Fungal Genomics

at Utrecht University

General Properties

Protein IDOphauB2|7159
Gene name
LocationContig_72:68735..69176
Strand+
Gene length (bp)441
Transcript length (bp)441
Coding sequence length (bp)441
Protein length (aa) 147

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

(None)

Swissprot hits

(None)

GO

(None)

Deeploc

Deeploc data not available for this genome

SignalP

SignalP signal predicted Location Score
Yes 1 - 23 0.999762

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

No expression data available for this genome

Orthologs

Orthofinder run ID4
Orthogroup171
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|2453
Ophiocordyceps australis 1348a (Ghana) OphauG2|5209
Ophiocordyceps australis 1348a (Ghana) OphauG2|6873
Ophiocordyceps australis map64 (Brazil) OphauB2|6831
Ophiocordyceps australis map64 (Brazil) OphauB2|7159 (this protein)
Ophiocordyceps kimflemingae Ophio5|5336
Ophiocordyceps kimflemingae Ophio5|7312
Ophiocordyceps subramaniannii Hirsu2|186
Ophiocordyceps subramaniannii Hirsu2|260
Ophiocordyceps subramaniannii Hirsu2|2751
Ophiocordyceps subramaniannii Hirsu2|9178

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >OphauB2|7159
MTVLNKMHLLILSLVLCLPATLARCQRRGRYRSDGRFFIDDYRVNEVVSQLQRQNGEAFGVLVNETCEWRGESPM
CGKDVATYGTIRWGWELVAYDEDVDFNEMCKNANHEHFPGVECCSVYGVTCLYGYKRLWCDTKEWHKSHSI*
Coding >OphauB2|7159
ATGACGGTCCTGAACAAAATGCATCTGCTCATCTTGAGCCTTGTCCTTTGCTTGCCGGCTACCCTCGCCAGATGC
CAACGACGTGGGCGTTATCGCAGCGACGGCAGATTCTTCATCGACGACTACCGAGTCAATGAGGTTGTTTCGCAA
CTACAAAGACAAAATGGAGAAGCATTCGGCGTCCTGGTTAATGAAACGTGCGAATGGCGCGGCGAGTCCCCCATG
TGCGGCAAGGACGTGGCCACTTATGGGACCATAAGATGGGGCTGGGAGCTGGTGGCATATGATGAAGATGTCGAC
TTTAATGAAATGTGCAAAAACGCCAACCATGAGCATTTCCCTGGGGTAGAGTGCTGTAGTGTCTACGGTGTCACC
TGTCTGTATGGGTATAAGCGCCTATGGTGCGATACGAAAGAATGGCACAAGTCGCATTCGATATGA
Transcript >OphauB2|7159
ATGACGGTCCTGAACAAAATGCATCTGCTCATCTTGAGCCTTGTCCTTTGCTTGCCGGCTACCCTCGCCAGATGC
CAACGACGTGGGCGTTATCGCAGCGACGGCAGATTCTTCATCGACGACTACCGAGTCAATGAGGTTGTTTCGCAA
CTACAAAGACAAAATGGAGAAGCATTCGGCGTCCTGGTTAATGAAACGTGCGAATGGCGCGGCGAGTCCCCCATG
TGCGGCAAGGACGTGGCCACTTATGGGACCATAAGATGGGGCTGGGAGCTGGTGGCATATGATGAAGATGTCGAC
TTTAATGAAATGTGCAAAAACGCCAACCATGAGCATTTCCCTGGGGTAGAGTGCTGTAGTGTCTACGGTGTCACC
TGTCTGTATGGGTATAAGCGCCTATGGTGCGATACGAAAGAATGGCACAAGTCGCATTCGATATGA
Gene >OphauB2|7159
ATGACGGTCCTGAACAAAATGCATCTGCTCATCTTGAGCCTTGTCCTTTGCTTGCCGGCTACCCTCGCCAGATGC
CAACGACGTGGGCGTTATCGCAGCGACGGCAGATTCTTCATCGACGACTACCGAGTCAATGAGGTTGTTTCGCAA
CTACAAAGACAAAATGGAGAAGCATTCGGCGTCCTGGTTAATGAAACGTGCGAATGGCGCGGCGAGTCCCCCATG
TGCGGCAAGGACGTGGCCACTTATGGGACCATAAGATGGGGCTGGGAGCTGGTGGCATATGATGAAGATGTCGAC
TTTAATGAAATGTGCAAAAACGCCAACCATGAGCATTTCCCTGGGGTAGAGTGCTGTAGTGTCTACGGTGTCACC
TGTCTGTATGGGTATAAGCGCCTATGGTGCGATACGAAAGAATGGCACAAGTCGCATTCGATATGA

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail