Fungal Genomics

at Utrecht University

General Properties

Protein IDOphauB2|7146
Gene name
LocationContig_72:33329..35657
Strand+
Gene length (bp)2328
Transcript length (bp)2328
Coding sequence length (bp)2328
Protein length (aa) 776

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00076 RRM_1 RNA recognition motif. (a.k.a. RRM, RBD, or RNP domain) 1.7E-15 40 110
PF00076 RRM_1 RNA recognition motif. (a.k.a. RRM, RBD, or RNP domain) 3.5E-14 144 212
PF00076 RRM_1 RNA recognition motif. (a.k.a. RRM, RBD, or RNP domain) 3.8E-15 345 403

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|O74400|YOCE_SCHPO Uncharacterized RNA-binding protein C4F6.14 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPBC4F6.14 PE=1 SV=1 39 672 4.0E-118
sp|P37838|NOP4_YEAST Nucleolar protein 4 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=NOP4 PE=1 SV=1 344 670 4.0E-70
sp|Q8CGC6|RBM28_MOUSE RNA-binding protein 28 OS=Mus musculus GN=Rbm28 PE=1 SV=4 39 670 2.0E-51
sp|P37838|NOP4_YEAST Nucleolar protein 4 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=NOP4 PE=1 SV=1 38 239 1.0E-36
sp|Q9NW13|RBM28_HUMAN RNA-binding protein 28 OS=Homo sapiens GN=RBM28 PE=1 SV=3 293 670 2.0E-22
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|O74400|YOCE_SCHPO Uncharacterized RNA-binding protein C4F6.14 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPBC4F6.14 PE=1 SV=1 39 672 4.0E-118
sp|P37838|NOP4_YEAST Nucleolar protein 4 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=NOP4 PE=1 SV=1 344 670 4.0E-70
sp|Q8CGC6|RBM28_MOUSE RNA-binding protein 28 OS=Mus musculus GN=Rbm28 PE=1 SV=4 39 670 2.0E-51
sp|P37838|NOP4_YEAST Nucleolar protein 4 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=NOP4 PE=1 SV=1 38 239 1.0E-36
sp|Q9NW13|RBM28_HUMAN RNA-binding protein 28 OS=Homo sapiens GN=RBM28 PE=1 SV=3 293 670 2.0E-22
sp|P19683|ROC4_NICSY 31 kDa ribonucleoprotein, chloroplastic OS=Nicotiana sylvestris PE=1 SV=1 40 220 2.0E-20
sp|P28644|ROC1_SPIOL 28 kDa ribonucleoprotein, chloroplastic OS=Spinacia oleracea PE=1 SV=1 40 217 2.0E-19
sp|P19682|ROC3_NICSY 28 kDa ribonucleoprotein, chloroplastic OS=Nicotiana sylvestris PE=1 SV=1 40 217 8.0E-18
sp|Q04836|CP31A_ARATH 31 kDa ribonucleoprotein, chloroplastic OS=Arabidopsis thaliana GN=CP31A PE=1 SV=1 24 217 4.0E-17
sp|Q39061|CP33_ARATH RNA-binding protein CP33, chloroplastic OS=Arabidopsis thaliana GN=CP33 PE=2 SV=1 40 221 5.0E-16
sp|O22173|PABP4_ARATH Polyadenylate-binding protein 4 OS=Arabidopsis thaliana GN=PAB4 PE=1 SV=1 39 401 1.0E-15
sp|Q9FGS0|CP31B_ARATH RNA-binding protein CP31B, chloroplastic OS=Arabidopsis thaliana GN=CP31B PE=1 SV=1 32 217 7.0E-15
sp|P42731|PABP2_ARATH Polyadenylate-binding protein 2 OS=Arabidopsis thaliana GN=PAB2 PE=1 SV=1 39 401 1.0E-14
sp|O04319|PABP6_ARATH Polyadenylate-binding protein 6 OS=Arabidopsis thaliana GN=PAB6 PE=2 SV=1 39 399 2.0E-14
sp|Q8R3C6|RBM19_MOUSE Probable RNA-binding protein 19 OS=Mus musculus GN=Rbm19 PE=1 SV=1 39 217 4.0E-14
sp|Q9Y4C8|RBM19_HUMAN Probable RNA-binding protein 19 OS=Homo sapiens GN=RBM19 PE=1 SV=3 39 217 9.0E-14
sp|Q08937|ROC2_NICSY 29 kDa ribonucleoprotein B, chloroplastic OS=Nicotiana sylvestris PE=2 SV=1 27 217 1.0E-13
sp|Q9SX79|RB47C_ARATH Polyadenylate-binding protein RBP47C OS=Arabidopsis thaliana GN=RBP47C PE=2 SV=1 39 217 1.0E-13
sp|Q9LKA4|UBA2C_ARATH UBP1-associated protein 2C OS=Arabidopsis thaliana GN=UBA2C PE=2 SV=1 38 230 1.0E-13
sp|P04147|PABP_YEAST Polyadenylate-binding protein, cytoplasmic and nuclear OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=PAB1 PE=1 SV=4 39 401 2.0E-13
sp|Q9SX80|R47CP_ARATH Polyadenylate-binding protein RBP47C' OS=Arabidopsis thaliana GN=RBP47C' PE=2 SV=1 39 217 2.0E-13
sp|Q5R9Z6|ELAV2_PONAB ELAV-like protein 2 OS=Pongo abelii GN=ELAVL2 PE=2 SV=1 35 401 3.0E-13
sp|Q12926|ELAV2_HUMAN ELAV-like protein 2 OS=Homo sapiens GN=ELAVL2 PE=1 SV=2 35 401 3.0E-13
sp|Q9FXA2|PABP8_ARATH Polyadenylate-binding protein 8 OS=Arabidopsis thaliana GN=PAB8 PE=1 SV=1 39 401 3.0E-13
sp|P19684|ROC5_NICSY 33 kDa ribonucleoprotein, chloroplastic OS=Nicotiana sylvestris PE=1 SV=1 40 217 3.0E-13
sp|Q6CSV3|PABP_KLULA Polyadenylate-binding protein, cytoplasmic and nuclear OS=Kluyveromyces lactis (strain ATCC 8585 / CBS 2359 / DSM 70799 / NBRC 1267 / NRRL Y-1140 / WM37) GN=PAB1 PE=3 SV=1 39 401 4.0E-13
sp|P31209|PABP_SCHPO Polyadenylate-binding protein, cytoplasmic and nuclear OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=pab1 PE=1 SV=2 39 401 6.0E-13
sp|Q61701|ELAV4_MOUSE ELAV-like protein 4 OS=Mus musculus GN=Elavl4 PE=1 SV=1 35 401 6.0E-13
sp|O09032|ELAV4_RAT ELAV-like protein 4 OS=Rattus norvegicus GN=Elavl4 PE=1 SV=1 35 401 6.0E-13
sp|P49314|ROC2_NICPL 31 kDa ribonucleoprotein, chloroplastic OS=Nicotiana plumbaginifolia PE=2 SV=1 27 217 6.0E-13
sp|P26378|ELAV4_HUMAN ELAV-like protein 4 OS=Homo sapiens GN=ELAVL4 PE=1 SV=2 35 401 7.0E-13
sp|P82277|RRP2_SPIOL 30S ribosomal protein 2, chloroplastic OS=Spinacia oleracea GN=PSRP2 PE=1 SV=1 38 217 1.0E-12
sp|O13845|RSD1_SCHPO RNA-binding protein rsd1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=rsd1 PE=1 SV=2 38 298 1.0E-12
sp|Q9FPJ8|RB45A_ARATH Polyadenylate-binding protein RBP45A OS=Arabidopsis thaliana GN=RBP45A PE=2 SV=1 38 217 1.0E-12
sp|Q60899|ELAV2_MOUSE ELAV-like protein 2 OS=Mus musculus GN=Elavl2 PE=2 SV=1 35 401 1.0E-12
sp|Q06106|MRD1_YEAST Multiple RNA-binding domain-containing protein 1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=MRD1 PE=1 SV=1 14 216 2.0E-12
sp|Q08935|ROC1_NICSY 29 kDa ribonucleoprotein A, chloroplastic OS=Nicotiana sylvestris PE=2 SV=1 40 214 2.0E-12
sp|Q8CH84|ELAV2_RAT ELAV-like protein 2 OS=Rattus norvegicus GN=Elavl2 PE=1 SV=1 45 401 3.0E-12
sp|P28644|ROC1_SPIOL 28 kDa ribonucleoprotein, chloroplastic OS=Spinacia oleracea PE=1 SV=1 30 121 5.0E-12
sp|O04319|PABP6_ARATH Polyadenylate-binding protein 6 OS=Arabidopsis thaliana GN=PAB6 PE=2 SV=1 39 221 5.0E-12
sp|Q6CEW9|MRD1_YARLI Multiple RNA-binding domain-containing protein 1 OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=MRD1 PE=3 SV=1 39 217 5.0E-12
sp|O94432|YHKF_SCHPO Uncharacterized RNA-binding protein C660.15 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPBC660.15 PE=3 SV=1 6 208 9.0E-12
sp|P49313|ROC1_NICPL 30 kDa ribonucleoprotein, chloroplastic OS=Nicotiana plumbaginifolia PE=2 SV=1 40 214 1.0E-11
sp|Q04836|CP31A_ARATH 31 kDa ribonucleoprotein, chloroplastic OS=Arabidopsis thaliana GN=CP31A PE=1 SV=1 30 117 2.0E-11
sp|O60176|YG41_SCHPO Uncharacterized RNA-binding protein C23E6.01c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPBC23E6.01c PE=1 SV=2 39 217 2.0E-11
sp|Q4PC17|MRD1_USTMA Multiple RNA-binding domain-containing protein 1 OS=Ustilago maydis (strain 521 / FGSC 9021) GN=MRD1 PE=3 SV=1 39 217 4.0E-11
sp|O22173|PABP4_ARATH Polyadenylate-binding protein 4 OS=Arabidopsis thaliana GN=PAB4 PE=1 SV=1 39 221 5.0E-11
sp|Q28IQ9|CIRBP_XENTR Cold-inducible RNA-binding protein OS=Xenopus tropicalis GN=cirbp PE=2 SV=1 40 114 5.0E-11
sp|Q8VXZ9|R47BP_ARATH Polyadenylate-binding protein RBP47B' OS=Arabidopsis thaliana GN=RBP47B' PE=2 SV=1 38 217 6.0E-11
sp|Q6FXP4|MRD1_CANGA Multiple RNA-binding domain-containing protein 1 OS=Candida glabrata (strain ATCC 2001 / CBS 138 / JCM 3761 / NBRC 0622 / NRRL Y-65) GN=MRD1 PE=3 SV=1 34 214 9.0E-11
sp|Q6BI95|PABP_DEBHA Polyadenylate-binding protein, cytoplasmic and nuclear OS=Debaryomyces hansenii (strain ATCC 36239 / CBS 767 / JCM 1990 / NBRC 0083 / IGC 2968) GN=PAB1 PE=3 SV=2 17 401 9.0E-11
sp|P19683|ROC4_NICSY 31 kDa ribonucleoprotein, chloroplastic OS=Nicotiana sylvestris PE=1 SV=1 40 120 1.0E-10
sp|Q91903|ELAV2_XENLA ELAV-like protein 2 OS=Xenopus laevis GN=elavl2 PE=1 SV=2 35 401 1.0E-10
sp|F4I3B3|RB47A_ARATH Polyadenylate-binding protein RBP47A OS=Arabidopsis thaliana GN=RBP47A PE=2 SV=1 39 217 1.0E-10
sp|Q61474|MSI1H_MOUSE RNA-binding protein Musashi homolog 1 OS=Mus musculus GN=Msi1 PE=1 SV=1 36 230 1.0E-10
sp|Q8K3P4|MSI1H_RAT RNA-binding protein Musashi homolog 1 OS=Rattus norvegicus GN=Msi1 PE=2 SV=1 36 230 1.0E-10
sp|P31209|PABP_SCHPO Polyadenylate-binding protein, cytoplasmic and nuclear OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=pab1 PE=1 SV=2 39 230 2.0E-10
sp|Q6FKG4|PABP_CANGA Polyadenylate-binding protein, cytoplasmic and nuclear OS=Candida glabrata (strain ATCC 2001 / CBS 138 / JCM 3761 / NBRC 0622 / NRRL Y-65) GN=PAB1 PE=3 SV=1 39 401 2.0E-10
sp|Q9H361|PABP3_HUMAN Polyadenylate-binding protein 3 OS=Homo sapiens GN=PABPC3 PE=1 SV=2 39 230 2.0E-10
sp|P19682|ROC3_NICSY 28 kDa ribonucleoprotein, chloroplastic OS=Nicotiana sylvestris PE=1 SV=1 30 120 4.0E-10
sp|P20965|PABPA_XENLA Polyadenylate-binding protein 1-A OS=Xenopus laevis GN=pabpc1-a PE=1 SV=3 39 401 4.0E-10
sp|P27476|NSR1_YEAST Nuclear localization sequence-binding protein OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=NSR1 PE=1 SV=1 30 217 4.0E-10
sp|Q9LEB3|RBP47_NICPL Polyadenylate-binding protein RBP47 OS=Nicotiana plumbaginifolia GN=RBP47 PE=1 SV=1 39 217 4.0E-10
sp|F4HT49|PABP1_ARATH Polyadenylate-binding protein 1 OS=Arabidopsis thaliana GN=PAB1 PE=2 SV=2 39 235 4.0E-10
sp|Q93W34|RP45C_ARATH Polyadenylate-binding protein RBP45C OS=Arabidopsis thaliana GN=RBP45C PE=2 SV=1 6 217 4.0E-10
sp|Q9DED4|CIRBB_XENLA Cold-inducible RNA-binding protein B OS=Xenopus laevis GN=cirbp-b PE=1 SV=1 40 114 5.0E-10
sp|Q05196|PABP5_ARATH Polyadenylate-binding protein 5 OS=Arabidopsis thaliana GN=PAB5 PE=1 SV=3 39 402 5.0E-10
sp|P0CB38|PAB4L_HUMAN Polyadenylate-binding protein 4-like OS=Homo sapiens GN=PABPC4L PE=2 SV=1 27 217 5.0E-10
sp|Q5RC80|RBM39_PONAB RNA-binding protein 39 OS=Pongo abelii GN=RBM39 PE=2 SV=1 38 220 6.0E-10
sp|Q8VH51|RBM39_MOUSE RNA-binding protein 39 OS=Mus musculus GN=Rbm39 PE=1 SV=2 38 220 8.0E-10
sp|Q14498|RBM39_HUMAN RNA-binding protein 39 OS=Homo sapiens GN=RBM39 PE=1 SV=2 38 220 8.0E-10
sp|Q75A83|MRD1_ASHGO Multiple RNA-binding domain-containing protein 1 OS=Ashbya gossypii (strain ATCC 10895 / CBS 109.51 / FGSC 9923 / NRRL Y-1056) GN=MRD1 PE=3 SV=2 5 217 9.0E-10
sp|Q9SAB3|RB45B_ARATH Polyadenylate-binding protein RBP45B OS=Arabidopsis thaliana GN=RBP45B PE=1 SV=1 33 217 9.0E-10
sp|P0CB38|PAB4L_HUMAN Polyadenylate-binding protein 4-like OS=Homo sapiens GN=PABPC4L PE=2 SV=1 39 401 1.0E-09
sp|Q5AJS6|MRD1_CANAL Multiple RNA-binding domain-containing protein 1 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=MRD1 PE=3 SV=1 17 131 1.0E-09
sp|Q86U06|RBM23_HUMAN Probable RNA-binding protein 23 OS=Homo sapiens GN=RBM23 PE=1 SV=1 38 220 1.0E-09
sp|P41891|GAR2_SCHPO Protein gar2 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=gar2 PE=1 SV=2 35 218 1.0E-09
sp|Q13310|PABP4_HUMAN Polyadenylate-binding protein 4 OS=Homo sapiens GN=PABPC4 PE=1 SV=1 39 221 1.0E-09
sp|Q54PB2|MRD1_DICDI Multiple RNA-binding domain-containing protein 1 OS=Dictyostelium discoideum GN=mrd1 PE=3 SV=1 40 217 1.0E-09
sp|Q9LEB4|RBP45_NICPL Polyadenylate-binding protein RBP45 OS=Nicotiana plumbaginifolia GN=RBP45 PE=1 SV=1 38 217 1.0E-09
sp|A3LXL0|PABP_PICST Polyadenylate-binding protein, cytoplasmic and nuclear OS=Scheffersomyces stipitis (strain ATCC 58785 / CBS 6054 / NBRC 10063 / NRRL Y-11545) GN=PAB1 PE=3 SV=1 39 401 2.0E-09
sp|Q9ZQA8|PABP7_ARATH Polyadenylate-binding protein 7 OS=Arabidopsis thaliana GN=PAB7 PE=2 SV=1 39 402 2.0E-09
sp|O43347|MSI1H_HUMAN RNA-binding protein Musashi homolog 1 OS=Homo sapiens GN=MSI1 PE=1 SV=1 36 230 2.0E-09
sp|Q5RF83|CIRBP_PONAB Cold-inducible RNA-binding protein OS=Pongo abelii GN=CIRBP PE=2 SV=1 40 114 2.0E-09
sp|Q14011|CIRBP_HUMAN Cold-inducible RNA-binding protein OS=Homo sapiens GN=CIRBP PE=1 SV=1 40 114 2.0E-09
sp|P31483|TIA1_HUMAN Nucleolysin TIA-1 isoform p40 OS=Homo sapiens GN=TIA1 PE=1 SV=3 40 240 2.0E-09
sp|A5DM21|PABP_PICGU Polyadenylate-binding protein, cytoplasmic and nuclear OS=Meyerozyma guilliermondii (strain ATCC 6260 / CBS 566 / DSM 6381 / JCM 1539 / NBRC 10279 / NRRL Y-324) GN=PAB1 PE=3 SV=2 40 401 3.0E-09
sp|Q4P8R9|PABP_USTMA Polyadenylate-binding protein, cytoplasmic and nuclear OS=Ustilago maydis (strain 521 / FGSC 9021) GN=PAB1 PE=3 SV=1 39 401 3.0E-09
sp|Q8C7E9|CSTFT_MOUSE Cleavage stimulation factor subunit 2 tau variant OS=Mus musculus GN=Cstf2t PE=1 SV=2 38 112 3.0E-09
sp|P49314|ROC2_NICPL 31 kDa ribonucleoprotein, chloroplastic OS=Nicotiana plumbaginifolia PE=2 SV=1 34 120 4.0E-09
sp|Q6CQR6|MRD1_KLULA Multiple RNA-binding domain-containing protein 1 OS=Kluyveromyces lactis (strain ATCC 8585 / CBS 2359 / DSM 70799 / NBRC 1267 / NRRL Y-1140 / WM37) GN=MRD1 PE=3 SV=1 39 217 4.0E-09
sp|P52912|TIA1_MOUSE Nucleolysin TIA-1 OS=Mus musculus GN=Tia1 PE=1 SV=1 40 234 4.0E-09
sp|Q9P3U1|YKX5_SCHPO Uncharacterized RNA-binding protein C328.05 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC328.05 PE=3 SV=3 36 217 4.0E-09
sp|Q74ZS6|PABP_ASHGO Polyadenylate-binding protein, cytoplasmic and nuclear OS=Ashbya gossypii (strain ATCC 10895 / CBS 109.51 / FGSC 9923 / NRRL Y-1056) GN=PAB1 PE=3 SV=1 39 217 4.0E-09
sp|Q9H0L4|CSTFT_HUMAN Cleavage stimulation factor subunit 2 tau variant OS=Homo sapiens GN=CSTF2T PE=1 SV=1 38 112 4.0E-09
sp|Q1ZXC2|PAP1B_DICDI Polyadenylate-binding protein 1-B OS=Dictyostelium discoideum GN=pabpc1B PE=3 SV=1 39 220 4.0E-09
sp|P51990|RO22_XENLA Heterogeneous nuclear ribonucleoprotein A2 homolog 2 OS=Xenopus laevis PE=2 SV=1 35 189 4.0E-09
sp|P33240|CSTF2_HUMAN Cleavage stimulation factor subunit 2 OS=Homo sapiens GN=CSTF2 PE=1 SV=1 38 112 4.0E-09
sp|Q5RDA3|CSTF2_PONAB Cleavage stimulation factor subunit 2 OS=Pongo abelii GN=CSTF2 PE=2 SV=1 38 112 4.0E-09
sp|Q4R4J7|NUCL_MACFA Nucleolin OS=Macaca fascicularis GN=NCL PE=2 SV=3 9 398 5.0E-09
sp|Q8HXM1|CSTF2_BOVIN Cleavage stimulation factor subunit 2 OS=Bos taurus GN=CSTF2 PE=2 SV=1 38 112 5.0E-09
sp|P19338|NUCL_HUMAN Nucleolin OS=Homo sapiens GN=NCL PE=1 SV=3 9 398 5.0E-09
sp|Q5RF26|NUCL_PONAB Nucleolin OS=Pongo abelii GN=NCL PE=2 SV=3 9 398 5.0E-09
sp|Q8BIQ5|CSTF2_MOUSE Cleavage stimulation factor subunit 2 OS=Mus musculus GN=Cstf2 PE=1 SV=2 38 112 5.0E-09
sp|P42731|PABP2_ARATH Polyadenylate-binding protein 2 OS=Arabidopsis thaliana GN=PAB2 PE=1 SV=1 39 221 6.0E-09
sp|Q08937|ROC2_NICSY 29 kDa ribonucleoprotein B, chloroplastic OS=Nicotiana sylvestris PE=2 SV=1 34 120 6.0E-09
sp|Q4VXU2|PAP1L_HUMAN Polyadenylate-binding protein 1-like OS=Homo sapiens GN=PABPC1L PE=2 SV=1 39 212 7.0E-09
sp|A4QUF0|PABP_MAGO7 Polyadenylate-binding protein, cytoplasmic and nuclear OS=Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958) GN=PAB1 PE=3 SV=1 21 381 7.0E-09
sp|P60825|CIRBP_RAT Cold-inducible RNA-binding protein OS=Rattus norvegicus GN=Cirbp PE=2 SV=1 40 114 7.0E-09
sp|P60824|CIRBP_MOUSE Cold-inducible RNA-binding protein OS=Mus musculus GN=Cirbp PE=1 SV=1 40 114 7.0E-09
sp|P60826|CIRBP_CRIGR Cold-inducible RNA-binding protein OS=Cricetulus griseus GN=CIRBP PE=2 SV=1 40 114 7.0E-09
sp|Q9ZUU4|CP29B_ARATH RNA-binding protein CP29B, chloroplastic OS=Arabidopsis thaliana GN=CP29B PE=1 SV=1 143 215 7.0E-09
sp|P0CR16|MRD1_CRYNJ Multiple RNA-binding domain-containing protein 1 OS=Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565) GN=MRD1 PE=3 SV=1 39 231 7.0E-09
sp|P0CR17|MRD1_CRYNB Multiple RNA-binding domain-containing protein 1 OS=Cryptococcus neoformans var. neoformans serotype D (strain B-3501A) GN=MRD1 PE=3 SV=1 39 231 7.0E-09
sp|Q6CSV3|PABP_KLULA Polyadenylate-binding protein, cytoplasmic and nuclear OS=Kluyveromyces lactis (strain ATCC 8585 / CBS 2359 / DSM 70799 / NBRC 1267 / NRRL Y-1140 / WM37) GN=PAB1 PE=3 SV=1 39 230 8.0E-09
sp|Q28GD4|ELAV2_XENTR ELAV-like protein 2 OS=Xenopus tropicalis GN=elavl2 PE=2 SV=2 35 211 8.0E-09
sp|Q7S6N6|PABP_NEUCR Polyadenylate-binding protein, cytoplasmic and nuclear OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=pabp-1 PE=3 SV=1 39 401 8.0E-09
sp|A5DM21|PABP_PICGU Polyadenylate-binding protein, cytoplasmic and nuclear OS=Meyerozyma guilliermondii (strain ATCC 6260 / CBS 566 / DSM 6381 / JCM 1539 / NBRC 10279 / NRRL Y-324) GN=PAB1 PE=3 SV=2 39 217 9.0E-09
sp|Q7JGR2|PABP5_MACMU Polyadenylate-binding protein 5 OS=Macaca mulatta GN=PABPC5 PE=3 SV=1 16 214 9.0E-09
sp|Q9ZR39|U2A2A_NICPL Splicing factor U2af large subunit A OS=Nicotiana plumbaginifolia GN=U2AF65A PE=2 SV=1 38 214 9.0E-09
sp|Q0U1G2|PABP_PHANO Polyadenylate-binding protein, cytoplasmic and nuclear OS=Phaeosphaeria nodorum (strain SN15 / ATCC MYA-4574 / FGSC 10173) GN=PAB1 PE=3 SV=3 39 376 9.0E-09
sp|P60050|PABP5_PONPY Polyadenylate-binding protein 5 OS=Pongo pygmaeus GN=PABPC5 PE=3 SV=1 16 214 1.0E-08
sp|P60049|PABP5_PANTR Polyadenylate-binding protein 5 OS=Pan troglodytes GN=PABPC5 PE=3 SV=1 16 214 1.0E-08
sp|P60048|PABP5_HYLLA Polyadenylate-binding protein 5 OS=Hylobates lar GN=PABPC5 PE=3 SV=1 16 214 1.0E-08
sp|Q96DU9|PABP5_HUMAN Polyadenylate-binding protein 5 OS=Homo sapiens GN=PABPC5 PE=2 SV=1 16 214 1.0E-08
sp|P60047|PABP5_GORGO Polyadenylate-binding protein 5 OS=Gorilla gorilla gorilla GN=PABPC5 PE=3 SV=1 16 214 1.0E-08
sp|P15771|NUCL_CHICK Nucleolin OS=Gallus gallus GN=NCL PE=1 SV=1 38 232 1.0E-08
sp|O93235|CIRBA_XENLA Cold-inducible RNA-binding protein A OS=Xenopus laevis GN=cirbp-a PE=1 SV=2 40 114 1.0E-08
sp|O88569|ROA2_MOUSE Heterogeneous nuclear ribonucleoproteins A2/B1 OS=Mus musculus GN=Hnrnpa2b1 PE=1 SV=2 21 189 1.0E-08
sp|P22626|ROA2_HUMAN Heterogeneous nuclear ribonucleoproteins A2/B1 OS=Homo sapiens GN=HNRNPA2B1 PE=1 SV=2 21 189 1.0E-08
sp|P25555|GBP2_YEAST Single-strand telomeric DNA-binding protein GBP2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=GBP2 PE=1 SV=1 39 214 1.0E-08
sp|Q5RBU8|ROA2_PONAB Heterogeneous nuclear ribonucleoproteins A2/B1 OS=Pongo abelii GN=HNRNPA2B1 PE=2 SV=1 21 189 1.0E-08
sp|P30352|SRSF2_CHICK Serine/arginine-rich splicing factor 2 OS=Gallus gallus GN=SRSF2 PE=2 SV=1 39 114 2.0E-08
sp|A7VJC2|ROA2_RAT Heterogeneous nuclear ribonucleoproteins A2/B1 OS=Rattus norvegicus GN=Hnrnpa2b1 PE=1 SV=1 21 189 2.0E-08
sp|P13383|NUCL_RAT Nucleolin OS=Rattus norvegicus GN=Ncl PE=1 SV=3 36 217 2.0E-08
sp|Q5AI15|PABP_CANAL Polyadenylate-binding protein, cytoplasmic and nuclear OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=PAB1 PE=3 SV=1 39 217 2.0E-08
sp|Q9EPH8|PABP1_RAT Polyadenylate-binding protein 1 OS=Rattus norvegicus GN=Pabpc1 PE=1 SV=1 39 222 2.0E-08
sp|Q5R1W5|SRSF2_PANTR Serine/arginine-rich splicing factor 2 OS=Pan troglodytes GN=SRSF2 PE=2 SV=3 39 114 2.0E-08
sp|P29341|PABP1_MOUSE Polyadenylate-binding protein 1 OS=Mus musculus GN=Pabpc1 PE=1 SV=2 39 222 2.0E-08
sp|P08199|NUCL_MESAU Nucleolin OS=Mesocricetus auratus GN=NCL PE=1 SV=2 36 217 2.0E-08
sp|Q9FGS0|CP31B_ARATH RNA-binding protein CP31B, chloroplastic OS=Arabidopsis thaliana GN=CP31B PE=1 SV=1 30 120 3.0E-08
sp|Q2QKB3|U2A2A_WHEAT Splicing factor U2af large subunit A OS=Triticum aestivum GN=U2AF65A PE=2 SV=1 38 214 3.0E-08
sp|Q9ZR40|U2A2B_NICPL Splicing factor U2af large subunit B OS=Nicotiana plumbaginifolia GN=U2AF65B PE=2 SV=1 22 214 3.0E-08
sp|Q22037|ROA1_CAEEL Heterogeneous nuclear ribonucleoprotein A1 OS=Caenorhabditis elegans GN=hrp-1 PE=1 SV=1 38 210 3.0E-08
sp|P20397|NUCL_XENLA Nucleolin OS=Xenopus laevis GN=ncl PE=2 SV=3 38 217 3.0E-08
sp|Q6IP09|PABPB_XENLA Polyadenylate-binding protein 1-B OS=Xenopus laevis GN=pabpc1-b PE=2 SV=1 33 221 3.0E-08
sp|P11940|PABP1_HUMAN Polyadenylate-binding protein 1 OS=Homo sapiens GN=PABPC1 PE=1 SV=2 39 222 3.0E-08
sp|P61286|PABP1_BOVIN Polyadenylate-binding protein 1 OS=Bos taurus GN=PABPC1 PE=2 SV=1 39 222 3.0E-08
sp|P82277|RRP2_SPIOL 30S ribosomal protein 2, chloroplastic OS=Spinacia oleracea GN=PSRP2 PE=1 SV=1 18 112 4.0E-08
sp|Q4R4J7|NUCL_MACFA Nucleolin OS=Macaca fascicularis GN=NCL PE=2 SV=3 36 217 4.0E-08
sp|P19338|NUCL_HUMAN Nucleolin OS=Homo sapiens GN=NCL PE=1 SV=3 36 217 4.0E-08
sp|Q5RF26|NUCL_PONAB Nucleolin OS=Pongo abelii GN=NCL PE=2 SV=3 36 217 4.0E-08
sp|Q5R8F7|PABP1_PONAB Polyadenylate-binding protein 1 OS=Pongo abelii GN=PABPC1 PE=2 SV=1 39 222 4.0E-08
sp|O23212|U2A2A_ARATH Splicing factor U2af large subunit A OS=Arabidopsis thaliana GN=U2AF65A PE=2 SV=2 22 214 4.0E-08
sp|Q0CR95|PABP_ASPTN Polyadenylate-binding protein, cytoplasmic and nuclear OS=Aspergillus terreus (strain NIH 2624 / FGSC A1156) GN=pab1 PE=3 SV=1 39 217 4.0E-08
sp|Q06A98|SRSF2_PIG Serine/arginine-rich splicing factor 2 OS=Sus scrofa GN=SRSF2 PE=2 SV=1 32 114 4.0E-08
sp|Q13310|PABP4_HUMAN Polyadenylate-binding protein 4 OS=Homo sapiens GN=PABPC4 PE=1 SV=1 39 217 5.0E-08
sp|Q6PDU1|SRSF2_RAT Serine/arginine-rich splicing factor 2 OS=Rattus norvegicus GN=Srsf2 PE=1 SV=3 32 114 5.0E-08
sp|Q62093|SRSF2_MOUSE Serine/arginine-rich splicing factor 2 OS=Mus musculus GN=Srsf2 PE=1 SV=4 32 114 5.0E-08
sp|Q01130|SRSF2_HUMAN Serine/arginine-rich splicing factor 2 OS=Homo sapiens GN=SRSF2 PE=1 SV=4 32 114 5.0E-08
sp|Q3MHR5|SRSF2_BOVIN Serine/arginine-rich splicing factor 2 OS=Bos taurus GN=SRSF2 PE=2 SV=3 32 114 5.0E-08
sp|Q6DEY7|EPAB_XENTR Embryonic polyadenylate-binding protein OS=Xenopus tropicalis GN=epabp PE=2 SV=1 39 217 5.0E-08
sp|Q7SG09|MRD1_NEUCR Multiple RNA-binding domain-containing protein 1 OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=mrd-1 PE=3 SV=1 36 217 5.0E-08
sp|P04147|PABP_YEAST Polyadenylate-binding protein, cytoplasmic and nuclear OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=PAB1 PE=1 SV=4 39 230 6.0E-08
sp|Q98SP8|EPABA_XENLA Embryonic polyadenylate-binding protein A OS=Xenopus laevis GN=epabp-a PE=1 SV=2 39 217 6.0E-08
sp|Q9VVE5|MSIR6_DROME RNA-binding protein Musashi homolog Rbp6 OS=Drosophila melanogaster GN=Rbp6 PE=2 SV=3 35 230 6.0E-08
sp|Q2HJ60|ROA2_BOVIN Heterogeneous nuclear ribonucleoproteins A2/B1 OS=Bos taurus GN=HNRNPA2B1 PE=2 SV=1 38 189 6.0E-08
sp|A1D4K4|PABP_NEOFI Polyadenylate-binding protein, cytoplasmic and nuclear OS=Neosartorya fischeri (strain ATCC 1020 / DSM 3700 / FGSC A1164 / NRRL 181) GN=pab1 PE=3 SV=1 32 380 6.0E-08
sp|Q9M427|UBP1_NICPL Oligouridylate-binding protein 1 OS=Nicotiana plumbaginifolia GN=UBP1 PE=2 SV=1 39 217 7.0E-08
sp|Q9PTX2|CIRBP_LITCT Cold-inducible RNA-binding protein OS=Lithobates catesbeiana GN=cirbp PE=2 SV=1 40 114 7.0E-08
sp|Q05196|PABP5_ARATH Polyadenylate-binding protein 5 OS=Arabidopsis thaliana GN=PAB5 PE=1 SV=3 39 221 8.0E-08
sp|P09405|NUCL_MOUSE Nucleolin OS=Mus musculus GN=Ncl PE=1 SV=2 36 217 9.0E-08
sp|Q4WK03|PABP_ASPFU Polyadenylate-binding protein, cytoplasmic and nuclear OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=pab1 PE=3 SV=1 32 380 9.0E-08
sp|Q08935|ROC1_NICSY 29 kDa ribonucleoprotein A, chloroplastic OS=Nicotiana sylvestris PE=2 SV=1 143 215 1.0E-07
sp|Q4VXU2|PAP1L_HUMAN Polyadenylate-binding protein 1-like OS=Homo sapiens GN=PABPC1L PE=2 SV=1 33 221 1.0E-07
sp|Q5ZJX4|RBM38_CHICK RNA-binding protein 38 OS=Gallus gallus GN=RBM38 PE=2 SV=1 40 142 1.0E-07
sp|Q5JQF8|PAP1M_HUMAN Polyadenylate-binding protein 1-like 2 OS=Homo sapiens GN=PABPC1L2A PE=2 SV=1 39 214 1.0E-07
sp|Q6GR16|EPABB_XENLA Embryonic polyadenylate-binding protein B OS=Xenopus laevis GN=epabp-b PE=2 SV=1 39 217 1.0E-07
sp|P51989|RO21_XENLA Heterogeneous nuclear ribonucleoprotein A2 homolog 1 OS=Xenopus laevis PE=2 SV=1 35 189 1.0E-07
sp|O89086|RBM3_MOUSE RNA-binding protein 3 OS=Mus musculus GN=Rbm3 PE=1 SV=1 36 114 1.0E-07
sp|Q925G0|RBM3_RAT RNA-binding protein 3 OS=Rattus norvegicus GN=Rbm3 PE=1 SV=2 36 119 1.0E-07
sp|Q2QKB4|U2A2B_WHEAT Splicing factor U2af large subunit B OS=Triticum aestivum GN=U2AF65B PE=2 SV=1 25 214 1.0E-07
sp|Q9FXA2|PABP8_ARATH Polyadenylate-binding protein 8 OS=Arabidopsis thaliana GN=PAB8 PE=1 SV=1 39 221 2.0E-07
sp|Q9H361|PABP3_HUMAN Polyadenylate-binding protein 3 OS=Homo sapiens GN=PABPC3 PE=1 SV=2 33 221 2.0E-07
sp|Q9TTV2|ROA2_SAGOE Heterogeneous nuclear ribonucleoproteins A2/B1 OS=Saguinus oedipus GN=HNRNPA2B1 PE=1 SV=1 38 189 2.0E-07
sp|Q1DXH0|PABP_COCIM Polyadenylate-binding protein, cytoplasmic and nuclear OS=Coccidioides immitis (strain RS) GN=PAB1 PE=3 SV=1 39 217 2.0E-07
sp|P09651|ROA1_HUMAN Heterogeneous nuclear ribonucleoprotein A1 OS=Homo sapiens GN=HNRNPA1 PE=1 SV=5 24 210 2.0E-07
sp|W8E7I1|RBM3_CAPHI RNA-binding protein 3 OS=Capra hircus GN=RBM3 PE=2 SV=2 36 119 2.0E-07
sp|P04256|ROA1_RAT Heterogeneous nuclear ribonucleoprotein A1 OS=Rattus norvegicus GN=Hnrnpa1 PE=1 SV=3 24 189 2.0E-07
sp|A5A6H4|ROA1_PANTR Heterogeneous nuclear ribonucleoprotein A1 OS=Pan troglodytes GN=HNRNPA1 PE=2 SV=1 24 189 2.0E-07
sp|P49312|ROA1_MOUSE Heterogeneous nuclear ribonucleoprotein A1 OS=Mus musculus GN=Hnrnpa1 PE=1 SV=2 24 189 2.0E-07
sp|P09867|ROA1_BOVIN Heterogeneous nuclear ribonucleoprotein A1 OS=Bos taurus GN=HNRNPA1 PE=1 SV=2 24 189 2.0E-07
sp|Q76LC6|RBM24_DANRE RNA-binding protein 24 OS=Danio rerio GN=rbm24 PE=2 SV=1 40 114 2.0E-07
sp|Q96DH6|MSI2H_HUMAN RNA-binding protein Musashi homolog 2 OS=Homo sapiens GN=MSI2 PE=1 SV=1 36 222 2.0E-07
sp|F4HT49|PABP1_ARATH Polyadenylate-binding protein 1 OS=Arabidopsis thaliana GN=PAB1 PE=2 SV=2 64 225 3.0E-07
sp|Q5AJS6|MRD1_CANAL Multiple RNA-binding domain-containing protein 1 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=MRD1 PE=3 SV=1 39 217 3.0E-07
sp|P31483|TIA1_HUMAN Nucleolysin TIA-1 isoform p40 OS=Homo sapiens GN=TIA1 PE=1 SV=3 35 220 3.0E-07
sp|P11940|PABP1_HUMAN Polyadenylate-binding protein 1 OS=Homo sapiens GN=PABPC1 PE=1 SV=2 33 221 3.0E-07
sp|P61286|PABP1_BOVIN Polyadenylate-binding protein 1 OS=Bos taurus GN=PABPC1 PE=2 SV=1 33 221 3.0E-07
sp|Q2UK72|PABP_ASPOR Polyadenylate-binding protein, cytoplasmic and nuclear OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) GN=pab1 PE=3 SV=1 32 382 3.0E-07
sp|Q01085|TIAR_HUMAN Nucleolysin TIAR OS=Homo sapiens GN=TIAL1 PE=1 SV=1 40 217 3.0E-07
sp|Q13151|ROA0_HUMAN Heterogeneous nuclear ribonucleoprotein A0 OS=Homo sapiens GN=HNRNPA0 PE=1 SV=1 40 221 3.0E-07
sp|Q15427|SF3B4_HUMAN Splicing factor 3B subunit 4 OS=Homo sapiens GN=SF3B4 PE=1 SV=1 39 222 3.0E-07
sp|Q9LIS2|RBG4_ARATH Glycine-rich RNA-binding protein 4, mitochondrial OS=Arabidopsis thaliana GN=RBG4 PE=2 SV=1 40 117 3.0E-07
sp|P32588|PUB1_YEAST Nuclear and cytoplasmic polyadenylated RNA-binding protein PUB1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=PUB1 PE=1 SV=4 16 217 3.0E-07
sp|Q9CX86|ROA0_MOUSE Heterogeneous nuclear ribonucleoprotein A0 OS=Mus musculus GN=Hnrnpa0 PE=1 SV=1 40 221 3.0E-07
sp|Q6AYL5|SF3B4_RAT Splicing factor 3B subunit 4 OS=Rattus norvegicus GN=Sf3b4 PE=2 SV=1 39 222 3.0E-07
sp|Q8QZY9|SF3B4_MOUSE Splicing factor 3B subunit 4 OS=Mus musculus GN=Sf3b4 PE=1 SV=1 39 222 3.0E-07
sp|Q9BX46|RBM24_HUMAN RNA-binding protein 24 OS=Homo sapiens GN=RBM24 PE=1 SV=1 40 114 3.0E-07
sp|P98179|RBM3_HUMAN RNA-binding protein 3 OS=Homo sapiens GN=RBM3 PE=1 SV=1 36 119 3.0E-07
sp|Q6P8A7|RBM24_XENTR RNA-binding protein 24 OS=Xenopus tropicalis GN=rbm24 PE=2 SV=1 40 114 3.0E-07
sp|O64380|PABP3_ARATH Polyadenylate-binding protein 3 OS=Arabidopsis thaliana GN=PAB3 PE=2 SV=1 39 401 3.0E-07
sp|Q6GQD3|RB24A_XENLA RNA-binding protein 24-A OS=Xenopus laevis GN=rbm24-a PE=2 SV=1 40 114 3.0E-07
sp|Q39061|CP33_ARATH RNA-binding protein CP33, chloroplastic OS=Arabidopsis thaliana GN=CP33 PE=2 SV=1 34 119 4.0E-07
sp|Q5R8F7|PABP1_PONAB Polyadenylate-binding protein 1 OS=Pongo abelii GN=PABPC1 PE=2 SV=1 33 221 4.0E-07
sp|Q5R8F7|PABP1_PONAB Polyadenylate-binding protein 1 OS=Pongo abelii GN=PABPC1 PE=2 SV=1 39 214 4.0E-07
sp|O64380|PABP3_ARATH Polyadenylate-binding protein 3 OS=Arabidopsis thaliana GN=PAB3 PE=2 SV=1 24 221 4.0E-07
sp|Q5ZMA3|RBM24_CHICK RNA-binding protein 24 OS=Gallus gallus GN=RBM24 PE=2 SV=2 40 114 4.0E-07
sp|Q91584|ELAV3_XENLA ELAV-like protein 3 OS=Xenopus laevis GN=elavl3 PE=2 SV=1 35 209 4.0E-07
sp|Q5B630|PABP_EMENI Polyadenylate-binding protein, cytoplasmic and nuclear OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=pab1 PE=2 SV=2 39 217 4.0E-07
sp|Q2GSX8|PABP_CHAGB Polyadenylate-binding protein, cytoplasmic and nuclear OS=Chaetomium globosum (strain ATCC 6205 / CBS 148.51 / DSM 1962 / NBRC 6347 / NRRL 1970) GN=PAB1 PE=3 SV=1 39 401 4.0E-07
sp|Q75A83|MRD1_ASHGO Multiple RNA-binding domain-containing protein 1 OS=Ashbya gossypii (strain ATCC 10895 / CBS 109.51 / FGSC 9923 / NRRL Y-1056) GN=MRD1 PE=3 SV=2 40 131 5.0E-07
sp|P52912|TIA1_MOUSE Nucleolysin TIA-1 OS=Mus musculus GN=Tia1 PE=1 SV=1 35 220 5.0E-07
sp|P0CR16|MRD1_CRYNJ Multiple RNA-binding domain-containing protein 1 OS=Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565) GN=MRD1 PE=3 SV=1 40 111 5.0E-07
sp|P0CR17|MRD1_CRYNB Multiple RNA-binding domain-containing protein 1 OS=Cryptococcus neoformans var. neoformans serotype D (strain B-3501A) GN=MRD1 PE=3 SV=1 40 111 5.0E-07
sp|Q6DEY7|EPAB_XENTR Embryonic polyadenylate-binding protein OS=Xenopus tropicalis GN=epabp PE=2 SV=1 33 221 5.0E-07
sp|Q1DXH0|PABP_COCIM Polyadenylate-binding protein, cytoplasmic and nuclear OS=Coccidioides immitis (strain RS) GN=PAB1 PE=3 SV=1 39 217 5.0E-07
sp|D3Z4I3|RBM24_MOUSE RNA-binding protein 24 OS=Mus musculus GN=Rbm24 PE=3 SV=1 40 114 5.0E-07
sp|O13620|MRD1_SCHPO Multiple RNA-binding domain-containing protein 1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=mrd1 PE=3 SV=1 78 231 5.0E-07
sp|Q60990|RBY1B_MOUSE RNA-binding motif protein, Y chromosome, family 1 member B OS=Mus musculus GN=Rbmy1b PE=2 SV=3 34 116 5.0E-07
sp|Q920Q6|MSI2H_MOUSE RNA-binding protein Musashi homolog 2 OS=Mus musculus GN=Msi2 PE=1 SV=1 36 222 5.0E-07
sp|O80678|UBA2B_ARATH UBP1-associated protein 2B OS=Arabidopsis thaliana GN=UBA2B PE=2 SV=1 38 227 5.0E-07
sp|Q28521|ROA1_MACMU Heterogeneous nuclear ribonucleoprotein A1 OS=Macaca mulatta GN=HNRNPA1 PE=2 SV=3 24 210 5.0E-07
sp|Q2QZL4|U2A2B_ORYSJ Splicing factor U2af large subunit B OS=Oryza sativa subsp. japonica GN=U2AF65B PE=3 SV=2 25 214 5.0E-07
sp|P38922|HRB1_YEAST Protein HRB1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=HRB1 PE=1 SV=2 39 214 5.0E-07
sp|Q9H0Z9|RBM38_HUMAN RNA-binding protein 38 OS=Homo sapiens GN=RBM38 PE=1 SV=2 40 114 5.0E-07
sp|P27476|NSR1_YEAST Nuclear localization sequence-binding protein OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=NSR1 PE=1 SV=1 139 237 6.0E-07
sp|Q4P8R9|PABP_USTMA Polyadenylate-binding protein, cytoplasmic and nuclear OS=Ustilago maydis (strain 521 / FGSC 9021) GN=PAB1 PE=3 SV=1 39 230 6.0E-07
sp|Q9ZUU4|CP29B_ARATH RNA-binding protein CP29B, chloroplastic OS=Arabidopsis thaliana GN=CP29B PE=1 SV=1 40 117 6.0E-07
sp|Q9I8B3|RB24B_XENLA RNA-binding protein 24-B OS=Xenopus laevis GN=rbm24-b PE=2 SV=1 40 114 6.0E-07
sp|A1CRM1|PABP_ASPCL Polyadenylate-binding protein, cytoplasmic and nuclear OS=Aspergillus clavatus (strain ATCC 1007 / CBS 513.65 / DSM 816 / NCTC 3887 / NRRL 1) GN=pab1 PE=3 SV=1 39 377 6.0E-07
sp|P48809|RB27C_DROME Heterogeneous nuclear ribonucleoprotein 27C OS=Drosophila melanogaster GN=Hrb27C PE=1 SV=2 35 208 6.0E-07
sp|P39684|PES4_YEAST Protein PES4 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=PES4 PE=3 SV=2 23 287 7.0E-07
sp|P19684|ROC5_NICSY 33 kDa ribonucleoprotein, chloroplastic OS=Nicotiana sylvestris PE=1 SV=1 21 137 8.0E-07
sp|Q60900|ELAV3_MOUSE ELAV-like protein 3 OS=Mus musculus GN=Elavl3 PE=1 SV=1 35 209 8.0E-07
sp|Q7T3I7|RBM38_XENLA RNA-binding protein 38 OS=Xenopus laevis GN=rbm38 PE=1 SV=2 40 142 8.0E-07
sp|Q9FNR1|RBG3_ARATH Glycine-rich RNA-binding protein 3, mitochondrial OS=Arabidopsis thaliana GN=RBG3 PE=2 SV=1 33 117 8.0E-07
sp|A5DW14|PABP_LODEL Polyadenylate-binding protein, cytoplasmic and nuclear OS=Lodderomyces elongisporus (strain ATCC 11503 / CBS 2605 / JCM 1781 / NBRC 1676 / NRRL YB-4239) GN=PAB1 PE=3 SV=1 39 240 8.0E-07
sp|P70318|TIAR_MOUSE Nucleolysin TIAR OS=Mus musculus GN=Tial1 PE=1 SV=1 40 217 9.0E-07
sp|Q6FKG4|PABP_CANGA Polyadenylate-binding protein, cytoplasmic and nuclear OS=Candida glabrata (strain ATCC 2001 / CBS 138 / JCM 3761 / NBRC 0622 / NRRL Y-65) GN=PAB1 PE=3 SV=1 39 230 1.0E-06
sp|A3LXL0|PABP_PICST Polyadenylate-binding protein, cytoplasmic and nuclear OS=Scheffersomyces stipitis (strain ATCC 58785 / CBS 6054 / NBRC 10063 / NRRL Y-11545) GN=PAB1 PE=3 SV=1 39 240 1.0E-06
sp|Q9ZQA8|PABP7_ARATH Polyadenylate-binding protein 7 OS=Arabidopsis thaliana GN=PAB7 PE=2 SV=1 39 233 1.0E-06
sp|Q9EPH8|PABP1_RAT Polyadenylate-binding protein 1 OS=Rattus norvegicus GN=Pabpc1 PE=1 SV=1 33 221 1.0E-06
sp|P29341|PABP1_MOUSE Polyadenylate-binding protein 1 OS=Mus musculus GN=Pabpc1 PE=1 SV=2 33 221 1.0E-06
sp|P20397|NUCL_XENLA Nucleolin OS=Xenopus laevis GN=ncl PE=2 SV=3 29 236 1.0E-06
sp|Q98SP8|EPABA_XENLA Embryonic polyadenylate-binding protein A OS=Xenopus laevis GN=epabp-a PE=1 SV=2 33 221 1.0E-06
sp|A5DW14|PABP_LODEL Polyadenylate-binding protein, cytoplasmic and nuclear OS=Lodderomyces elongisporus (strain ATCC 11503 / CBS 2605 / JCM 1781 / NBRC 1676 / NRRL YB-4239) GN=PAB1 PE=3 SV=1 24 220 1.0E-06
sp|Q08473|SQD_DROME RNA-binding protein squid OS=Drosophila melanogaster GN=sqd PE=1 SV=3 26 208 1.0E-06
sp|Q6DIV4|RBM38_XENTR RNA-binding protein 38 OS=Xenopus tropicalis GN=rbm38 PE=2 SV=1 40 142 1.0E-06
sp|Q32P51|RA1L2_HUMAN Heterogeneous nuclear ribonucleoprotein A1-like 2 OS=Homo sapiens GN=HNRNPA1L2 PE=2 SV=2 38 189 1.0E-06
sp|P51992|RO32_XENLA Heterogeneous nuclear ribonucleoprotein A3 homolog 2 OS=Xenopus laevis PE=2 SV=1 12 189 1.0E-06
sp|P70372|ELAV1_MOUSE ELAV-like protein 1 OS=Mus musculus GN=Elavl1 PE=1 SV=2 25 219 1.0E-06
sp|Q06106|MRD1_YEAST Multiple RNA-binding domain-containing protein 1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=MRD1 PE=1 SV=1 33 131 2.0E-06
sp|Q08935|ROC1_NICSY 29 kDa ribonucleoprotein A, chloroplastic OS=Nicotiana sylvestris PE=2 SV=1 40 117 2.0E-06
sp|P20965|PABPA_XENLA Polyadenylate-binding protein 1-A OS=Xenopus laevis GN=pabpc1-a PE=1 SV=3 33 221 2.0E-06
sp|Q6DEY7|EPAB_XENTR Embryonic polyadenylate-binding protein OS=Xenopus tropicalis GN=epabp PE=2 SV=1 39 214 2.0E-06
sp|Q01085|TIAR_HUMAN Nucleolysin TIAR OS=Homo sapiens GN=TIAL1 PE=1 SV=1 36 220 2.0E-06
sp|Q9SEU4|SRC33_ARATH Serine/arginine-rich SC35-like splicing factor SCL33 OS=Arabidopsis thaliana GN=SCL33 PE=1 SV=1 35 123 2.0E-06
sp|Q84TH4|SR45A_ARATH Serine/arginine-rich splicing factor SR45a OS=Arabidopsis thaliana GN=SR45A PE=1 SV=1 39 114 2.0E-06
sp|O35698|RBY1A_MOUSE RNA-binding motif protein, Y chromosome, family 1 member A1 OS=Mus musculus GN=Rbmy1a1 PE=1 SV=2 34 116 2.0E-06
sp|Q44554|RBPB_NOSS1 Putative RNA-binding protein RbpB OS=Nostoc sp. (strain PCC 7120 / UTEX 2576) GN=rbpB PE=3 SV=3 39 117 2.0E-06
sp|Q28FX0|ELAV3_XENTR ELAV-like protein 3 OS=Xenopus tropicalis GN=elavl3 PE=2 SV=1 35 206 2.0E-06
sp|Q6DJI9|ZCRB1_XENLA Zinc finger CCHC-type and RNA-binding motif-containing protein 1 OS=Xenopus laevis GN=zcrb1 PE=2 SV=1 343 403 2.0E-06
sp|Q6XE24|RBMS3_HUMAN RNA-binding motif, single-stranded-interacting protein 3 OS=Homo sapiens GN=RBMS3 PE=1 SV=1 39 207 2.0E-06
sp|Q5RBD3|RBMS3_PONAB RNA-binding motif, single-stranded-interacting protein 3 OS=Pongo abelii GN=RBMS3 PE=2 SV=1 39 207 2.0E-06
sp|P17130|ROA1_XENLA Heterogeneous nuclear ribonucleoproteins A1 homolog OS=Xenopus laevis GN=hnrnpa1 PE=2 SV=1 35 189 2.0E-06
sp|O97018|SXL_CHRRU Sex-lethal homolog OS=Chrysomya rufifacies GN=SXL PE=2 SV=2 39 203 2.0E-06
sp|Q44560|RBPA_NOSS1 Putative RNA-binding protein RbpA OS=Nostoc sp. (strain PCC 7120 / UTEX 2576) GN=rbpA PE=3 SV=3 39 118 2.0E-06
sp|Q14576|ELAV3_HUMAN ELAV-like protein 3 OS=Homo sapiens GN=ELAVL3 PE=2 SV=3 35 209 2.0E-06
sp|O13759|CSX1_SCHPO RNA-binding post-transcriptional regulator csx1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=csx1 PE=1 SV=1 39 216 2.0E-06
sp|P37838|NOP4_YEAST Nucleolar protein 4 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=NOP4 PE=1 SV=1 39 111 3.0E-06
sp|P49313|ROC1_NICPL 30 kDa ribonucleoprotein, chloroplastic OS=Nicotiana plumbaginifolia PE=2 SV=1 40 117 3.0E-06
sp|Q4PC17|MRD1_USTMA Multiple RNA-binding domain-containing protein 1 OS=Ustilago maydis (strain 521 / FGSC 9021) GN=MRD1 PE=3 SV=1 33 111 3.0E-06
sp|Q74ZS6|PABP_ASHGO Polyadenylate-binding protein, cytoplasmic and nuclear OS=Ashbya gossypii (strain ATCC 10895 / CBS 109.51 / FGSC 9923 / NRRL Y-1056) GN=PAB1 PE=3 SV=1 39 230 3.0E-06
sp|P15771|NUCL_CHICK Nucleolin OS=Gallus gallus GN=NCL PE=1 SV=1 36 217 3.0E-06
sp|Q6IP09|PABPB_XENLA Polyadenylate-binding protein 1-B OS=Xenopus laevis GN=pabpc1-b PE=2 SV=1 39 214 3.0E-06
sp|Q0CR95|PABP_ASPTN Polyadenylate-binding protein, cytoplasmic and nuclear OS=Aspergillus terreus (strain NIH 2624 / FGSC A1156) GN=pab1 PE=3 SV=1 39 382 3.0E-06
sp|A5DW14|PABP_LODEL Polyadenylate-binding protein, cytoplasmic and nuclear OS=Lodderomyces elongisporus (strain ATCC 11503 / CBS 2605 / JCM 1781 / NBRC 1676 / NRRL YB-4239) GN=PAB1 PE=3 SV=1 39 217 3.0E-06
sp|Q54BM2|PAP1A_DICDI Polyadenylate-binding protein 1-A OS=Dictyostelium discoideum GN=pabpc1A PE=1 SV=1 39 214 3.0E-06
sp|B4KX02|SHEP_DROMO Protein alan shepard OS=Drosophila mojavensis GN=shep PE=3 SV=1 39 209 3.0E-06
sp|P21187|PABP_DROME Polyadenylate-binding protein OS=Drosophila melanogaster GN=pAbp PE=1 SV=3 39 214 3.0E-06
sp|P21187|PABP_DROME Polyadenylate-binding protein OS=Drosophila melanogaster GN=pAbp PE=1 SV=3 39 221 3.0E-06
sp|P42696|RBM34_HUMAN RNA-binding protein 34 OS=Homo sapiens GN=RBM34 PE=1 SV=2 12 228 3.0E-06
sp|Q15717|ELAV1_HUMAN ELAV-like protein 1 OS=Homo sapiens GN=ELAVL1 PE=1 SV=2 25 219 3.0E-06
sp|Q10422|YDC1_SCHPO Uncharacterized RNA-binding protein C25G10.01 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC25G10.01 PE=1 SV=1 40 116 3.0E-06
sp|Q74ZS6|PABP_ASHGO Polyadenylate-binding protein, cytoplasmic and nuclear OS=Ashbya gossypii (strain ATCC 10895 / CBS 109.51 / FGSC 9923 / NRRL Y-1056) GN=PAB1 PE=3 SV=1 39 220 4.0E-06
sp|Q9ZUU4|CP29B_ARATH RNA-binding protein CP29B, chloroplastic OS=Arabidopsis thaliana GN=CP29B PE=1 SV=1 333 397 4.0E-06
sp|Q6GR16|EPABB_XENLA Embryonic polyadenylate-binding protein B OS=Xenopus laevis GN=epabp-b PE=2 SV=1 33 221 4.0E-06
sp|P51968|RO31_XENLA Heterogeneous nuclear ribonucleoprotein A3 homolog 1 OS=Xenopus laevis PE=2 SV=1 12 208 4.0E-06
sp|Q8BWL5|RBMS3_MOUSE RNA-binding motif, single-stranded-interacting protein 3 OS=Mus musculus GN=Rbms3 PE=2 SV=2 39 207 4.0E-06
sp|Q9WX37|RBPE_NOSS1 Putative RNA-binding protein RbpE OS=Nostoc sp. (strain PCC 7120 / UTEX 2576) GN=rbpE PE=3 SV=3 39 128 4.0E-06
sp|P21522|ROA1_SCHAM Heterogeneous nuclear ribonucleoprotein A1, A2/B1 homolog OS=Schistocerca americana GN=HNRNP PE=2 SV=1 38 109 4.0E-06
sp|P49313|ROC1_NICPL 30 kDa ribonucleoprotein, chloroplastic OS=Nicotiana plumbaginifolia PE=2 SV=1 143 215 5.0E-06
sp|Q56JZ7|ZCRB1_BOVIN Zinc finger CCHC-type and RNA-binding motif-containing protein 1 OS=Bos taurus GN=ZCRB1 PE=2 SV=1 343 480 5.0E-06
sp|Q96EP5|DAZP1_HUMAN DAZ-associated protein 1 OS=Homo sapiens GN=DAZAP1 PE=1 SV=1 35 208 5.0E-06
sp|Q9JII5|DAZP1_MOUSE DAZ-associated protein 1 OS=Mus musculus GN=Dazap1 PE=1 SV=2 35 208 6.0E-06
sp|Q6CDH3|PABP_YARLI Polyadenylate-binding protein, cytoplasmic and nuclear OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=PAB1 PE=3 SV=1 16 220 6.0E-06
sp|Q6IP09|PABPB_XENLA Polyadenylate-binding protein 1-B OS=Xenopus laevis GN=pabpc1-b PE=2 SV=1 39 222 7.0E-06
sp|Q98SJ2|DAZP1_XENLA DAZ-associated protein 1 OS=Xenopus laevis GN=dazap1 PE=1 SV=1 35 208 7.0E-06
sp|Q99729|ROAA_HUMAN Heterogeneous nuclear ribonucleoprotein A/B OS=Homo sapiens GN=HNRNPAB PE=1 SV=2 40 200 7.0E-06
sp|Q13310|PABP4_HUMAN Polyadenylate-binding protein 4 OS=Homo sapiens GN=PABPC4 PE=1 SV=1 39 214 8.0E-06
sp|Q6CQR6|MRD1_KLULA Multiple RNA-binding domain-containing protein 1 OS=Kluyveromyces lactis (strain ATCC 8585 / CBS 2359 / DSM 70799 / NBRC 1267 / NRRL Y-1140 / WM37) GN=MRD1 PE=3 SV=1 33 131 1.0E-05
sp|P21187|PABP_DROME Polyadenylate-binding protein OS=Drosophila melanogaster GN=pAbp PE=1 SV=3 39 226 1.0E-05
[Show less]

GO

GO Term Description Terminal node
GO:0003723 RNA binding Yes
GO:0003674 molecular_function No
GO:0005488 binding No
GO:1901363 heterocyclic compound binding No
GO:0097159 organic cyclic compound binding No
GO:0003676 nucleic acid binding No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 11 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >OphauB2|7146
MSTPKNHRKRQRSLVEDDAATIEAQDQAAKKPRVDEPRSIFVRSLPAKATDESLADFFSQHFAVKHATVVLDQAT
KQSRGYGFVTFADAQDASDAQKALDKAIWDGRCLRVDLAERRHRKAADDTANSLPLVSRKPQFEKPPKLIIRNLP
WSIKTSEQLAHLFQSFGKVKFADLPQSKGKLKGFGFVTLRGKANAEKALQCINGKEVDGRTLAVDWAVDKETWDK
QNAAQKGNEPDDHEPDESDDEHEQDEPEASSSEADADKEPLASSQKKQDPDLDDDLANFIKNHMENLEDESDNDD
DDDDDDDDQDDGDARDDDDQEDDATQPQGQNKPPHRQSTDNSSTIFVRNLPFTTTDEQLGALFASFGHIRYARVV
MDKVTDRPAGTGFVCFVNEADAKKCIKGAPRPNLRASRGKQSLLLDEASDPSGTYTLDGRLLQVAQAVAKQEAAN
LAETALSKRREKDKRRLFLLSEGSIGRASPLFNLLTPAEIQMRQTSTAQRKKMVQKNPSLHLSLTRLAVRNIPRN
IGAKELKELARKAIVGFAQDVKDGRRQPLSKEEKARDGKDAKERERQRKLKGKGIVRQAKIVFESEQGSKVAEKT
GAGKSRGYGFIEYSSHHWALMGLRYLNGYQMQGDNGKKQRLIVEFAIENAQVVQRRRAAEEKSAQAMKTRNQVAA
AAAKAEGSDEGVEDAHGEDADASKMRKNIKKGKGKGKGKDQPKYKKDGGAVANKPRGQTIKDQHQDKGDETDSKA
KRSDVKQTLIARKRLMRKKKAKARS*
Coding >OphauB2|7146
ATGTCAACGCCCAAGAACCATCGCAAGCGGCAACGCTCACTAGTCGAAGACGACGCTGCAACAATTGAAGCACAG
GATCAAGCGGCCAAGAAGCCCCGCGTCGACGAGCCAAGGTCCATCTTTGTTCGATCGCTGCCCGCAAAGGCTACC
GATGAGAGCCTCGCCGACTTCTTTTCGCAACACTTTGCCGTCAAACATGCCACAGTTGTGCTAGACCAAGCCACA
AAACAGTCTCGAGGCTACGGTTTCGTCACCTTTGCCGACGCCCAAGATGCTTCCGACGCCCAAAAGGCCCTGGAC
AAGGCCATCTGGGACGGACGATGCCTTCGCGTCGATTTGGCCGAGCGTCGCCATCGTAAAGCCGCAGACGACACT
GCAAACTCTCTCCCTTTAGTTTCCCGAAAGCCTCAGTTTGAGAAGCCTCCCAAACTAATTATTCGAAACTTGCCC
TGGAGCATCAAGACGTCGGAACAGCTGGCACATCTCTTCCAAAGCTTTGGCAAGGTCAAATTTGCCGATTTGCCC
CAGAGCAAGGGCAAGCTCAAGGGGTTTGGCTTTGTCACTCTCCGCGGAAAAGCCAATGCCGAGAAGGCGCTGCAA
TGCATCAATGGGAAAGAGGTGGATGGCAGGACTCTGGCCGTTGACTGGGCTGTTGACAAGGAGACTTGGGACAAG
CAAAATGCCGCGCAAAAAGGCAACGAGCCAGACGACCATGAGCCAGACGAGTCTGATGACGAGCATGAGCAAGAC
GAGCCCGAAGCCTCATCGTCTGAGGCCGACGCCGACAAGGAGCCGCTGGCTTCATCCCAAAAGAAACAGGACCCA
GATTTGGACGATGATCTCGCAAATTTTATCAAAAATCACATGGAAAACCTCGAGGATGAGTCTGACAATGACGAT
GATGACGACGACGACGACGACGACCAAGATGACGGCGACGCCCGAGATGACGACGACCAAGAGGACGATGCTACC
CAGCCTCAAGGCCAAAATAAGCCCCCACATCGTCAAAGCACTGATAATTCTTCGACTATATTTGTTCGTAATCTT
CCATTCACAACAACTGATGAGCAACTCGGAGCTTTATTTGCAAGCTTTGGTCACATAAGATATGCCAGAGTTGTC
ATGGACAAGGTCACGGATAGGCCAGCTGGAACTGGCTTTGTCTGCTTCGTAAACGAAGCCGACGCCAAGAAGTGC
ATCAAGGGAGCACCTCGGCCCAACCTGCGCGCGTCACGCGGAAAGCAGTCACTTCTACTTGATGAGGCGTCCGAC
CCCAGTGGCACGTATACTCTGGATGGTCGCCTGTTACAAGTGGCTCAGGCAGTGGCCAAGCAAGAGGCGGCCAAT
CTAGCAGAAACGGCACTCTCCAAACGCAGGGAAAAGGACAAACGAAGGCTTTTCTTGCTTTCAGAGGGCTCTATT
GGTCGGGCTTCTCCTCTCTTCAACCTGTTGACACCAGCAGAGATACAGATGCGGCAGACAAGCACGGCACAGAGG
AAAAAGATGGTGCAGAAAAACCCGAGTCTGCATCTGAGCTTGACACGACTTGCTGTACGCAACATTCCGCGCAAC
ATTGGGGCAAAGGAGCTAAAGGAGCTGGCGCGCAAAGCTATTGTAGGCTTTGCACAAGACGTCAAAGACGGCCGA
CGGCAGCCCCTTTCCAAAGAGGAGAAGGCGCGAGATGGTAAAGATGCCAAGGAGCGTGAGCGCCAGCGCAAGCTC
AAGGGCAAAGGCATTGTTCGCCAGGCAAAAATTGTCTTTGAAAGCGAGCAAGGGTCCAAGGTGGCAGAAAAGACG
GGCGCAGGCAAAAGTCGTGGCTACGGCTTCATTGAATACTCATCACACCACTGGGCCCTCATGGGTCTGCGCTAC
CTCAACGGCTACCAGATGCAAGGCGACAATGGCAAAAAACAGCGGCTGATTGTCGAGTTTGCCATTGAGAATGCC
CAGGTCGTGCAGCGGAGGCGGGCCGCCGAGGAGAAATCGGCACAGGCCATGAAGACCAGAAACCAAGTCGCTGCT
GCTGCTGCAAAAGCAGAGGGCAGCGACGAAGGGGTAGAAGACGCGCACGGGGAGGATGCTGATGCTTCCAAGATG
AGGAAGAACATCAAAAAGGGCAAGGGCAAGGGCAAGGGCAAGGATCAACCCAAGTATAAAAAGGATGGCGGTGCC
GTCGCCAACAAGCCGCGGGGGCAGACTATAAAGGATCAGCACCAGGACAAGGGCGATGAAACGGATTCAAAGGCC
AAGAGAAGCGACGTCAAGCAAACGCTGATTGCGCGCAAGAGACTGATGCGCAAAAAGAAGGCAAAAGCAAGGAGC
TAA
Transcript >OphauB2|7146
ATGTCAACGCCCAAGAACCATCGCAAGCGGCAACGCTCACTAGTCGAAGACGACGCTGCAACAATTGAAGCACAG
GATCAAGCGGCCAAGAAGCCCCGCGTCGACGAGCCAAGGTCCATCTTTGTTCGATCGCTGCCCGCAAAGGCTACC
GATGAGAGCCTCGCCGACTTCTTTTCGCAACACTTTGCCGTCAAACATGCCACAGTTGTGCTAGACCAAGCCACA
AAACAGTCTCGAGGCTACGGTTTCGTCACCTTTGCCGACGCCCAAGATGCTTCCGACGCCCAAAAGGCCCTGGAC
AAGGCCATCTGGGACGGACGATGCCTTCGCGTCGATTTGGCCGAGCGTCGCCATCGTAAAGCCGCAGACGACACT
GCAAACTCTCTCCCTTTAGTTTCCCGAAAGCCTCAGTTTGAGAAGCCTCCCAAACTAATTATTCGAAACTTGCCC
TGGAGCATCAAGACGTCGGAACAGCTGGCACATCTCTTCCAAAGCTTTGGCAAGGTCAAATTTGCCGATTTGCCC
CAGAGCAAGGGCAAGCTCAAGGGGTTTGGCTTTGTCACTCTCCGCGGAAAAGCCAATGCCGAGAAGGCGCTGCAA
TGCATCAATGGGAAAGAGGTGGATGGCAGGACTCTGGCCGTTGACTGGGCTGTTGACAAGGAGACTTGGGACAAG
CAAAATGCCGCGCAAAAAGGCAACGAGCCAGACGACCATGAGCCAGACGAGTCTGATGACGAGCATGAGCAAGAC
GAGCCCGAAGCCTCATCGTCTGAGGCCGACGCCGACAAGGAGCCGCTGGCTTCATCCCAAAAGAAACAGGACCCA
GATTTGGACGATGATCTCGCAAATTTTATCAAAAATCACATGGAAAACCTCGAGGATGAGTCTGACAATGACGAT
GATGACGACGACGACGACGACGACCAAGATGACGGCGACGCCCGAGATGACGACGACCAAGAGGACGATGCTACC
CAGCCTCAAGGCCAAAATAAGCCCCCACATCGTCAAAGCACTGATAATTCTTCGACTATATTTGTTCGTAATCTT
CCATTCACAACAACTGATGAGCAACTCGGAGCTTTATTTGCAAGCTTTGGTCACATAAGATATGCCAGAGTTGTC
ATGGACAAGGTCACGGATAGGCCAGCTGGAACTGGCTTTGTCTGCTTCGTAAACGAAGCCGACGCCAAGAAGTGC
ATCAAGGGAGCACCTCGGCCCAACCTGCGCGCGTCACGCGGAAAGCAGTCACTTCTACTTGATGAGGCGTCCGAC
CCCAGTGGCACGTATACTCTGGATGGTCGCCTGTTACAAGTGGCTCAGGCAGTGGCCAAGCAAGAGGCGGCCAAT
CTAGCAGAAACGGCACTCTCCAAACGCAGGGAAAAGGACAAACGAAGGCTTTTCTTGCTTTCAGAGGGCTCTATT
GGTCGGGCTTCTCCTCTCTTCAACCTGTTGACACCAGCAGAGATACAGATGCGGCAGACAAGCACGGCACAGAGG
AAAAAGATGGTGCAGAAAAACCCGAGTCTGCATCTGAGCTTGACACGACTTGCTGTACGCAACATTCCGCGCAAC
ATTGGGGCAAAGGAGCTAAAGGAGCTGGCGCGCAAAGCTATTGTAGGCTTTGCACAAGACGTCAAAGACGGCCGA
CGGCAGCCCCTTTCCAAAGAGGAGAAGGCGCGAGATGGTAAAGATGCCAAGGAGCGTGAGCGCCAGCGCAAGCTC
AAGGGCAAAGGCATTGTTCGCCAGGCAAAAATTGTCTTTGAAAGCGAGCAAGGGTCCAAGGTGGCAGAAAAGACG
GGCGCAGGCAAAAGTCGTGGCTACGGCTTCATTGAATACTCATCACACCACTGGGCCCTCATGGGTCTGCGCTAC
CTCAACGGCTACCAGATGCAAGGCGACAATGGCAAAAAACAGCGGCTGATTGTCGAGTTTGCCATTGAGAATGCC
CAGGTCGTGCAGCGGAGGCGGGCCGCCGAGGAGAAATCGGCACAGGCCATGAAGACCAGAAACCAAGTCGCTGCT
GCTGCTGCAAAAGCAGAGGGCAGCGACGAAGGGGTAGAAGACGCGCACGGGGAGGATGCTGATGCTTCCAAGATG
AGGAAGAACATCAAAAAGGGCAAGGGCAAGGGCAAGGGCAAGGATCAACCCAAGTATAAAAAGGATGGCGGTGCC
GTCGCCAACAAGCCGCGGGGGCAGACTATAAAGGATCAGCACCAGGACAAGGGCGATGAAACGGATTCAAAGGCC
AAGAGAAGCGACGTCAAGCAAACGCTGATTGCGCGCAAGAGACTGATGCGCAAAAAGAAGGCAAAAGCAAGGAGC
TAA
Gene >OphauB2|7146
ATGTCAACGCCCAAGAACCATCGCAAGCGGCAACGCTCACTAGTCGAAGACGACGCTGCAACAATTGAAGCACAG
GATCAAGCGGCCAAGAAGCCCCGCGTCGACGAGCCAAGGTCCATCTTTGTTCGATCGCTGCCCGCAAAGGCTACC
GATGAGAGCCTCGCCGACTTCTTTTCGCAACACTTTGCCGTCAAACATGCCACAGTTGTGCTAGACCAAGCCACA
AAACAGTCTCGAGGCTACGGTTTCGTCACCTTTGCCGACGCCCAAGATGCTTCCGACGCCCAAAAGGCCCTGGAC
AAGGCCATCTGGGACGGACGATGCCTTCGCGTCGATTTGGCCGAGCGTCGCCATCGTAAAGCCGCAGACGACACT
GCAAACTCTCTCCCTTTAGTTTCCCGAAAGCCTCAGTTTGAGAAGCCTCCCAAACTAATTATTCGAAACTTGCCC
TGGAGCATCAAGACGTCGGAACAGCTGGCACATCTCTTCCAAAGCTTTGGCAAGGTCAAATTTGCCGATTTGCCC
CAGAGCAAGGGCAAGCTCAAGGGGTTTGGCTTTGTCACTCTCCGCGGAAAAGCCAATGCCGAGAAGGCGCTGCAA
TGCATCAATGGGAAAGAGGTGGATGGCAGGACTCTGGCCGTTGACTGGGCTGTTGACAAGGAGACTTGGGACAAG
CAAAATGCCGCGCAAAAAGGCAACGAGCCAGACGACCATGAGCCAGACGAGTCTGATGACGAGCATGAGCAAGAC
GAGCCCGAAGCCTCATCGTCTGAGGCCGACGCCGACAAGGAGCCGCTGGCTTCATCCCAAAAGAAACAGGACCCA
GATTTGGACGATGATCTCGCAAATTTTATCAAAAATCACATGGAAAACCTCGAGGATGAGTCTGACAATGACGAT
GATGACGACGACGACGACGACGACCAAGATGACGGCGACGCCCGAGATGACGACGACCAAGAGGACGATGCTACC
CAGCCTCAAGGCCAAAATAAGCCCCCACATCGTCAAAGCACTGATAATTCTTCGACTATATTTGTTCGTAATCTT
CCATTCACAACAACTGATGAGCAACTCGGAGCTTTATTTGCAAGCTTTGGTCACATAAGATATGCCAGAGTTGTC
ATGGACAAGGTCACGGATAGGCCAGCTGGAACTGGCTTTGTCTGCTTCGTAAACGAAGCCGACGCCAAGAAGTGC
ATCAAGGGAGCACCTCGGCCCAACCTGCGCGCGTCACGCGGAAAGCAGTCACTTCTACTTGATGAGGCGTCCGAC
CCCAGTGGCACGTATACTCTGGATGGTCGCCTGTTACAAGTGGCTCAGGCAGTGGCCAAGCAAGAGGCGGCCAAT
CTAGCAGAAACGGCACTCTCCAAACGCAGGGAAAAGGACAAACGAAGGCTTTTCTTGCTTTCAGAGGGCTCTATT
GGTCGGGCTTCTCCTCTCTTCAACCTGTTGACACCAGCAGAGATACAGATGCGGCAGACAAGCACGGCACAGAGG
AAAAAGATGGTGCAGAAAAACCCGAGTCTGCATCTGAGCTTGACACGACTTGCTGTACGCAACATTCCGCGCAAC
ATTGGGGCAAAGGAGCTAAAGGAGCTGGCGCGCAAAGCTATTGTAGGCTTTGCACAAGACGTCAAAGACGGCCGA
CGGCAGCCCCTTTCCAAAGAGGAGAAGGCGCGAGATGGTAAAGATGCCAAGGAGCGTGAGCGCCAGCGCAAGCTC
AAGGGCAAAGGCATTGTTCGCCAGGCAAAAATTGTCTTTGAAAGCGAGCAAGGGTCCAAGGTGGCAGAAAAGACG
GGCGCAGGCAAAAGTCGTGGCTACGGCTTCATTGAATACTCATCACACCACTGGGCCCTCATGGGTCTGCGCTAC
CTCAACGGCTACCAGATGCAAGGCGACAATGGCAAAAAACAGCGGCTGATTGTCGAGTTTGCCATTGAGAATGCC
CAGGTCGTGCAGCGGAGGCGGGCCGCCGAGGAGAAATCGGCACAGGCCATGAAGACCAGAAACCAAGTCGCTGCT
GCTGCTGCAAAAGCAGAGGGCAGCGACGAAGGGGTAGAAGACGCGCACGGGGAGGATGCTGATGCTTCCAAGATG
AGGAAGAACATCAAAAAGGGCAAGGGCAAGGGCAAGGGCAAGGATCAACCCAAGTATAAAAAGGATGGCGGTGCC
GTCGCCAACAAGCCGCGGGGGCAGACTATAAAGGATCAGCACCAGGACAAGGGCGATGAAACGGATTCAAAGGCC
AAGAGAAGCGACGTCAAGCAAACGCTGATTGCGCGCAAGAGACTGATGCGCAAAAAGAAGGCAAAAGCAAGGAGC
TAA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail