGACGTATTCGCCAGACGATATTGCCAGTATTTTTGAATACGCCACCTACCGCGGCATT
TCAGTGATTATGGAAGTCGATATGCCTAATCATATCGAGCCACCGTGTGGTGCGTTCCAGATGAATAACTCAAAA
GTATATGACTTTGTTACAACCTTATTCGACGATCTTCTTCCTCGGATTCTGCCATACTCGGCTTATATGCACACC
GGAGGCGATGAAATATACGCCAATGATTCAGCTATCGATCCTACGGTTCAATCCAACGATACAGCCGTAATTGCA
CCACTTCTAGATAGATTCAGCAATTTTACGCATACAAAGGTCCAAGAAGGTGGACTTACCCAAGTTGTCTGGGAG
GATTTCATCACAAACTGGAATCAGACTCTGGCTTCTGACGTTGTCGTCCAAGCATGGCTGGGCGACGACTCGGTT
AAGAGTCTAATTAACAAGGGATACAAGGTTATCGATAGTAACCTCAACTTTTACTATCTTGACTGCGGCCGCGGC
CAGTGGATCAACTATGCCAACGGCGAGTCCTTCCAGAAAGCCTATCCCTTCAAGGATTACTGTGATCCAGTCAAG
AACTGGCGTTTAATCTATTCTCATGACCCGAGAGCCGGTCTTTCTGGAGAAGCGGCTGAGCGGGTACTGGGCGGA
GAAGTAGCAGCTTGGAGTGAAATGATGGACGGTATCAACTTTGACACTACAGTCTGGCCACGGGCGGCCGCCGCC
GCTGAAGTTTGGTGGTCAGGCAGGCTGGATTCTTCAGGCCAGAACCGTAGCCAGTTGGACGCTGCACCCAGATTG
TCCGAGATGAGGGAGCGCATGGTAGCCCGTGGAGTTAGAGCGTTTCCAGTGCAAATGGTCTACTGCACCCAGGGT
AATAAGACAGAATGTAGTTTGTGA
Transcript >OphauB2|7170
ATGTCGCCCATGATTACATTAATAGTTGCCACGTTTGCGCTAAGTCCGGCCGTGGCACTATGGCCAGTACCACAG
GAACTCGAGACGGGACAGGACGTCCTCTTTATCAACCGGGAAATTGAGGTTACGTATAATGACGAGAATCTGTCT
CATGACGCCGATTACAAGCCACCGCGTGGCTCGAACTTCACTGGCAAGGATGTCGTCCAGTCTGGAGTCTCCCGT
GCTCTCAAGGGCATCCTTGACGAAAACTTTGTTCCTTGGAAGTTGCGCCCGCGTAACTCAGACTTTGAACCCAAC
GCCGACGGCGACAAGACGATGATTAAAAACATCAAAATTACACAGTCCGAGCCAGACAAGCCCGAAACGTTTAAA
CCACAAGCTGGAGACGTTGATGAGTCTTACTCGCTCGCTATTTCGCAAGGAGGCGAGGTTACTCTCGAATGCAAA
ACTTCAACGGGCTGTCTGTATGGCTTGGAGTCTTTTGTCCAACTTTTCTACAAGCACAGCAGCATGTCCGAGCCA
ATGAGCTATACGCCTTATGCCCCTATTGTCGTCGAGGATGGACCCATGTTTCCCCATCGCGGCCTGATTATGGAT
GTGGCCCGTAACTGGTATCCGATTGAAGATATCTATAGGACTCTCGATGCCATGTCGTGGAATAAGATGAACCGG
TTGCATCTACACCTTACTAATACACAGTCGTGGCCAATCGAGATACCAGCTCTTCCCGAACTAGCCGAAAAGGGT
GCATATAGCAAGGGCTTGACGTATTCGCCAGACGATATTGCCAGTATTTTTGAATACGCCACCTACCGCGGCATT
TCAGTGATTATGGAAGTCGATATGCCTAATCATATCGAGCCACCGTGTGGTGCGTTCCAGATGAATAACTCAAAA
GTATATGACTTTGTTACAACCTTATTCGACGATCTTCTTCCTCGGATTCTGCCATACTCGGCTTATATGCACACC
GGAGGCGATGAAATATACGCCAATGATTCAGCTATCGATCCTACGGTTCAATCCAACGATACAGCCGTAATTGCA
CCACTTCTAGATAGATTCAGCAATTTTACGCATACAAAGGTCCAAGAAGGTGGACTTACCCAAGTTGTCTGGGAG
GATTTCATCACAAACTGGAATCAGACTCTGGCTTCTGACGTTGTCGTCCAAGCATGGCTGGGCGACGACTCGGTT
AAGAGTCTAATTAACAAGGGATACAAGGTTATCGATAGTAACCTCAACTTTTACTATCTTGACTGCGGCCGCGGC
CAGTGGATCAACTATGCCAACGGCGAGTCCTTCCAGAAAGCCTATCCCTTCAAGGATTACTGTGATCCAGTCAAG
AACTGGCGTTTAATCTATTCTCATGACCCGAGAGCCGGTCTTTCTGGAGAAGCGGCTGAGCGGGTACTGGGCGGA
GAAGTAGCAGCTTGGAGTGAAATGATGGACGGTATCAACTTTGACACTACAGTCTGGCCACGGGCGGCCGCCGCC
GCTGAAGTTTGGTGGTCAGGCAGGCTGGATTCTTCAGGCCAGAACCGTAGCCAGTTGGACGCTGCACCCAGATTG
TCCGAGATGAGGGAGCGCATGGTAGCCCGTGGAGTTAGAGCGTTTCCAGTGCAAATGGTCTACTGCACCCAGGGT
AATAAGACAGAATGTAGTTTGTGA
Gene >OphauB2|7170
ATGTCGCCCATGATTACATTAATAGTTGCCACGTTTGCGCTAAGTCCGGCCGTGGCACTATGGCCAGTACCACAG
GAACTCGAGACGGGACAGGACGTCCTCTTTATCAACCGGGAAATTGAGGTTACGTATAATGACGAGAATGTACGT
CCTTTGCGCGTCGCAAGCTTCCATCATCTTTTGCGCTTGAATGAAGTATTGGCCCTGAGCAGAATGCTAAAAGAC
GTTGATATACAGCTGTCTCATGACGCCGATTACAAGCCACCGCGTGGCTCGAACTTCACTGGCAAGGATGTCGTC
CAGTCTGGAGTCTCCCGTGCTCTCAAGGGCATCCTTGACGAAAACTTTGTTCCTTGGAAGTTGCGCCCGCGTAAC
TCAGACTTTGAACCCAACGCCGACGGCGACAAGACGATGATTAAAAACATCAAAATTACACAGTCCGAGCCAGAC
AAGCCCGAAACGTTTAAACCACAAGCTGGAGACGTTGATGAGTCTTACTCGCTCGCTATTTCGCAAGGAGGCGAG
GTTACTCTCGAATGCAAAACTTCAACGGGCTGTCTGTATGGCTTGGAGTCTTTTGTCCAACTTTTCTACAAGCAC
AGCAGCATGTCCGAGCCAATGAGCTATACGCCTTATGCCCCTATTGTCGTCGAGGATGGACCCATGTTTCCCCAT
CGCGGCCTGATTATGGATGTGGCCCGTAACTGGTATCCGATTGAAGATATCTATAGGACTCTCGATGCCATGTCG
TGGAATAAGATGAACCGGTTGCATCTACACCTTACTAATACACAGTCGTGGCCAATCGAGATACCAGCTCTTCCC
GAACTAGCCGAAAAGGGTGCATATAGCAAGGGCTTGACGTATTCGCCAGACGATATTGCCAGTATTTTTGAATAC
GCCACCTACCGCGGCATTTCAGTGATTATGGAAGTCGATATGCCTAATCATATCGGTATAGTCGACCTTGCTTAT
AAAGACATTGCCGTTGCATATAATATGCAGCCATGGAATTGGTGGTGTCTAGAGCCACCGTGTGGTGCGTTCCAG
ATGAATAACTCAAAAGTATATGACTTTGTTACAACCTTATTCGACGATCTTCTTCCTCGGATTCTGCCATACTCG
GCTTATATGCACACCGGAGGCGATGAAATATACGCCAATGATTCAGCTATCGATCCTACGGTTCAATCCAACGAT
ACAGCCGTAATTGCACCACTTCTAGATAGATTCAGCAATTTTACGCATACAAAGGTCCAAGAAGGTGGACTTACC
CAAGTTGTCTGGGAGGATTTCATCACAAACTGGAATCAGACTCTGGCTTCTGACGTTGTCGTCCAAGCATGGCTG
GGCGACGACTCGGTTAAGAGTCTAATTAACAAGGGATACAAGGTTATCGATAGTAACCTCAACTTTTACGTCAGT
CACTGCTTGCATCAAGTCTTTTTAAAAAAAACATCACGTTAGAGTTATTCAACGCTAACGCATTACATGCTTCTA
GTATCTTGACTGCGGCCGCGGCCAGTGGATCAACTATGCCAACGGCGAGTCCTTCCAGAAAGCCTATCCCTTCAA
GGATTACTGTGATCCAGTCAAGAACTGGCGTTTAATCTATTCTCATGACCCGAGAGCCGGTCTTTCTGGAGAAGC
GGCTGAGCGGGTACTGGGCGGAGAAGTAGCAGCTTGGAGTGAAATGATGGACGGTATCAACTTTGACACTACAGT
CTGGCCACGGGCGGCCGCCGCCGCTGAAGTTTGGTGGTCAGGCAGGCTGGATTCTTCAGGCCAGAACCGTAGCCA
GTTGGACGCTGCACCCAGATTGTCCGAGATGAGGGAGCGCATGGTAGCCCGTGGAGTTAGAGCGTTTCCAGTGCA
AATGGTCTACTGCACCCAGGGTAATAAGACAGAATGTAGTTTGTGA

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail