Fungal Genomics

at Utrecht University

General Properties

Protein IDOphauB2|7160
Gene name
LocationContig_72:73478..74221
Strand+
Gene length (bp)743
Transcript length (bp)606
Coding sequence length (bp)606
Protein length (aa) 202

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF04117 Mpv17_PMP22 Mpv17 / PMP22 family 1.4E-16 134 195

Swissprot hits

Swissprot ID Swissprot Description Start End E-value
sp|Q54GD8|PX24C_DICDI PXMP2/4 family protein 3 OS=Dictyostelium discoideum GN=DDB_G0290223 PE=3 SV=1 3 200 3.0E-14
sp|Q9V492|MPV17_DROME Mpv17-like protein OS=Drosophila melanogaster GN=CG11077 PE=2 SV=1 38 197 6.0E-07
sp|Q06563|SYM1_YEAST Protein SYM1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=SYM1 PE=1 SV=1 102 201 1.0E-06

GO

GO Term Description Terminal node
GO:0016021 integral component of membrane Yes
GO:0031224 intrinsic component of membrane No
GO:0110165 cellular anatomical entity No
GO:0005575 cellular_component No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 29 0.5

Transmembrane Domains

Domain # Start End Length
1 114 136 22
2 151 173 22
3 180 197 17

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >OphauB2|7160
MPSPMAVATLQASGLSVASNLAAQVIEAHNKSRPLGLDVRQLLRFLILTLLTAPPNYLWQQLLERKLPAYPRRRA
PSRHGIEMSVLEQGGATADAAMSDTAPVFSWRNTMAKWFIDCITLGALVNTTAFFIIMGLLKGQPRALISHNIAT
ETLPIILAGYKIWPLASVISFTFVPVHRRIVWLSTIGFIWGIYMSLVASRV*
Coding >OphauB2|7160
ATGCCGTCGCCCATGGCCGTTGCGACGCTGCAGGCATCCGGCCTGTCTGTGGCCTCGAATCTTGCGGCTCAAGTG
ATTGAAGCGCACAACAAGAGTCGCCCGCTGGGCCTCGACGTGCGCCAGCTGCTTCGCTTCCTTATCCTGACGCTC
CTCACCGCTCCGCCCAATTACCTCTGGCAGCAGCTGCTCGAGCGCAAGCTGCCCGCCTATCCGCGCCGCCGCGCG
CCCAGCCGCCACGGCATTGAAATGAGCGTGCTCGAGCAGGGCGGCGCCACTGCCGATGCTGCCATGTCGGACACG
GCTCCCGTCTTTAGCTGGCGCAACACAATGGCCAAGTGGTTCATTGACTGCATCACCCTCGGCGCCCTTGTCAAT
ACGACTGCCTTCTTCATCATCATGGGCCTGCTCAAGGGTCAGCCCCGTGCCCTCATCTCCCACAACATCGCCACT
GAAACGCTGCCCATCATCTTGGCTGGCTACAAGATTTGGCCCCTGGCCTCTGTCATTAGCTTTACCTTTGTGCCC
GTCCATCGCCGCATCGTCTGGCTGAGTACCATTGGCTTTATCTGGGGCATCTACATGAGCCTGGTTGCATCGCGT
GTCTAG
Transcript >OphauB2|7160
ATGCCGTCGCCCATGGCCGTTGCGACGCTGCAGGCATCCGGCCTGTCTGTGGCCTCGAATCTTGCGGCTCAAGTG
ATTGAAGCGCACAACAAGAGTCGCCCGCTGGGCCTCGACGTGCGCCAGCTGCTTCGCTTCCTTATCCTGACGCTC
CTCACCGCTCCGCCCAATTACCTCTGGCAGCAGCTGCTCGAGCGCAAGCTGCCCGCCTATCCGCGCCGCCGCGCG
CCCAGCCGCCACGGCATTGAAATGAGCGTGCTCGAGCAGGGCGGCGCCACTGCCGATGCTGCCATGTCGGACACG
GCTCCCGTCTTTAGCTGGCGCAACACAATGGCCAAGTGGTTCATTGACTGCATCACCCTCGGCGCCCTTGTCAAT
ACGACTGCCTTCTTCATCATCATGGGCCTGCTCAAGGGTCAGCCCCGTGCCCTCATCTCCCACAACATCGCCACT
GAAACGCTGCCCATCATCTTGGCTGGCTACAAGATTTGGCCCCTGGCCTCTGTCATTAGCTTTACCTTTGTGCCC
GTCCATCGCCGCATCGTCTGGCTGAGTACCATTGGCTTTATCTGGGGCATCTACATGAGCCTGGTTGCATCGCGT
GTCTAG
Gene >OphauB2|7160
ATGCCGTCGCCCATGGCCGTTGCGACGCTGCAGGCATCCGGCCTGTCTGTGGCCTCGAATCTTGCGGCTCAAGTG
ATTGAAGCGCACAACAAGAGTGTAAGGCCCCCTATAATGCTGTTGCTCCCTCCTCCCTTTTTTTTTATTCGTCTC
CCTCGATGGCTTGGGGCTGACGATGCAACGGTAGCGCCCGCTGGGCCTCGACGTGCGCCAGCTGCTTCGCTTCCT
TATCCTGACGCTCCTCACCGCTCCGCCCAATTACCTCTGGCAGCAGCTGCTCGAGCGCAAGCTGCCCGCCTATCC
GCGCCGCCGCGCGCCCAGCCGCCACGGCATTGAAATGAGCGTGCTCGAGCAGGGCGGCGCCACTGCCGATGCTGC
CATGTCGGACACGGCTCCCGTCTTTAGCTGGCGCAACACAATGGCCAAGTGGTTCATTGACTGCATCACCCTCGG
CGCCCTTGTCAATACGACTGCCTTCTTCATCATCATGGGCCTGCTCAAGGGTCAGCCCCGTGCCCTCATCTCCCA
CAACATCGCCACTGTAAGCCAGCCCCCCACGACGCTTGGAATCTCGCAGCTTACCCACGCAGGAAACGCTGCCCA
TCATCTTGGCTGGCTACAAGATTTGGCCCCTGGCCTCTGTCATTAGCTTTACCTTTGTGCCCGTCCATCGCCGCA
TCGTCTGGCTGAGTACCATTGGCTTTATCTGGGGCATCTACATGAGCCTGGTTGCATCGCGTGTCTAG

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail