Fungal Genomics

at Utrecht University

General Properties

Protein IDOphauB2|7138
Gene name
LocationContig_72:16559..16946
Strand-
Gene length (bp)387
Transcript length (bp)387
Coding sequence length (bp)387
Protein length (aa) 129

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF09435 DUF2015 Fungal protein of unknown function (DUF2015) 8.8E-45 10 123

Swissprot hits

Swissprot ID Swissprot Description Start End E-value
sp|Q876Z1|YCB2_ASHGO UPF0357 protein AAL017W OS=Ashbya gossypii (strain ATCC 10895 / CBS 109.51 / FGSC 9923 / NRRL Y-1056) GN=AAL017W PE=3 SV=1 42 127 1.0E-20
sp|Q8J0M6|YCB2_SACBA UPF0357 protein YCL012C OS=Saccharomyces bayanus GN=YCL012C PE=3 SV=1 42 127 1.0E-18
sp|Q8J0N0|YCB2_SACPA UPF0357 protein YCL012C OS=Saccharomyces paradoxus GN=YCL012C PE=3 SV=1 44 127 3.0E-18
sp|Q8J0M4|YCB2_YEAST UPF0357 protein YCL012C OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=YCL012C PE=1 SV=2 42 127 1.0E-17
sp|O14068|YFF7_SCHPO UPF0357 protein C1687.07 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC1687.07 PE=3 SV=1 42 126 3.0E-14

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 17 0.5

Transmembrane Domains

Domain # Start End Length
1 5 27 22

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >OphauB2|7138
MAYLLFSLSLLFVVGATVLFLTRTCWLPMVPDIYLPGAGFIYTRLPGSFSRDIEAGLSSSNFDLSDNVDAGDSRA
GLDDASKAEILKIMKKRRMTFDQARKAFMESRFKANGIGADGRPRDPKFVSFS*
Coding >OphauB2|7138
ATGGCTTATCTACTCTTCAGCCTTTCCCTCCTCTTTGTTGTCGGCGCCACGGTGCTCTTTTTAACGCGCACTTGT
TGGTTGCCCATGGTTCCCGACATTTACCTGCCTGGCGCAGGATTTATTTACACGCGCCTACCCGGCAGCTTCAGC
CGCGACATTGAGGCCGGCCTTTCCAGCAGCAACTTTGATCTAAGCGACAATGTCGACGCTGGAGATAGCCGTGCA
GGTCTTGACGACGCCAGCAAAGCCGAAATCTTAAAAATTATGAAGAAGAGGCGCATGACTTTTGATCAGGCTCGG
AAAGCCTTTATGGAGAGCCGCTTCAAGGCAAATGGTATTGGCGCTGACGGTCGACCTCGAGATCCTAAATTTGTC
AGCTTCTCTTAA
Transcript >OphauB2|7138
ATGGCTTATCTACTCTTCAGCCTTTCCCTCCTCTTTGTTGTCGGCGCCACGGTGCTCTTTTTAACGCGCACTTGT
TGGTTGCCCATGGTTCCCGACATTTACCTGCCTGGCGCAGGATTTATTTACACGCGCCTACCCGGCAGCTTCAGC
CGCGACATTGAGGCCGGCCTTTCCAGCAGCAACTTTGATCTAAGCGACAATGTCGACGCTGGAGATAGCCGTGCA
GGTCTTGACGACGCCAGCAAAGCCGAAATCTTAAAAATTATGAAGAAGAGGCGCATGACTTTTGATCAGGCTCGG
AAAGCCTTTATGGAGAGCCGCTTCAAGGCAAATGGTATTGGCGCTGACGGTCGACCTCGAGATCCTAAATTTGTC
AGCTTCTCTTAA
Gene >OphauB2|7138
ATGGCTTATCTACTCTTCAGCCTTTCCCTCCTCTTTGTTGTCGGCGCCACGGTGCTCTTTTTAACGCGCACTTGT
TGGTTGCCCATGGTTCCCGACATTTACCTGCCTGGCGCAGGATTTATTTACACGCGCCTACCCGGCAGCTTCAGC
CGCGACATTGAGGCCGGCCTTTCCAGCAGCAACTTTGATCTAAGCGACAATGTCGACGCTGGAGATAGCCGTGCA
GGTCTTGACGACGCCAGCAAAGCCGAAATCTTAAAAATTATGAAGAAGAGGCGCATGACTTTTGATCAGGCTCGG
AAAGCCTTTATGGAGAGCCGCTTCAAGGCAAATGGTATTGGCGCTGACGGTCGACCTCGAGATCCTAAATTTGTC
AGCTTCTCTTAA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail