Fungal Genomics

at Utrecht University

General Properties

Protein IDOphauB2|7134
Gene name
LocationContig_72:6426..8710
Strand-
Gene length (bp)2284
Transcript length (bp)2010
Coding sequence length (bp)2010
Protein length (aa) 670

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF01490 Aa_trans Transmembrane amino acid transporter protein 1.2E-59 265 657

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|P47082|AVT1_YEAST Vacuolar amino acid transporter 1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=AVT1 PE=1 SV=1 247 654 1.0E-94
sp|Q9SF09|ANT1_ARATH Amino acid transporter ANT1 OS=Arabidopsis thaliana GN=ANT1 PE=1 SV=1 229 656 2.0E-18
sp|Q4KL91|S36A4_XENLA Proton-coupled amino acid transporter 4 OS=Xenopus laevis GN=slc36a4 PE=2 SV=1 205 656 4.0E-18
sp|Q6YBV0|S36A4_HUMAN Proton-coupled amino acid transporter 4 OS=Homo sapiens GN=SLC36A4 PE=1 SV=1 224 631 4.0E-15
sp|Q8CH36|S36A4_MOUSE Proton-coupled amino acid transporter 4 OS=Mus musculus GN=Slc36a4 PE=2 SV=1 224 630 6.0E-15
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|P47082|AVT1_YEAST Vacuolar amino acid transporter 1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=AVT1 PE=1 SV=1 247 654 1.0E-94
sp|Q9SF09|ANT1_ARATH Amino acid transporter ANT1 OS=Arabidopsis thaliana GN=ANT1 PE=1 SV=1 229 656 2.0E-18
sp|Q4KL91|S36A4_XENLA Proton-coupled amino acid transporter 4 OS=Xenopus laevis GN=slc36a4 PE=2 SV=1 205 656 4.0E-18
sp|Q6YBV0|S36A4_HUMAN Proton-coupled amino acid transporter 4 OS=Homo sapiens GN=SLC36A4 PE=1 SV=1 224 631 4.0E-15
sp|Q8CH36|S36A4_MOUSE Proton-coupled amino acid transporter 4 OS=Mus musculus GN=Slc36a4 PE=2 SV=1 224 630 6.0E-15
sp|F4ILY9|ANTL1_ARATH Amino acid transporter ANTL1 OS=Arabidopsis thaliana GN=At2g42005 PE=2 SV=1 274 636 4.0E-12
sp|Q99624|S38A3_HUMAN Sodium-coupled neutral amino acid transporter 3 OS=Homo sapiens GN=SLC38A3 PE=1 SV=1 263 627 5.0E-12
sp|Q9DCP2|S38A3_MOUSE Sodium-coupled neutral amino acid transporter 3 OS=Mus musculus GN=Slc38a3 PE=1 SV=1 263 627 7.0E-12
sp|Q9JHZ9|S38A3_RAT Sodium-coupled neutral amino acid transporter 3 OS=Rattus norvegicus GN=Slc38a3 PE=2 SV=1 263 627 2.0E-11
sp|Q5SPB1|S38A2_DANRE Sodium-coupled neutral amino acid transporter 2 OS=Danio rerio GN=slc38a2 PE=3 SV=1 196 631 3.0E-10
sp|Q5I012|S38AA_MOUSE Putative sodium-coupled neutral amino acid transporter 10 OS=Mus musculus GN=Slc38a10 PE=1 SV=2 272 653 3.0E-10
sp|E9PT23|S38AA_RAT Putative sodium-coupled neutral amino acid transporter 10 OS=Rattus norvegicus GN=Slc38a10 PE=2 SV=2 272 653 4.0E-10
sp|Q9HBR0|S38AA_HUMAN Putative sodium-coupled neutral amino acid transporter 10 OS=Homo sapiens GN=SLC38A10 PE=1 SV=2 272 664 1.0E-09
sp|Q5EA97|S38AB_BOVIN Putative sodium-coupled neutral amino acid transporter 11 OS=Bos taurus GN=SLC38A11 PE=2 SV=1 244 520 2.0E-09
sp|Q5RC98|S38AA_PONAB Putative sodium-coupled neutral amino acid transporter 10 OS=Pongo abelii GN=SLC38A10 PE=2 SV=1 272 664 2.0E-09
sp|Q9JM15|S38A1_RAT Sodium-coupled neutral amino acid transporter 1 OS=Rattus norvegicus GN=Slc38a1 PE=1 SV=1 208 627 2.0E-09
sp|Q8BHK3|S36A2_MOUSE Proton-coupled amino acid transporter 2 OS=Mus musculus GN=Slc36a2 PE=1 SV=1 270 517 4.0E-09
sp|Q495M3|S36A2_HUMAN Proton-coupled amino acid transporter 2 OS=Homo sapiens GN=SLC36A2 PE=1 SV=1 205 628 8.0E-09
sp|Q9H598|VIAAT_HUMAN Vesicular inhibitory amino acid transporter OS=Homo sapiens GN=SLC32A1 PE=2 SV=2 274 624 4.0E-08
sp|Q95KE2|VIAAT_MACFA Vesicular inhibitory amino acid transporter OS=Macaca fascicularis GN=SLC32A1 PE=2 SV=1 274 624 4.0E-08
sp|O35458|VIAAT_RAT Vesicular inhibitory amino acid transporter OS=Rattus norvegicus GN=Slc32a1 PE=1 SV=1 274 624 4.0E-08
sp|O35633|VIAAT_MOUSE Vesicular inhibitory amino acid transporter OS=Mus musculus GN=Slc32a1 PE=1 SV=3 274 624 1.0E-07
sp|Q9SVG0|ANTL2_ARATH Amino acid transporter ANTL2 OS=Arabidopsis thaliana GN=At4g38250 PE=1 SV=1 274 632 1.0E-07
sp|Q9JHE5|S38A2_RAT Sodium-coupled neutral amino acid transporter 2 OS=Rattus norvegicus GN=Slc38a2 PE=1 SV=1 199 656 1.0E-07
sp|Q8IZM9|S38A6_HUMAN Probable sodium-coupled neutral amino acid transporter 6 OS=Homo sapiens GN=SLC38A6 PE=1 SV=2 271 641 2.0E-07
sp|Q8K2P7|S38A1_MOUSE Sodium-coupled neutral amino acid transporter 1 OS=Mus musculus GN=Slc38a1 PE=1 SV=1 208 627 2.0E-07
sp|Q28HE5|S38A6_XENTR Probable sodium-coupled neutral amino acid transporter 6 OS=Xenopus tropicalis GN=slc38a6 PE=2 SV=1 219 645 3.0E-07
sp|Q8K415|S36A2_RAT Proton-coupled amino acid transporter 2 OS=Rattus norvegicus GN=Slc36a2 PE=1 SV=1 270 517 4.0E-07
sp|Q5R443|S38A1_PONAB Sodium-coupled neutral amino acid transporter 1 OS=Pongo abelii GN=SLC38A1 PE=2 SV=1 208 627 4.0E-07
sp|P39981|AVT2_YEAST Vacuolar amino acid transporter 2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=AVT2 PE=2 SV=1 230 644 7.0E-07
sp|Q9H2H9|S38A1_HUMAN Sodium-coupled neutral amino acid transporter 1 OS=Homo sapiens GN=SLC38A1 PE=1 SV=1 208 627 8.0E-07
sp|Q3USY0|S38AB_MOUSE Putative sodium-coupled neutral amino acid transporter 11 OS=Mus musculus GN=Slc38a11 PE=2 SV=2 248 429 8.0E-07
sp|D3Z813|S38AB_RAT Putative sodium-coupled neutral amino acid transporter 11 OS=Rattus norvegicus GN=Slc38a11 PE=2 SV=1 248 554 2.0E-06
sp|Q8L4X4|GAT2_ARATH Probable GABA transporter 2 OS=Arabidopsis thaliana GN=At5g41800 PE=1 SV=1 273 659 2.0E-06
sp|Q8R1S9|S38A4_MOUSE Sodium-coupled neutral amino acid transporter 4 OS=Mus musculus GN=Slc38a4 PE=1 SV=1 197 425 2.0E-06
sp|Q5XH90|S38A2_XENTR Sodium-coupled neutral amino acid transporter 2 OS=Xenopus tropicalis GN=slc38a2 PE=2 SV=1 208 656 3.0E-06
sp|Q9SS86|LHTL4_ARATH Lysine histidine transporter-like 4 OS=Arabidopsis thaliana GN=At3g01760 PE=3 SV=2 237 627 9.0E-06
sp|Q6DEL1|S38A7_DANRE Putative sodium-coupled neutral amino acid transporter 7 OS=Danio rerio GN=slc38a7 PE=2 SV=1 271 513 9.0E-06
[Show less]

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 12 0.45

Transmembrane Domains

Domain # Start End Length
1 296 318 22
2 344 366 22
3 376 398 22
4 403 425 22
5 445 467 22
6 487 509 22
7 524 546 22
8 580 599 19
9 603 625 22
10 638 660 22

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >OphauB2|7134
MAPSAANGEWRMDSPGGSVLTDEEALIDDDEAECSERGERIVGRGRRRSSVTERLSSMADVGGINSFRSFARSWQ
RAAGFVEVIPRRPSLVLSTWSDQAEGEADDAGEEAEGEAVDGGIHERSSILSQQLRRSASWQHHDQAADGSIFAV
APHLAAPSVLDSYGSFRSWHYGTTASRPSRCSFSHGSGWTALHRHDSATSSGRRRSSDDDQGSHDASHDASHDDD
DDADAAADADDQDGALGEEQPLLVREVKQGDRVVLTVEGRSTLPQSVFNSINSIIGVGLLSLPLAFKMSGWLLGL
LLLTMLAAVTAHTAKLLGRCMQLDASVVTYSDLAYLSFGSRARLVVSLLFTLELLAACLALIILFSDSLHLLLPG
LLGINVWKCLCALLVLVLNALPLRWLSYTSVLGILSTFSIVCIVIVDGLVKPHAPGSLRHPAATSMMPSSWLSLP
LAYGLMASPWGAHSVFPSIYRDMRHASKWNKGVNITFSFSYTLDTCLAVIGLLMFGDGIKDTITSNILRTPGYPP
GLNIFMSICIAVIPLTKIPLNARPIITTVDVLCRLDHASTRAAHANTSSIYMQRGLVRLFVVALLLAISILFPAF
DSVCAFLGAALCSLISVILPLLFYLRLFGRRISARESLVCWLLVLVFSVFGTVGTVWTFLPKHLVGASA*
Coding >OphauB2|7134
ATGGCTCCGTCGGCAGCAAATGGAGAATGGCGGATGGACAGTCCAGGGGGCAGCGTGCTCACGGATGAGGAGGCC
TTGATTGACGACGACGAGGCAGAGTGCAGCGAGAGGGGCGAGAGGATTGTGGGCCGTGGGCGCAGACGGTCGTCG
GTGACGGAGCGTCTCTCCTCCATGGCAGACGTGGGCGGCATCAACAGCTTCCGAAGCTTTGCGCGCAGCTGGCAG
CGAGCCGCCGGCTTCGTCGAGGTGATTCCGCGACGGCCGAGCCTCGTCTTGTCGACATGGTCGGACCAGGCCGAG
GGCGAGGCAGACGATGCGGGCGAGGAGGCAGAGGGCGAGGCAGTCGACGGCGGCATCCACGAGCGGTCCAGCATC
CTCAGCCAGCAGCTACGGCGCTCCGCCTCGTGGCAACACCATGACCAGGCGGCCGACGGGTCCATCTTTGCCGTG
GCGCCGCATCTGGCAGCGCCGTCGGTCCTTGATAGCTACGGCTCCTTTCGCAGCTGGCACTACGGCACGACTGCA
TCGCGGCCCTCGAGATGCTCCTTTAGCCATGGCAGCGGATGGACGGCTCTGCACCGCCACGACTCTGCCACTAGC
AGCGGCAGGCGGCGAAGCAGCGACGACGACCAGGGCAGTCACGATGCCAGTCACGATGCTAGTCACGACGACGAC
GACGATGCCGATGCCGCCGCCGACGCCGACGACCAAGACGGCGCGCTGGGCGAGGAGCAGCCGCTGCTGGTGCGC
GAGGTCAAGCAGGGCGACCGCGTCGTCTTGACCGTCGAGGGCCGCAGCACGCTGCCCCAGTCCGTCTTCAACTCC
ATCAACTCCATTATTGGCGTCGGCCTGCTCAGCCTGCCCCTCGCCTTCAAGATGAGCGGCTGGCTGCTCGGCCTG
CTCCTCCTGACCATGCTGGCCGCCGTCACGGCCCATACGGCAAAGCTGCTCGGCCGCTGCATGCAGCTCGATGCC
AGCGTCGTCACCTACTCAGACCTGGCCTATCTCTCCTTTGGCTCTCGCGCCCGCCTCGTCGTCTCCCTGCTCTTT
ACCCTTGAGCTGCTCGCCGCCTGCCTCGCCCTCATCATCCTCTTTTCCGACTCGCTCCACCTGCTGCTGCCAGGC
CTCCTTGGCATCAATGTGTGGAAGTGCCTCTGCGCCCTCCTCGTCCTCGTCCTCAACGCCCTGCCGCTGCGCTGG
CTCAGCTACACCAGCGTCCTCGGCATCCTCTCCACCTTTTCCATCGTTTGCATCGTCATTGTCGACGGCCTCGTC
AAGCCCCATGCCCCGGGCTCCCTGCGCCATCCTGCCGCCACCTCGATGATGCCCTCGAGCTGGCTCTCGCTGCCT
CTGGCTTACGGACTCATGGCCAGTCCCTGGGGGGCCCACTCCGTCTTTCCTTCGATTTACAGAGACATGCGTCAC
GCCAGCAAGTGGAACAAGGGCGTCAACATCACCTTTTCCTTTTCTTACACCCTCGATACCTGTCTGGCCGTCATT
GGTCTGCTCATGTTTGGCGACGGCATCAAGGACACCATCACCTCCAATATTTTGCGCACCCCGGGCTACCCCCCG
GGCCTCAATATTTTCATGTCCATCTGCATCGCCGTGATTCCCCTCACCAAGATTCCTCTCAATGCCCGCCCCATA
ATCACCACGGTCGACGTCTTGTGCCGCCTTGATCACGCTTCAACACGAGCTGCGCACGCAAACACGTCAAGTATT
TACATGCAAAGAGGTCTTGTACGCCTCTTTGTCGTGGCCCTTCTCTTGGCCATTTCCATCTTGTTTCCTGCATTT
GACTCTGTCTGCGCCTTTCTCGGCGCTGCCCTGTGCTCCCTCATCTCCGTCATTTTGCCCCTTCTTTTTTACCTG
CGCCTCTTTGGCCGCCGCATCTCTGCACGCGAATCCCTTGTTTGCTGGCTTCTTGTCCTTGTCTTCTCGGTCTTT
GGCACTGTTGGCACTGTATGGACCTTTTTGCCCAAGCACCTTGTTGGTGCGTCCGCATGA
Transcript >OphauB2|7134
ATGGCTCCGTCGGCAGCAAATGGAGAATGGCGGATGGACAGTCCAGGGGGCAGCGTGCTCACGGATGAGGAGGCC
TTGATTGACGACGACGAGGCAGAGTGCAGCGAGAGGGGCGAGAGGATTGTGGGCCGTGGGCGCAGACGGTCGTCG
GTGACGGAGCGTCTCTCCTCCATGGCAGACGTGGGCGGCATCAACAGCTTCCGAAGCTTTGCGCGCAGCTGGCAG
CGAGCCGCCGGCTTCGTCGAGGTGATTCCGCGACGGCCGAGCCTCGTCTTGTCGACATGGTCGGACCAGGCCGAG
GGCGAGGCAGACGATGCGGGCGAGGAGGCAGAGGGCGAGGCAGTCGACGGCGGCATCCACGAGCGGTCCAGCATC
CTCAGCCAGCAGCTACGGCGCTCCGCCTCGTGGCAACACCATGACCAGGCGGCCGACGGGTCCATCTTTGCCGTG
GCGCCGCATCTGGCAGCGCCGTCGGTCCTTGATAGCTACGGCTCCTTTCGCAGCTGGCACTACGGCACGACTGCA
TCGCGGCCCTCGAGATGCTCCTTTAGCCATGGCAGCGGATGGACGGCTCTGCACCGCCACGACTCTGCCACTAGC
AGCGGCAGGCGGCGAAGCAGCGACGACGACCAGGGCAGTCACGATGCCAGTCACGATGCTAGTCACGACGACGAC
GACGATGCCGATGCCGCCGCCGACGCCGACGACCAAGACGGCGCGCTGGGCGAGGAGCAGCCGCTGCTGGTGCGC
GAGGTCAAGCAGGGCGACCGCGTCGTCTTGACCGTCGAGGGCCGCAGCACGCTGCCCCAGTCCGTCTTCAACTCC
ATCAACTCCATTATTGGCGTCGGCCTGCTCAGCCTGCCCCTCGCCTTCAAGATGAGCGGCTGGCTGCTCGGCCTG
CTCCTCCTGACCATGCTGGCCGCCGTCACGGCCCATACGGCAAAGCTGCTCGGCCGCTGCATGCAGCTCGATGCC
AGCGTCGTCACCTACTCAGACCTGGCCTATCTCTCCTTTGGCTCTCGCGCCCGCCTCGTCGTCTCCCTGCTCTTT
ACCCTTGAGCTGCTCGCCGCCTGCCTCGCCCTCATCATCCTCTTTTCCGACTCGCTCCACCTGCTGCTGCCAGGC
CTCCTTGGCATCAATGTGTGGAAGTGCCTCTGCGCCCTCCTCGTCCTCGTCCTCAACGCCCTGCCGCTGCGCTGG
CTCAGCTACACCAGCGTCCTCGGCATCCTCTCCACCTTTTCCATCGTTTGCATCGTCATTGTCGACGGCCTCGTC
AAGCCCCATGCCCCGGGCTCCCTGCGCCATCCTGCCGCCACCTCGATGATGCCCTCGAGCTGGCTCTCGCTGCCT
CTGGCTTACGGACTCATGGCCAGTCCCTGGGGGGCCCACTCCGTCTTTCCTTCGATTTACAGAGACATGCGTCAC
GCCAGCAAGTGGAACAAGGGCGTCAACATCACCTTTTCCTTTTCTTACACCCTCGATACCTGTCTGGCCGTCATT
GGTCTGCTCATGTTTGGCGACGGCATCAAGGACACCATCACCTCCAATATTTTGCGCACCCCGGGCTACCCCCCG
GGCCTCAATATTTTCATGTCCATCTGCATCGCCGTGATTCCCCTCACCAAGATTCCTCTCAATGCCCGCCCCATA
ATCACCACGGTCGACGTCTTGTGCCGCCTTGATCACGCTTCAACACGAGCTGCGCACGCAAACACGTCAAGTATT
TACATGCAAAGAGGTCTTGTACGCCTCTTTGTCGTGGCCCTTCTCTTGGCCATTTCCATCTTGTTTCCTGCATTT
GACTCTGTCTGCGCCTTTCTCGGCGCTGCCCTGTGCTCCCTCATCTCCGTCATTTTGCCCCTTCTTTTTTACCTG
CGCCTCTTTGGCCGCCGCATCTCTGCACGCGAATCCCTTGTTTGCTGGCTTCTTGTCCTTGTCTTCTCGGTCTTT
GGCACTGTTGGCACTGTATGGACCTTTTTGCCCAAGCACCTTGTTGGTGCGTCCGCATGA
Gene >OphauB2|7134
ATGGCTCCGTCGGCAGCAAATGGAGAATGGCGGATGGACAGTCCAGGGGGCAGCGTGCTCACGGATGAGGAGGCC
TTGATTGACGACGACGAGGCAGAGTGCAGCGAGAGGGGCGAGAGGATTGTGGGCCGTGGGCGCAGACGGTGAGTG
CCAGCATCTTGATGGTGGTGGCTTGGTGGCGGCTTGGTGGTGTGCCGGCGAGCAAGCCCTGCTAACGGCAAAGAG
GGCAGGTCGTCGGTGACGGAGCGTCTCTCCTCCATGGCAGACGTGGGCGGCATCAACAGCTTCCGAAGCTTTGCG
CGCAGCTGGCAGCGAGCCGCCGGCTTCGTCGAGGTGATTCCGCGACGGCCGAGCCTCGTCTTGTCGACATGGTCG
GACCAGGCCGAGGGCGAGGCAGACGATGCGGGCGAGGAGGCAGAGGGCGAGGCAGTCGACGGCGGCATCCACGAG
CGGTCCAGCATCCTCAGCCAGCAGCTACGGCGCTCCGCCTCGTGGCAACACCATGACCAGGCGGCCGACGGGTCC
ATCTTTGCCGTGGCGCCGCATCTGGCAGCGCCGTCGGTCCTTGATAGCTACGGCTCCTTTCGCAGCTGGCACTAC
GGCACGACTGCATCGCGGCCCTCGAGATGCTCCTTTAGCCATGGCAGCGGATGGACGGCTCTGCACCGCCACGAC
TCTGCCACTAGCAGCGGCAGGCGGCGAAGCAGCGACGACGACCAGGGCAGTCACGATGCCAGTCACGATGCTAGT
CACGACGACGACGACGATGCCGATGCCGCCGCCGACGCCGACGACCAAGACGGCGCGCTGGGCGAGGAGCAGCCG
CTGCTGGTGCGCGAGGTCAAGCAGGGCGACCGCGTCGTCTTGACCGTCGAGGGCCGCAGCACGCTGCCCCAGTCC
GTCTTCAACTCCATCAACTCCATTATTGGCGTCGGCCTGCTCAGCCTGCCCCTCGCCTTCAAGATGAGCGGCTGG
CTGCTCGGCCTGCTCCTCCTGACCATGCTGGCCGCCGTCACGGCCCATACGGCAAAGCTGCTCGGCCGCTGCATG
CAGCTCGATGCCAGCGTCGTCACCTACTCAGACCTGGCCTATCTCTCCTTTGGCTCTCGCGCCCGCCTCGTCGTC
TCCCTGCTCTTTACCCTTGAGCTGCTCGCCGCCTGCCTCGCCCTCATCATCCTCTTTTCCGACTCGCTCCACCTG
CTGCTGCCAGGCCTCCTTGGCATCAATGTGTGGAAGTGCCTCTGCGCCCTCCTCGTCCTCGTCCTCAACGCCCTG
CCGCTGCGCTGGCTCAGCTACACCAGCGTCCTCGGCATCCTCTCCACCTTTTCCAGTCAGTCGCCCCGGCTGCAT
GCCGTCCCTGCGCAAAGCTCTCTACTGACTTTTGCCTCGGTGCTTTTTGCTAGTCGTTTGCATCGTCATTGTCGA
CGGCCTCGTCAAGCCCCATGCCCCGGGCTCCCTGCGCCATCCTGCCGCCACCTCGATGATGCCCTCGAGCTGGCT
CTCGCTGCCTCTGGCTTACGGACTCATGGCCAGTCCCTGGGGGGCCCACTCCGTCTTTCCTTCGGTAAGCATGTG
CCTGCCACGCCGAGCGCAATGCTCTACTGACGCCATGTCTAGATTTACAGAGACATGCGTCACGCCAGCAAGTGG
AACAAGGGCGTCAACATCACCTTTTCCTTTTCTGTAAGTCTGTGCCCTCTGCACCTCAGCCATGCGAGCCTGACC
AATCCTTGTCTCACTCTAGTACACCCTCGATACCTGTCTGGCCGTCATTGGTCTGCTCATGTTTGGCGACGGCAT
CAAGGACACCATCACCTCCAATATTTTGCGCACCCCGGGCTACCCCCCGGGCCTCAATATTTTCATGTCCATCTG
CATCGCCGTGATTCCCCTCACCAAGATTCCTCTCAATGCCCGCCCCATAATCACCACGGTCGACGTCTTGTGCCG
CCTTGATCACGCTTCAACACGAGCTGCGCACGCAAACACGTCAAGTATTTACATGCAAAGAGGTCTTGTACGCCT
CTTTGTCGTGGCCCTTCTCTTGGCCATTTCCATCTTGTTTCCTGCATTTGACTCTGTCTGCGCCTTTCTCGGCGC
TGCCCTGTGCTCCCTCATCTCCGTCATTTTGCCCCTTCTTTTTTACCTGCGCCTCTTTGGCCGCCGCATCTCTGC
ACGCGAATCCCTTGTTTGCTGGCTTCTTGTCCTTGTCTTCTCGGTCTTTGGCACTGTTGGCACTGTATGGACCTT
TTTGCCCAAGCACCTTGTTGGTGCGTCCGCATGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail