Fungal Genomics

at Utrecht University

General Properties

Protein IDOphauB2|7144
Gene name
LocationContig_72:26520..29466
Strand+
Gene length (bp)2946
Transcript length (bp)2577
Coding sequence length (bp)2577
Protein length (aa) 859

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF19316 PIGO_PIGG GPI ethanolamine phosphate transferase membrane region 4.6E-153 433 855
PF01663 Phosphodiest Type I phosphodiesterase / nucleotide pyrophosphatase 4.0E-09 179 260
PF00884 Sulfatase Sulfatase 6.9E-06 225 319

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q2U9J2|GPI7_ASPOR GPI ethanolamine phosphate transferase 2 OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) GN=las21 PE=3 SV=2 5 844 0.0E+00
sp|Q4WDM5|GPI7_ASPFU GPI ethanolamine phosphate transferase 2 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=las21 PE=2 SV=1 5 844 0.0E+00
sp|Q8TGB2|GPI7_CANAL GPI ethanolamine phosphate transferase 2 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=LAS21 PE=3 SV=2 14 848 4.0E-160
sp|Q6C7Q6|GPI7_YARLI GPI ethanolamine phosphate transferase 2 OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=LAS21 PE=3 SV=1 15 856 3.0E-159
sp|Q6BZ57|GPI7_DEBHA GPI ethanolamine phosphate transferase 2 OS=Debaryomyces hansenii (strain ATCC 36239 / CBS 767 / JCM 1990 / NBRC 0083 / IGC 2968) GN=LAS21 PE=3 SV=2 18 843 8.0E-148
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q2U9J2|GPI7_ASPOR GPI ethanolamine phosphate transferase 2 OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) GN=las21 PE=3 SV=2 5 844 0.0E+00
sp|Q4WDM5|GPI7_ASPFU GPI ethanolamine phosphate transferase 2 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=las21 PE=2 SV=1 5 844 0.0E+00
sp|Q8TGB2|GPI7_CANAL GPI ethanolamine phosphate transferase 2 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=LAS21 PE=3 SV=2 14 848 4.0E-160
sp|Q6C7Q6|GPI7_YARLI GPI ethanolamine phosphate transferase 2 OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=LAS21 PE=3 SV=1 15 856 3.0E-159
sp|Q6BZ57|GPI7_DEBHA GPI ethanolamine phosphate transferase 2 OS=Debaryomyces hansenii (strain ATCC 36239 / CBS 767 / JCM 1990 / NBRC 0083 / IGC 2968) GN=LAS21 PE=3 SV=2 18 843 8.0E-148
sp|Q758B8|GPI7_ASHGO GPI ethanolamine phosphate transferase 2 OS=Ashbya gossypii (strain ATCC 10895 / CBS 109.51 / FGSC 9923 / NRRL Y-1056) GN=LAS21 PE=3 SV=2 14 843 5.0E-141
sp|Q6CLN2|GPI7_KLULA GPI ethanolamine phosphate transferase 2 OS=Kluyveromyces lactis (strain ATCC 8585 / CBS 2359 / DSM 70799 / NBRC 1267 / NRRL Y-1140 / WM37) GN=LAS21 PE=3 SV=1 14 836 6.0E-140
sp|Q6FPB2|GPI7_CANGA GPI ethanolamine phosphate transferase 2 OS=Candida glabrata (strain ATCC 2001 / CBS 138 / JCM 3761 / NBRC 0622 / NRRL Y-65) GN=LAS21 PE=3 SV=1 1 842 2.0E-135
sp|Q09782|GPI7_SCHPO GPI ethanolamine phosphate transferase 2 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=las21 PE=3 SV=1 17 835 1.0E-118
sp|P40367|GPI7_YEAST GPI ethanolamine phosphate transferase 2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=LAS21 PE=1 SV=1 14 836 1.0E-117
sp|Q5H8A4|PIGG_HUMAN GPI ethanolamine phosphate transferase 2 OS=Homo sapiens GN=PIGG PE=1 SV=1 14 337 1.0E-67
sp|Q8TEQ8|PIGO_HUMAN GPI ethanolamine phosphate transferase 3 OS=Homo sapiens GN=PIGO PE=1 SV=3 46 335 2.0E-41
sp|Q07830|GPI13_YEAST GPI ethanolamine phosphate transferase 3 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=GPI13 PE=1 SV=1 3 328 2.0E-39
sp|O13663|GPI13_SCHPO GPI ethanolamine phosphate transferase 3 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=gpi13 PE=3 SV=1 49 335 4.0E-39
sp|Q9JJI6|PIGO_MOUSE GPI ethanolamine phosphate transferase 3 OS=Mus musculus GN=Pigo PE=1 SV=2 30 342 6.0E-38
sp|Q74ZS2|GPI13_ASHGO GPI ethanolamine phosphate transferase 3 OS=Ashbya gossypii (strain ATCC 10895 / CBS 109.51 / FGSC 9923 / NRRL Y-1056) GN=GPI13 PE=3 SV=2 14 328 9.0E-35
sp|Q5H8A4|PIGG_HUMAN GPI ethanolamine phosphate transferase 2 OS=Homo sapiens GN=PIGG PE=1 SV=1 511 842 3.0E-14
sp|P36051|MCD4_YEAST GPI ethanolamine phosphate transferase 1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=MCD4 PE=1 SV=1 28 377 5.0E-12
sp|Q9R1S3|PIGN_MOUSE GPI ethanolamine phosphate transferase 1 OS=Mus musculus GN=Pign PE=2 SV=2 4 329 6.0E-12
sp|O95427|PIGN_HUMAN GPI ethanolamine phosphate transferase 1 OS=Homo sapiens GN=PIGN PE=1 SV=1 4 413 2.0E-11
sp|Q5AXD1|MCD4_EMENI GPI ethanolamine phosphate transferase 1 OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=mcd4 PE=3 SV=1 47 328 3.0E-10
sp|Q2H0X9|MCD4_CHAGB GPI ethanolamine phosphate transferase 1 OS=Chaetomium globosum (strain ATCC 6205 / CBS 148.51 / DSM 1962 / NBRC 6347 / NRRL 1970) GN=MCD4 PE=3 SV=1 193 328 4.0E-10
sp|Q6C0Z3|MCD4_YARLI GPI ethanolamine phosphate transferase 1 OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=MCD4 PE=3 SV=1 28 328 2.0E-09
sp|Q4W9R7|MCD4_ASPFU GPI ethanolamine phosphate transferase 1 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=mcd4 PE=2 SV=1 172 328 7.0E-09
sp|Q7SAP1|MCD4_NEUCR GPI ethanolamine phosphate transferase 1 OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=mcd-4 PE=3 SV=1 44 328 7.0E-09
sp|Q8WZK2|MCD4_SCHPO GPI ethanolamine phosphate transferase 1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=its8 PE=1 SV=1 28 355 2.0E-08
sp|Q6FJ81|MCD4_CANGA GPI ethanolamine phosphate transferase 1 OS=Candida glabrata (strain ATCC 2001 / CBS 138 / JCM 3761 / NBRC 0622 / NRRL Y-65) GN=MCD4 PE=3 SV=1 28 328 3.0E-08
sp|Q4ILH3|MCD4_GIBZE GPI ethanolamine phosphate transferase 1 OS=Gibberella zeae (strain PH-1 / ATCC MYA-4620 / FGSC 9075 / NRRL 31084) GN=MCD4 PE=3 SV=1 172 356 3.0E-08
sp|Q6CW36|MCD4_KLULA GPI ethanolamine phosphate transferase 1 OS=Kluyveromyces lactis (strain ATCC 8585 / CBS 2359 / DSM 70799 / NBRC 1267 / NRRL Y-1140 / WM37) GN=MCD4 PE=3 SV=1 28 328 4.0E-08
sp|Q757X5|MCD4_ASHGO GPI ethanolamine phosphate transferase 1 OS=Ashbya gossypii (strain ATCC 10895 / CBS 109.51 / FGSC 9923 / NRRL Y-1056) GN=MCD4 PE=3 SV=2 174 328 4.0E-08
sp|Q5A3M6|MCD4_CANAL GPI ethanolamine phosphate transferase 1 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=MCD4 PE=3 SV=1 28 328 1.0E-07
sp|Q6BWE3|MCD4_DEBHA GPI ethanolamine phosphate transferase 1 OS=Debaryomyces hansenii (strain ATCC 36239 / CBS 767 / JCM 1990 / NBRC 0083 / IGC 2968) GN=MCD4 PE=3 SV=2 28 328 2.0E-07
sp|Q2U0S9|MCD4_ASPOR GPI ethanolamine phosphate transferase 1 OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) GN=mcd4 PE=3 SV=1 189 328 6.0E-07
[Show less]

GO

GO Term Description Terminal node
GO:0008484 sulfuric ester hydrolase activity Yes
GO:0003824 catalytic activity No
GO:0016788 hydrolase activity, acting on ester bonds No
GO:0003674 molecular_function No
GO:0016787 hydrolase activity No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 23 0.5

Transmembrane Domains

Domain # Start End Length
1 2 24 22
2 442 461 19
3 468 490 22
4 495 514 19
5 562 579 17
6 589 611 22
7 639 656 17
8 746 768 22
9 788 810 22
10 830 852 22

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >OphauB2|7144
MSILLIISNLLIPVSMVIFATGFFPYKPLLPGLAEYENLGYGAPPAAPFNRLVFMVVDALRSDFVYSNGSGFHFT
QSLIRNGTAMPFTANARSPTVTMPRIKSMTTGSIPSFVDLILNIDEADTSSSLASQDTWLAQLKISEKGKLLMYG
DDTWLKLFPDTFDRHDGTTSFFVSDFTQVDKNVTRHVAPELENSDWSLMVLHYLGLDHIGHKAGPKSFHMVPKQR
EMDNVVERIYRAMESNTHLDSTLLIVCGDHGMNDAGNHGASSPGETSPALVFISPKLRAVSSKQWAPAQPVHEYD
YFSTVEQSDIAPTIAALLGFPVPKNNLGVFIPDFFPLWSSSSDMVQIVMRNARQMLGIVTAAFGAKEVFDADTPS
NSDACTLEGTSIMALGCKWRQISRQASSVASTAKMDQVWLSDAMNWLRETQDLMSNMASNYDMVRLNAGQWMALA
AVMMNMMVLRFQGTWQDGSWLPVLTLSVSYGAMMFASSYVEEEQHFWYWSTTLALACMGLRAIRGTRRLSAATRY
LLALGALRLARGWNQTGQKFAGEPDIVKSYLLPHPRLLWALVVATYAVISFQLTRQLKGLPPLVATLLASASVLA
AFAFKLAFTAADSPELVAGFARDVNEAIEGPSLLRRARLVFAFIVGLLAYAVWRAIQGGRYATYSPRLVHQVVAL
LAVTQSRVTNVPLLLLATIIYHCLESDEGLDAGHMSALSVMLQHVFFFAFGGSNAISSVDLASAYNGIASFNVVA
VGVLTFIGNWAGPIFWTLATANMLLQHGNGGNGSLKTILARHLGLVTLFATTSMAAVMAASMALRTHLFIWTVFS
PKYLYAMAWGMGQHLVVDLCFGSLVFLLGWRRQ*
Coding >OphauB2|7144
ATGAGCATTCTGCTCATCATCAGCAATCTGCTCATTCCTGTGTCAATGGTGATATTTGCCACCGGATTCTTTCCC
TACAAGCCACTTCTTCCAGGTCTTGCCGAGTACGAGAATTTAGGATATGGCGCCCCTCCAGCTGCTCCATTCAAC
CGTCTCGTCTTCATGGTGGTTGACGCGCTGCGGAGTGATTTTGTCTACTCAAACGGTTCGGGTTTCCACTTTACC
CAAAGTCTCATTCGCAATGGCACTGCCATGCCCTTTACTGCTAACGCACGATCTCCCACGGTGACTATGCCGCGT
ATCAAGTCCATGACGACGGGGTCCATTCCCTCGTTTGTCGATCTCATTCTCAACATTGATGAAGCCGACACGTCG
TCTTCACTTGCCTCGCAGGACACCTGGCTGGCGCAACTCAAAATTTCTGAAAAGGGCAAGCTGCTCATGTATGGC
GACGACACGTGGTTGAAGCTCTTTCCCGACACATTTGATCGTCACGATGGCACTACTAGCTTTTTTGTTTCGGAT
TTTACCCAGGTTGACAAGAATGTTACGCGACATGTTGCCCCTGAATTGGAAAACAGTGACTGGAGCTTAATGGTG
TTGCACTATCTTGGCCTTGACCACATTGGTCATAAAGCGGGGCCTAAAAGCTTCCACATGGTGCCCAAGCAACGC
GAGATGGACAATGTTGTCGAGCGTATTTATAGAGCCATGGAGTCAAACACGCACCTCGACTCCACTCTTCTCATT
GTCTGCGGCGATCACGGCATGAACGATGCTGGAAACCACGGCGCCTCTTCGCCAGGCGAGACATCACCGGCTCTT
GTCTTTATTTCCCCAAAGCTCAGGGCCGTGTCGAGCAAGCAGTGGGCGCCGGCGCAGCCTGTTCATGAATATGAC
TATTTTTCAACCGTCGAGCAGTCAGATATTGCCCCCACAATTGCGGCGTTGCTTGGCTTCCCTGTTCCCAAGAAT
AACCTGGGTGTCTTTATACCAGACTTTTTCCCTCTTTGGTCCAGCTCCAGCGACATGGTGCAGATTGTCATGCGA
AATGCCAGACAAATGCTCGGCATTGTTACCGCAGCGTTTGGTGCCAAAGAAGTCTTTGACGCTGACACGCCTAGC
AACTCTGATGCTTGTACTTTGGAAGGAACTAGTATCATGGCATTGGGCTGTAAATGGCGGCAGATTAGCCGCCAG
GCCTCTTCAGTCGCGTCGACGGCCAAGATGGATCAAGTCTGGCTTTCTGACGCTATGAATTGGCTGCGCGAGACT
CAGGACCTGATGAGCAACATGGCTTCCAACTACGACATGGTTCGCCTCAATGCTGGTCAATGGATGGCTCTGGCC
GCCGTCATGATGAACATGATGGTGTTGAGATTTCAGGGCACTTGGCAGGATGGCAGCTGGTTGCCTGTGCTAACT
CTTTCGGTATCTTATGGGGCCATGATGTTTGCGAGCAGCTATGTGGAAGAGGAGCAGCATTTTTGGTATTGGTCT
ACGACGCTTGCTCTGGCCTGCATGGGATTGAGGGCAATTCGCGGGACGCGACGGCTATCAGCTGCCACTCGATAC
CTTTTGGCCCTGGGTGCCTTGCGTCTGGCTAGGGGTTGGAACCAAACGGGCCAAAAGTTTGCTGGTGAGCCTGAC
ATTGTCAAGTCGTATCTGCTTCCACACCCACGCCTCCTTTGGGCTCTGGTGGTGGCAACATATGCCGTCATCTCG
TTTCAACTGACGCGCCAGCTCAAGGGGCTCCCACCTCTTGTGGCAACCTTGCTGGCGTCTGCTTCCGTATTGGCG
GCGTTTGCTTTCAAGCTGGCCTTTACAGCTGCAGACTCTCCTGAGCTTGTGGCTGGCTTTGCGCGAGATGTTAAT
GAGGCTATTGAGGGGCCGAGCCTGTTACGGAGGGCACGCCTTGTCTTTGCTTTTATTGTCGGCTTATTGGCATAT
GCCGTGTGGCGCGCCATTCAGGGCGGGCGCTATGCCACCTATTCTCCCCGACTGGTCCATCAAGTTGTGGCATTG
CTCGCTGTGACACAGTCGCGGGTAACGAATGTGCCGCTGCTGCTGCTGGCCACGATTATCTACCACTGCCTCGAA
TCCGATGAAGGCTTGGACGCGGGCCACATGTCAGCGCTGTCAGTGATGCTGCAGCACGTCTTCTTCTTTGCGTTT
GGTGGGTCCAATGCCATTTCGTCTGTGGATCTGGCGAGCGCATACAACGGTATTGCTAGCTTCAATGTCGTGGCC
GTTGGCGTACTTACCTTTATTGGCAATTGGGCCGGCCCAATCTTCTGGACTTTGGCCACGGCCAACATGTTGTTG
CAGCACGGCAATGGAGGCAATGGGAGCTTGAAGACGATATTGGCACGCCATTTGGGGCTGGTGACGCTGTTTGCG
ACGACGAGCATGGCGGCCGTCATGGCGGCGTCGATGGCGCTACGGACCCATCTTTTCATATGGACTGTATTTTCG
CCCAAGTACCTCTATGCCATGGCATGGGGCATGGGCCAGCACCTGGTGGTTGACTTGTGTTTTGGCTCCCTTGTA
TTCTTGTTGGGATGGAGGCGCCAATGA
Transcript >OphauB2|7144
ATGAGCATTCTGCTCATCATCAGCAATCTGCTCATTCCTGTGTCAATGGTGATATTTGCCACCGGATTCTTTCCC
TACAAGCCACTTCTTCCAGGTCTTGCCGAGTACGAGAATTTAGGATATGGCGCCCCTCCAGCTGCTCCATTCAAC
CGTCTCGTCTTCATGGTGGTTGACGCGCTGCGGAGTGATTTTGTCTACTCAAACGGTTCGGGTTTCCACTTTACC
CAAAGTCTCATTCGCAATGGCACTGCCATGCCCTTTACTGCTAACGCACGATCTCCCACGGTGACTATGCCGCGT
ATCAAGTCCATGACGACGGGGTCCATTCCCTCGTTTGTCGATCTCATTCTCAACATTGATGAAGCCGACACGTCG
TCTTCACTTGCCTCGCAGGACACCTGGCTGGCGCAACTCAAAATTTCTGAAAAGGGCAAGCTGCTCATGTATGGC
GACGACACGTGGTTGAAGCTCTTTCCCGACACATTTGATCGTCACGATGGCACTACTAGCTTTTTTGTTTCGGAT
TTTACCCAGGTTGACAAGAATGTTACGCGACATGTTGCCCCTGAATTGGAAAACAGTGACTGGAGCTTAATGGTG
TTGCACTATCTTGGCCTTGACCACATTGGTCATAAAGCGGGGCCTAAAAGCTTCCACATGGTGCCCAAGCAACGC
GAGATGGACAATGTTGTCGAGCGTATTTATAGAGCCATGGAGTCAAACACGCACCTCGACTCCACTCTTCTCATT
GTCTGCGGCGATCACGGCATGAACGATGCTGGAAACCACGGCGCCTCTTCGCCAGGCGAGACATCACCGGCTCTT
GTCTTTATTTCCCCAAAGCTCAGGGCCGTGTCGAGCAAGCAGTGGGCGCCGGCGCAGCCTGTTCATGAATATGAC
TATTTTTCAACCGTCGAGCAGTCAGATATTGCCCCCACAATTGCGGCGTTGCTTGGCTTCCCTGTTCCCAAGAAT
AACCTGGGTGTCTTTATACCAGACTTTTTCCCTCTTTGGTCCAGCTCCAGCGACATGGTGCAGATTGTCATGCGA
AATGCCAGACAAATGCTCGGCATTGTTACCGCAGCGTTTGGTGCCAAAGAAGTCTTTGACGCTGACACGCCTAGC
AACTCTGATGCTTGTACTTTGGAAGGAACTAGTATCATGGCATTGGGCTGTAAATGGCGGCAGATTAGCCGCCAG
GCCTCTTCAGTCGCGTCGACGGCCAAGATGGATCAAGTCTGGCTTTCTGACGCTATGAATTGGCTGCGCGAGACT
CAGGACCTGATGAGCAACATGGCTTCCAACTACGACATGGTTCGCCTCAATGCTGGTCAATGGATGGCTCTGGCC
GCCGTCATGATGAACATGATGGTGTTGAGATTTCAGGGCACTTGGCAGGATGGCAGCTGGTTGCCTGTGCTAACT
CTTTCGGTATCTTATGGGGCCATGATGTTTGCGAGCAGCTATGTGGAAGAGGAGCAGCATTTTTGGTATTGGTCT
ACGACGCTTGCTCTGGCCTGCATGGGATTGAGGGCAATTCGCGGGACGCGACGGCTATCAGCTGCCACTCGATAC
CTTTTGGCCCTGGGTGCCTTGCGTCTGGCTAGGGGTTGGAACCAAACGGGCCAAAAGTTTGCTGGTGAGCCTGAC
ATTGTCAAGTCGTATCTGCTTCCACACCCACGCCTCCTTTGGGCTCTGGTGGTGGCAACATATGCCGTCATCTCG
TTTCAACTGACGCGCCAGCTCAAGGGGCTCCCACCTCTTGTGGCAACCTTGCTGGCGTCTGCTTCCGTATTGGCG
GCGTTTGCTTTCAAGCTGGCCTTTACAGCTGCAGACTCTCCTGAGCTTGTGGCTGGCTTTGCGCGAGATGTTAAT
GAGGCTATTGAGGGGCCGAGCCTGTTACGGAGGGCACGCCTTGTCTTTGCTTTTATTGTCGGCTTATTGGCATAT
GCCGTGTGGCGCGCCATTCAGGGCGGGCGCTATGCCACCTATTCTCCCCGACTGGTCCATCAAGTTGTGGCATTG
CTCGCTGTGACACAGTCGCGGGTAACGAATGTGCCGCTGCTGCTGCTGGCCACGATTATCTACCACTGCCTCGAA
TCCGATGAAGGCTTGGACGCGGGCCACATGTCAGCGCTGTCAGTGATGCTGCAGCACGTCTTCTTCTTTGCGTTT
GGTGGGTCCAATGCCATTTCGTCTGTGGATCTGGCGAGCGCATACAACGGTATTGCTAGCTTCAATGTCGTGGCC
GTTGGCGTACTTACCTTTATTGGCAATTGGGCCGGCCCAATCTTCTGGACTTTGGCCACGGCCAACATGTTGTTG
CAGCACGGCAATGGAGGCAATGGGAGCTTGAAGACGATATTGGCACGCCATTTGGGGCTGGTGACGCTGTTTGCG
ACGACGAGCATGGCGGCCGTCATGGCGGCGTCGATGGCGCTACGGACCCATCTTTTCATATGGACTGTATTTTCG
CCCAAGTACCTCTATGCCATGGCATGGGGCATGGGCCAGCACCTGGTGGTTGACTTGTGTTTTGGCTCCCTTGTA
TTCTTGTTGGGATGGAGGCGCCAATGA
Gene >OphauB2|7144
ATGAGCATTCTGCTCATCATCAGCAATCTGCTCATTCCTGTGTCAATGGTGATATTTGCCACCGGATTCTTTCCC
TACAAGCCACTTCTTCCAGGTCTTGCCGAGTACGAGAATTTAGGATATGGCGCCCCTCCAGCTGCTCCATTCAAC
CGTCTCGTCTTCATGGTGGTTGACGCGCTGCGGAGGTAAGGAGTCTTTTGATGAGGCTTATTAGCCGATGAGATG
AAGCACTGCTGACACCATGCCAGTGATTTTGTCTACTCAAACGGTTCGGGTTTCCACTTTACCCAAAGGTGAGGA
TTGTTTCCGTCTGCTGGCACATCATGTCATTCTCACTTCCTTGTTTTCAGTCTCATTCGCAATGGCACTGCCATG
CCCTTTACTGCTAACGCACGATCTCCCACGGTGACTATGCCGCGTATCAAGTCCATGACGACGGGGTCCATTCCC
TCGTTTGTCGATCTCATTCTCAACATTGATGAAGCCGACACGTCGTCTTCACTTGCCTCGCAGGACACCTGGCTG
GCGCAACTCAAAATTTCTGAAAAGGGCAAGCTGCTCATGTATGGCGACGACACGTGGTTGAAGCTCTTTCCCGAC
ACATTTGATCGTCACGATGGCACTACTAGCTTTTTTGTTTCGGTGGGTCTCAAGGTTGTCGGTCAAGCTCTCAGC
AAACGCGTCCTCACCTTTACCAGGATTTTACCCAGGTTGACAAGAATGTTACGCGACATGTTGCCCCTGAATTGG
AAAACAGTGACTGGAGCTTAATGGTGTTGCACTATCTTGGCCTTGACCACATTGGTCATAAAGCGGGGCCTAAAA
GGTGAGAAGAGTTTGTATGTGATTTTTGTGCTTTATGGGCCCTCTGCTCACCTGTCTACAGCTTCCACATGGTGC
CCAAGCAACGCGAGATGGACAATGTTGTCGAGCGTATTTATAGAGCCATGGAGTCAAACACGCACCTCGACTCCA
CTCTTCTCATTGTCTGCGGCGATCACGGCATGAACGATGCTGGAAACCACGGCGCCTCTTCGCCAGGCGAGACAT
CACCGGCTCTTGTCTTTATTTCCCCAAAGCTCAGGGCCGTGTCGAGCAAGCAGTGGGCGCCGGCGCAGCCTGTTC
ATGAATATGACTATTTTTCAACCGTCGAGCAGTCAGATATTGCCCCCACAATTGCGGCGTTGCTTGGCTTCCCTG
TTCCCAAGAATAACCTGGGTGTCTTTATACCAGACTTTTTCCCTCTTTGGTCCAGCTCCAGCGACATGGTGCAGA
TTGTCATGCGAAATGCCAGACAAATGCTCGGCATTGTTACCGCAGCGTTTGGTGCCAAAGAAGTCTTTGACGCTG
ACACGCCTAGCAACTCTGATGCTTGTACTTTGGAAGGAACTAGTATCATGGCATTGGGCTGTAAATGGCGGCAGA
TTAGCCGCCAGGCCTCTTCAGTCGCGTCGACGGCCAAGATGGATCAAGTCTGGCTTTCTGACGCTATGAATTGGC
TGCGCGAGACTCAGGACCTGATGAGCAACATGGCTTCCAACTACGACATGGTTCGCCTCAATGCTGGTCAATGGA
TGGCTCTGGCCGCCGTCATGATGAACATGATGGTGTTGAGATTTCAGGGCACTTGGCAGGATGGCAGCTGGTTGC
CTGTGCTAACTCTTTCGGTATCTTATGGGGCCATGATGTTTGCGAGCAGCTATGTGGAAGAGGAGCAGCATTTTT
GGTATTGGTCTACGACGCTTGCTCTGGCCTGCATGGGATTGAGGGCAATTCGCGGGTGAATGCAACTGACATTGC
TACCCGTGTCTAGAATAACGGCTGACAGACAAGGCAGGACGCGACGGCTATCAGCTGCCACTCGATACCTTTTGG
CCCTGGGTGCCTTGCGTCTGGCTAGGGGTTGGAACCAAACGGGCCAAAAGTTTGCTGGTGAGCCTGACATTGTCA
AGTCGTATCTGCTTCCACACCCACGCCTCCTTTGGGCTCTGGTGGTGGCAACATATGCCGTCATCTCGTTTCAAC
TGACGCGCCAGCTCAAGGGGCTCCCACCTCTTGTGGCAACCTTGCTGGCGTCTGCTTCCGTATTGGCGGCGTTTG
CTTTCAAGCTGGCCTTTACAGCTGCAGACTCTCCTGAGCTTGTGGCTGGCTTTGCGCGAGATGTTAATGAGGCTA
TTGAGGGGCCGAGCCTGTTACGGAGGGCACGCCTTGTCTTTGCTTTTATTGTCGGCTTATTGGCATATGCCGTGT
GGCGCGCCATTCAGGGCGGGCGCTATGCCACCTATTCTCGTGAGCAGTTTTTCTTGTCAGTTTGCTCGAGTGATG
AGTTTTGGTTGCTGATGAAGTTGGCTCAACGCTTAATCAGCCCGACTGGTCCATCAAGTTGTGGCATTGCTCGCT
GTGACACAGTCGCGGGTAACGAATGTGCCGCTGCTGCTGCTGGCCACGATTATCTACCACTGCCTCGAATCCGAT
GAAGGCTTGGACGCGGGCCACATGTCAGCGCTGTCAGTGATGCTGCAGCACGTCTTCTTCTTTGCGTTTGGTGGG
TCCAATGCCATTTCGTCTGTGGATCTGGCGAGCGCATACAACGGTATTGCTAGCTTCAATGTCGTGGCCGTTGGC
GTACTTACCTTTATTGGCAATTGGGCCGGCCCAATCTTCTGGACTTTGGCCACGGCCAACATGTTGTTGCAGCAC
GGCAATGGAGGCAATGGGAGCTTGAAGACGATATTGGCACGCCATTTGGGGCTGGTGACGCTGTTTGCGACGACG
AGCATGGCGGCCGTCATGGCGGCGTCGATGGCGCTACGGACCCATCTTTTCATATGGACTGTATTTTCGCCCAAG
TACCTCTATGCCATGGCATGGGGCATGGGCCAGCACCTGGTGGTTGACTTGTGTTTTGGCTCCCTTGTATTCTTG
TTGGGATGGAGGCGCCAATGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail