Fungal Genomics

at Utrecht University

General Properties

Protein IDOphauB2|7166
Gene name
LocationContig_72:91088..92745
Strand-
Gene length (bp)1657
Transcript length (bp)1383
Coding sequence length (bp)1383
Protein length (aa) 461

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF05730 CFEM CFEM domain 1.3E-15 28 91

Swissprot hits

(None)

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
Yes 1 - 23 0.45

Transmembrane Domains

Domain # Start End Length
1 100 122 22
2 178 200 22
3 213 235 22
4 259 281 22
5 294 316 22
6 336 358 22

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >OphauB2|7166
MKTGALARLAALVALAAPTVVAQLPAEISNLPDCAISCLGQSISKTQCSPSDVACICRDEPLQEALTACVMEKCS
VPDSLVAKNITSTSCGLPVRDRHKTYVATSNAFGIITGVIVLLRVGYKLWAGLEFGLDDVFTLATTLMGVPSTVF
NATVLPQNGIGRDVWTQTPTQITNFARIFYVMEILYFAEVALLKLAMLFFYVRIFPAANVRRLLMGTIVIVSLFG
LAYVLAAIFQCTPISYHWHQWDGMHHGKCINLNGLAWSNAIMSIVLDIWMLAIPLWQLKILRMDWKKKAGVAIMF
CVGTFVTVVSILRLHSLVKFGLDADNPTWEFYNVGLWSTIEINVGIVCVCLPTLRLMLVRLFPMLRSSTQRYYDG
RYANSASAGDRQLRRPSRTLGTAGTDNSIKGAPSTSKADASLNQITMQTTYAVEYRDLNDMRLKYLGDVGSHASS
GRTDDSLGHA*
Coding >OphauB2|7166
ATGAAGACTGGGGCACTGGCCCGGCTGGCCGCTCTCGTTGCCCTCGCCGCCCCAACAGTGGTTGCTCAGCTGCCG
GCAGAAATCTCAAACCTGCCAGACTGTGCTATTTCCTGTCTTGGCCAGTCCATCAGCAAGACACAATGCTCGCCG
AGCGACGTGGCCTGCATCTGCAGGGACGAGCCGCTTCAAGAAGCACTCACGGCATGCGTCATGGAAAAGTGCAGC
GTTCCTGATTCTCTGGTTGCCAAAAACATCACGTCGACGAGCTGCGGGCTGCCGGTGCGAGACCGTCACAAGACA
TATGTGGCCACGTCGAATGCCTTTGGCATCATTACGGGCGTCATTGTCCTCTTGCGGGTGGGCTATAAGCTATGG
GCAGGCCTAGAGTTTGGCCTCGACGACGTGTTTACGCTGGCCACGACGCTGATGGGAGTGCCGAGCACCGTCTTC
AACGCCACGGTGCTGCCGCAGAATGGAATCGGGCGCGACGTGTGGACGCAGACGCCGACGCAAATCACAAACTTT
GCGCGCATCTTTTACGTCATGGAGATTCTTTACTTTGCCGAGGTGGCGCTTCTCAAGCTGGCCATGCTCTTCTTT
TACGTGCGCATCTTTCCGGCGGCCAATGTGCGGCGGCTGCTCATGGGCACCATTGTTATAGTGTCGCTCTTTGGG
CTGGCCTATGTGCTGGCAGCCATTTTCCAGTGCACGCCAATCAGCTACCATTGGCATCAGTGGGATGGGATGCAT
CACGGCAAATGCATCAATCTCAATGGGCTGGCGTGGTCTAATGCCATTATGAGCATTGTGCTGGATATATGGATG
CTGGCCATTCCGCTGTGGCAGCTCAAGATTTTGCGCATGGACTGGAAGAAGAAGGCTGGTGTGGCCATAATGTTT
TGCGTCGGCACCTTCGTCACCGTCGTCAGCATCCTGCGCCTGCACTCGCTCGTCAAGTTTGGCCTCGACGCCGAT
AACCCAACATGGGAGTTTTACAATGTCGGTCTGTGGTCCACGATTGAAATCAACGTGGGCATTGTTTGCGTCTGC
CTGCCCACGCTGCGTCTGATGCTGGTGCGTCTCTTCCCCATGCTGCGCAGCTCGACGCAGCGCTACTACGACGGC
CGCTATGCAAACTCGGCCAGTGCTGGCGATCGCCAGCTGCGACGCCCCAGTCGGACACTGGGCACCGCGGGCACC
GACAACTCCATCAAGGGCGCGCCGTCGACGAGCAAGGCTGATGCGAGTCTCAACCAAATCACCATGCAAACCACG
TATGCTGTCGAGTACAGGGACTTGAATGACATGAGGCTCAAGTACCTGGGCGACGTGGGGTCGCATGCTAGCAGT
GGTCGGACAGACGACAGTCTTGGCCACGCATAG
Transcript >OphauB2|7166
ATGAAGACTGGGGCACTGGCCCGGCTGGCCGCTCTCGTTGCCCTCGCCGCCCCAACAGTGGTTGCTCAGCTGCCG
GCAGAAATCTCAAACCTGCCAGACTGTGCTATTTCCTGTCTTGGCCAGTCCATCAGCAAGACACAATGCTCGCCG
AGCGACGTGGCCTGCATCTGCAGGGACGAGCCGCTTCAAGAAGCACTCACGGCATGCGTCATGGAAAAGTGCAGC
GTTCCTGATTCTCTGGTTGCCAAAAACATCACGTCGACGAGCTGCGGGCTGCCGGTGCGAGACCGTCACAAGACA
TATGTGGCCACGTCGAATGCCTTTGGCATCATTACGGGCGTCATTGTCCTCTTGCGGGTGGGCTATAAGCTATGG
GCAGGCCTAGAGTTTGGCCTCGACGACGTGTTTACGCTGGCCACGACGCTGATGGGAGTGCCGAGCACCGTCTTC
AACGCCACGGTGCTGCCGCAGAATGGAATCGGGCGCGACGTGTGGACGCAGACGCCGACGCAAATCACAAACTTT
GCGCGCATCTTTTACGTCATGGAGATTCTTTACTTTGCCGAGGTGGCGCTTCTCAAGCTGGCCATGCTCTTCTTT
TACGTGCGCATCTTTCCGGCGGCCAATGTGCGGCGGCTGCTCATGGGCACCATTGTTATAGTGTCGCTCTTTGGG
CTGGCCTATGTGCTGGCAGCCATTTTCCAGTGCACGCCAATCAGCTACCATTGGCATCAGTGGGATGGGATGCAT
CACGGCAAATGCATCAATCTCAATGGGCTGGCGTGGTCTAATGCCATTATGAGCATTGTGCTGGATATATGGATG
CTGGCCATTCCGCTGTGGCAGCTCAAGATTTTGCGCATGGACTGGAAGAAGAAGGCTGGTGTGGCCATAATGTTT
TGCGTCGGCACCTTCGTCACCGTCGTCAGCATCCTGCGCCTGCACTCGCTCGTCAAGTTTGGCCTCGACGCCGAT
AACCCAACATGGGAGTTTTACAATGTCGGTCTGTGGTCCACGATTGAAATCAACGTGGGCATTGTTTGCGTCTGC
CTGCCCACGCTGCGTCTGATGCTGGTGCGTCTCTTCCCCATGCTGCGCAGCTCGACGCAGCGCTACTACGACGGC
CGCTATGCAAACTCGGCCAGTGCTGGCGATCGCCAGCTGCGACGCCCCAGTCGGACACTGGGCACCGCGGGCACC
GACAACTCCATCAAGGGCGCGCCGTCGACGAGCAAGGCTGATGCGAGTCTCAACCAAATCACCATGCAAACCACG
TATGCTGTCGAGTACAGGGACTTGAATGACATGAGGCTCAAGTACCTGGGCGACGTGGGGTCGCATGCTAGCAGT
GGTCGGACAGACGACAGTCTTGGCCACGCATAG
Gene >OphauB2|7166
ATGAAGACTGGGGCACTGGCCCGGCTGGCCGCTCTCGTTGCCCTCGCCGCCCCAACAGTGGTTGCTCAGCTGCCG
GCAGAAATCTCAAACCTGCCAGACTGTGCTGTATGTATTTCCTTGGGCGAGACTTGCAGAGAGCCCGTCGTGCTG
ACGATTTGAGGATTCAAGATTTCCTGTCTTGGCCAGTCCATCAGCAAGACACAATGCTCGCCGAGCGACGTGGCC
TGCATCTGCAGGGACGAGCCGCTTCAAGAAGCACTCACGGCATGCGTCATGGAAAAGTGCAGCGTTCCTGATTCT
CTGGGTATGTAAACAAGAGACAAAAAGAGTCGGGCCCCACGGCAGAGACTGACTCTTTTTGAAAAATTCAGTTGC
CAAAAACATCACGTCGACGAGCTGCGGGCTGCCGGTGCGAGACCGTCACAAGACATATGTGGCCACGTCGAATGC
CTTTGGCATCATTACGGGCGTCATTGTCCTCTTGCGGGTGGGCTATAAGCTATGGGCAGGCCTAGAGTTTGGCCT
CGACGACGTGTTTACGCTGGCCACGACGCTGATGGGAGTGCCGAGCACCGTCTTCAACGCCACGGTGCTGCCGCA
GAATGGAATCGGGCGCGACGTGTGGACGCAGACGCCGACGCAAATCACAAACTTTGCGCGCATCTTTTACGTCAT
GGAGATTCTTTACTTTGCCGAGGTGGCGCTTCTCAAGCTGGCCATGCTCTTCTTTTACGTGCGCATCTTTCCGGC
GGCCAATGTGCGGCGGCTGCTCATGGGCACCATTGTTATAGTGTCGCTCTTTGGGCTGGCCTATGTGCTGGCAGC
CATTTTCCAGTGCACGCCAATCAGCTACCATTGGCATCAGTGGGATGGGATGCATCACGGCAAATGCATCAATCT
CAATGGGCTGGCGTGGTCTAATGCCATTATGAGCATTGTGCTGGATATATGGATGCTGGCCATTCCGCTGTGGCA
GCTCAAGATTTTGCGCATGGACTGGAAGAAGAAGGCTGGTGTGGCCATAATGTTTTGCGTCGGCACCTTGTTAGT
CACCCTCTGTCTCTCTCTGTCTCTCTCTCTCTGTCTCTCTCTGTCTCTCTCTCTCTGTCTCTTTTTTTTCTTTTT
TTCTCCTTTTTTCTTTTCTTTTTACACATATTGTTTGTCATGATGCTAACAGACATCCTTTAGCGTCACCGTCGT
CAGCATCCTGCGCCTGCACTCGCTCGTCAAGTTTGGCCTCGACGCCGATAACCCAACATGGGAGTTTTACAATGT
CGGTCTGTGGTCCACGATTGAAATCAACGTGGGCATTGTTTGCGTCTGCCTGCCCACGCTGCGTCTGATGCTGGT
GCGTCTCTTCCCCATGCTGCGCAGCTCGACGCAGCGCTACTACGACGGCCGCTATGCAAACTCGGCCAGTGCTGG
CGATCGCCAGCTGCGACGCCCCAGTCGGACACTGGGCACCGCGGGCACCGACAACTCCATCAAGGGCGCGCCGTC
GACGAGCAAGGCTGATGCGAGTCTCAACCAAATCACCATGCAAACCACGTATGCTGTCGAGTACAGGGACTTGAA
TGACATGAGGCTCAAGTACCTGGGCGACGTGGGGTCGCATGCTAGCAGTGGTCGGACAGACGACAGTCTTGGCCA
CGCATAG

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail