Fungal Genomics

at Utrecht University

General Properties

Protein IDOphauB2|7131
Gene name
LocationContig_71:95023..96162
Strand+
Gene length (bp)1139
Transcript length (bp)1083
Coding sequence length (bp)1083
Protein length (aa) 361

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00226 DnaJ DnaJ domain 9.9E-12 77 140

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|A4W6D6|DNAJ_ENT38 Chaperone protein DnaJ OS=Enterobacter sp. (strain 638) GN=dnaJ PE=3 SV=1 73 143 3.0E-08
sp|Q5E3A8|DNAJ_VIBF1 Chaperone protein DnaJ OS=Vibrio fischeri (strain ATCC 700601 / ES114) GN=dnaJ PE=3 SV=1 77 143 6.0E-08
sp|A7MIK3|DNAJ_CROS8 Chaperone protein DnaJ OS=Cronobacter sakazakii (strain ATCC BAA-894) GN=dnaJ PE=3 SV=1 73 143 7.0E-08
sp|A1VMG1|DNAJ_POLNA Chaperone protein DnaJ OS=Polaromonas naphthalenivorans (strain CJ2) GN=dnaJ PE=3 SV=1 73 148 8.0E-08
sp|Q1RHG9|DNAJ_RICBR Chaperone protein DnaJ OS=Rickettsia bellii (strain RML369-C) GN=dnaJ PE=3 SV=1 77 151 1.0E-07
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|A4W6D6|DNAJ_ENT38 Chaperone protein DnaJ OS=Enterobacter sp. (strain 638) GN=dnaJ PE=3 SV=1 73 143 3.0E-08
sp|Q5E3A8|DNAJ_VIBF1 Chaperone protein DnaJ OS=Vibrio fischeri (strain ATCC 700601 / ES114) GN=dnaJ PE=3 SV=1 77 143 6.0E-08
sp|A7MIK3|DNAJ_CROS8 Chaperone protein DnaJ OS=Cronobacter sakazakii (strain ATCC BAA-894) GN=dnaJ PE=3 SV=1 73 143 7.0E-08
sp|A1VMG1|DNAJ_POLNA Chaperone protein DnaJ OS=Polaromonas naphthalenivorans (strain CJ2) GN=dnaJ PE=3 SV=1 73 148 8.0E-08
sp|Q1RHG9|DNAJ_RICBR Chaperone protein DnaJ OS=Rickettsia bellii (strain RML369-C) GN=dnaJ PE=3 SV=1 77 151 1.0E-07
sp|A8EXP6|DNAJ_RICCK Chaperone protein DnaJ OS=Rickettsia canadensis (strain McKiel) GN=dnaJ PE=3 SV=1 77 151 1.0E-07
sp|Q607A6|DNAJ_METCA Chaperone protein DnaJ OS=Methylococcus capsulatus (strain ATCC 33009 / NCIMB 11132 / Bath) GN=dnaJ PE=3 SV=1 73 148 1.0E-07
sp|Q6RSN5|DNAJ_RHIRD Chaperone protein DnaJ OS=Rhizobium radiobacter GN=dnaJ PE=1 SV=1 73 143 1.0E-07
sp|B1Y787|DNAJ_LEPCP Chaperone protein DnaJ OS=Leptothrix cholodnii (strain ATCC 51168 / LMG 8142 / SP-6) GN=dnaJ PE=3 SV=1 77 148 1.0E-07
sp|B9JGW2|DNAJ_AGRRK Chaperone protein DnaJ OS=Agrobacterium radiobacter (strain K84 / ATCC BAA-868) GN=dnaJ PE=3 SV=1 73 143 1.0E-07
sp|A1TLH8|DNAJ_ACIAC Chaperone protein DnaJ OS=Acidovorax citrulli (strain AAC00-1) GN=dnaJ PE=3 SV=1 77 148 1.0E-07
sp|B9JZ89|DNAJ_AGRVS Chaperone protein DnaJ OS=Agrobacterium vitis (strain S4 / ATCC BAA-846) GN=dnaJ PE=3 SV=1 73 143 1.0E-07
sp|B7VJX0|DNAJ_VIBTL Chaperone protein DnaJ OS=Vibrio tasmaniensis (strain LGP32) GN=dnaJ PE=3 SV=1 77 143 1.0E-07
sp|A2SIR5|DNAJ_METPP Chaperone protein DnaJ OS=Methylibium petroleiphilum (strain PM1) GN=dnaJ PE=3 SV=1 77 148 1.0E-07
sp|Q128K1|DNAJ_POLSJ Chaperone protein DnaJ OS=Polaromonas sp. (strain JS666 / ATCC BAA-500) GN=dnaJ PE=3 SV=1 73 148 2.0E-07
sp|C3LTA6|DNAJ_VIBCM Chaperone protein DnaJ OS=Vibrio cholerae serotype O1 (strain M66-2) GN=dnaJ PE=3 SV=1 77 143 2.0E-07
sp|O34242|DNAJ_VIBCH Chaperone protein DnaJ OS=Vibrio cholerae serotype O1 (strain ATCC 39315 / El Tor Inaba N16961) GN=dnaJ PE=3 SV=2 77 143 2.0E-07
sp|A5F362|DNAJ_VIBC3 Chaperone protein DnaJ OS=Vibrio cholerae serotype O1 (strain ATCC 39541 / Classical Ogawa 395 / O395) GN=dnaJ PE=3 SV=1 77 143 2.0E-07
sp|B0BTI6|DNAJ_ACTPJ Chaperone protein DnaJ OS=Actinobacillus pleuropneumoniae serotype 3 (strain JL03) GN=dnaJ PE=3 SV=1 73 143 3.0E-07
sp|A3N3J9|DNAJ_ACTP2 Chaperone protein DnaJ OS=Actinobacillus pleuropneumoniae serotype 5b (strain L20) GN=dnaJ PE=3 SV=1 73 143 3.0E-07
sp|A9MR76|DNAJ_SALAR Chaperone protein DnaJ OS=Salmonella arizonae (strain ATCC BAA-731 / CDC346-86 / RSK2980) GN=dnaJ PE=3 SV=1 73 143 3.0E-07
sp|A8GV67|DNAJ_RICB8 Chaperone protein DnaJ OS=Rickettsia bellii (strain OSU 85-389) GN=dnaJ PE=3 SV=1 77 151 3.0E-07
sp|A6UEY1|DNAJ_SINMW Chaperone protein DnaJ OS=Sinorhizobium medicae (strain WSM419) GN=dnaJ PE=3 SV=1 77 143 3.0E-07
sp|P50018|DNAJ_AGRFC Chaperone protein DnaJ OS=Agrobacterium fabrum (strain C58 / ATCC 33970) GN=dnaJ PE=2 SV=2 73 143 3.0E-07
sp|A6T4F5|DNAJ_KLEP7 Chaperone protein DnaJ OS=Klebsiella pneumoniae subsp. pneumoniae (strain ATCC 700721 / MGH 78578) GN=dnaJ PE=3 SV=1 73 143 3.0E-07
sp|B5Y241|DNAJ_KLEP3 Chaperone protein DnaJ OS=Klebsiella pneumoniae (strain 342) GN=dnaJ PE=3 SV=1 73 143 3.0E-07
sp|Q9ZDY0|DNAJ_RICPR Chaperone protein DnaJ OS=Rickettsia prowazekii (strain Madrid E) GN=dnaJ PE=3 SV=1 77 151 4.0E-07
sp|B5BLH9|DNAJ_SALPK Chaperone protein DnaJ OS=Salmonella paratyphi A (strain AKU_12601) GN=dnaJ PE=3 SV=1 73 143 4.0E-07
sp|Q5PDJ4|DNAJ_SALPA Chaperone protein DnaJ OS=Salmonella paratyphi A (strain ATCC 9150 / SARB42) GN=dnaJ PE=3 SV=3 73 143 4.0E-07
sp|P0A1G7|DNAJ_SALTY Chaperone protein DnaJ OS=Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) GN=dnaJ PE=3 SV=2 73 143 5.0E-07
sp|P0A1G8|DNAJ_SALTI Chaperone protein DnaJ OS=Salmonella typhi GN=dnaJ PE=3 SV=2 73 143 5.0E-07
sp|B4TVZ6|DNAJ_SALSV Chaperone protein DnaJ OS=Salmonella schwarzengrund (strain CVM19633) GN=dnaJ PE=3 SV=1 73 143 5.0E-07
sp|C0Q4F4|DNAJ_SALPC Chaperone protein DnaJ OS=Salmonella paratyphi C (strain RKS4594) GN=dnaJ PE=3 SV=1 73 143 5.0E-07
sp|A9MXI3|DNAJ_SALPB Chaperone protein DnaJ OS=Salmonella paratyphi B (strain ATCC BAA-1250 / SPB7) GN=dnaJ PE=3 SV=1 73 143 5.0E-07
sp|B4T6D7|DNAJ_SALNS Chaperone protein DnaJ OS=Salmonella newport (strain SL254) GN=dnaJ PE=3 SV=1 73 143 5.0E-07
sp|B4TIB5|DNAJ_SALHS Chaperone protein DnaJ OS=Salmonella heidelberg (strain SL476) GN=dnaJ PE=3 SV=1 73 143 5.0E-07
sp|B5RF09|DNAJ_SALG2 Chaperone protein DnaJ OS=Salmonella gallinarum (strain 287/91 / NCTC 13346) GN=dnaJ PE=3 SV=1 73 143 5.0E-07
sp|B5R5I3|DNAJ_SALEP Chaperone protein DnaJ OS=Salmonella enteritidis PT4 (strain P125109) GN=dnaJ PE=3 SV=1 73 143 5.0E-07
sp|B5FHA7|DNAJ_SALDC Chaperone protein DnaJ OS=Salmonella dublin (strain CT_02021853) GN=dnaJ PE=3 SV=1 73 143 5.0E-07
sp|Q57TP2|DNAJ_SALCH Chaperone protein DnaJ OS=Salmonella choleraesuis (strain SC-B67) GN=dnaJ PE=3 SV=3 73 143 5.0E-07
sp|B5F6Y9|DNAJ_SALA4 Chaperone protein DnaJ OS=Salmonella agona (strain SL483) GN=dnaJ PE=3 SV=1 73 143 5.0E-07
sp|B6EKA0|DNAJ_ALISL Chaperone protein DnaJ OS=Aliivibrio salmonicida (strain LFI1238) GN=dnaJ PE=3 SV=1 77 143 6.0E-07
sp|Q32KA4|DNAJ_SHIDS Chaperone protein DnaJ OS=Shigella dysenteriae serotype 1 (strain Sd197) GN=dnaJ PE=3 SV=1 73 143 6.0E-07
sp|Q0HY10|DNAJ_SHESR Chaperone protein DnaJ OS=Shewanella sp. (strain MR-7) GN=dnaJ PE=3 SV=1 77 148 6.0E-07
sp|Q0HLM9|DNAJ_SHESM Chaperone protein DnaJ OS=Shewanella sp. (strain MR-4) GN=dnaJ PE=3 SV=1 77 148 6.0E-07
sp|Q326K6|DNAJ_SHIBS Chaperone protein DnaJ OS=Shigella boydii serotype 4 (strain Sb227) GN=dnaJ PE=3 SV=1 73 143 6.0E-07
sp|B2U233|DNAJ_SHIB3 Chaperone protein DnaJ OS=Shigella boydii serotype 18 (strain CDC 3083-94 / BS512) GN=dnaJ PE=3 SV=1 73 143 6.0E-07
sp|Q11KJ5|DNAJ_CHESB Chaperone protein DnaJ OS=Chelativorans sp. (strain BNC1) GN=dnaJ PE=3 SV=1 77 143 6.0E-07
sp|Q3SIN3|DNAJ_THIDA Chaperone protein DnaJ OS=Thiobacillus denitrificans (strain ATCC 25259) GN=dnaJ PE=3 SV=1 77 150 6.0E-07
sp|Q3Z600|DNAJ_SHISS Chaperone protein DnaJ OS=Shigella sonnei (strain Ss046) GN=dnaJ PE=3 SV=1 73 143 6.0E-07
sp|B7LVP7|DNAJ_ESCF3 Chaperone protein DnaJ OS=Escherichia fergusonii (strain ATCC 35469 / DSM 13698 / CDC 0568-73) GN=dnaJ PE=3 SV=1 73 143 6.0E-07
sp|Q1RGI7|DNAJ_ECOUT Chaperone protein DnaJ OS=Escherichia coli (strain UTI89 / UPEC) GN=dnaJ PE=3 SV=1 73 143 6.0E-07
sp|B1LFU5|DNAJ_ECOSM Chaperone protein DnaJ OS=Escherichia coli (strain SMS-3-5 / SECEC) GN=dnaJ PE=3 SV=1 73 143 6.0E-07
sp|B6HZ11|DNAJ_ECOSE Chaperone protein DnaJ OS=Escherichia coli (strain SE11) GN=dnaJ PE=3 SV=1 73 143 6.0E-07
sp|B7N7N9|DNAJ_ECOLU Chaperone protein DnaJ OS=Escherichia coli O17:K52:H18 (strain UMN026 / ExPEC) GN=dnaJ PE=3 SV=1 73 143 6.0E-07
sp|B1IRF9|DNAJ_ECOLC Chaperone protein DnaJ OS=Escherichia coli (strain ATCC 8739 / DSM 1576 / Crooks) GN=dnaJ PE=3 SV=1 73 143 6.0E-07
sp|Q8FLC5|DNAJ_ECOL6 Chaperone protein DnaJ OS=Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC) GN=dnaJ PE=3 SV=3 73 143 6.0E-07
sp|A7ZVV8|DNAJ_ECOHS Chaperone protein DnaJ OS=Escherichia coli O9:H4 (strain HS) GN=dnaJ PE=3 SV=1 73 143 6.0E-07
sp|B7M0B1|DNAJ_ECO8A Chaperone protein DnaJ OS=Escherichia coli O8 (strain IAI1) GN=dnaJ PE=3 SV=1 73 143 6.0E-07
sp|B7MNM2|DNAJ_ECO81 Chaperone protein DnaJ OS=Escherichia coli O81 (strain ED1a) GN=dnaJ PE=3 SV=1 73 143 6.0E-07
sp|B7NHB7|DNAJ_ECO7I Chaperone protein DnaJ OS=Escherichia coli O7:K1 (strain IAI39 / ExPEC) GN=dnaJ PE=3 SV=1 73 143 6.0E-07
sp|Q8XA65|DNAJ_ECO57 Chaperone protein DnaJ OS=Escherichia coli O157:H7 GN=dnaJ PE=3 SV=3 73 143 6.0E-07
sp|B7L4D9|DNAJ_ECO55 Chaperone protein DnaJ OS=Escherichia coli (strain 55989 / EAEC) GN=dnaJ PE=3 SV=1 73 143 6.0E-07
sp|B7MAD6|DNAJ_ECO45 Chaperone protein DnaJ OS=Escherichia coli O45:K1 (strain S88 / ExPEC) GN=dnaJ PE=3 SV=1 73 143 6.0E-07
sp|B7UI60|DNAJ_ECO27 Chaperone protein DnaJ OS=Escherichia coli O127:H6 (strain E2348/69 / EPEC) GN=dnaJ PE=3 SV=1 73 143 6.0E-07
sp|A7ZHA5|DNAJ_ECO24 Chaperone protein DnaJ OS=Escherichia coli O139:H28 (strain E24377A / ETEC) GN=dnaJ PE=3 SV=1 73 143 6.0E-07
sp|Q87WP1|DNAJ_PSESM Chaperone protein DnaJ OS=Pseudomonas syringae pv. tomato (strain DC3000) GN=dnaJ PE=3 SV=1 77 148 6.0E-07
sp|A0KTS6|DNAJ_SHESA Chaperone protein DnaJ OS=Shewanella sp. (strain ANA-3) GN=dnaJ PE=3 SV=1 77 148 7.0E-07
sp|Q8EHT6|DNAJ_SHEON Chaperone protein DnaJ OS=Shewanella oneidensis (strain MR-1) GN=dnaJ PE=3 SV=1 77 148 7.0E-07
sp|Q12Q07|DNAJ_SHEDO Chaperone protein DnaJ OS=Shewanella denitrificans (strain OS217 / ATCC BAA-1090 / DSM 15013) GN=dnaJ PE=3 SV=1 77 148 8.0E-07
sp|P50027|DNAJH_SYNY3 DnAJ-like protein slr0093 OS=Synechocystis sp. (strain PCC 6803 / Kazusa) GN=slr0093 PE=3 SV=1 77 154 8.0E-07
sp|Q2KDW7|DNAJ_RHIEC Chaperone protein DnaJ OS=Rhizobium etli (strain CFN 42 / ATCC 51251) GN=dnaJ PE=3 SV=1 73 143 1.0E-06
sp|A8FYT9|DNAJ_SHESH Chaperone protein DnaJ OS=Shewanella sediminis (strain HAW-EB3) GN=dnaJ PE=3 SV=1 77 148 1.0E-06
sp|Q15UD2|DNAJ_PSEA6 Chaperone protein DnaJ OS=Pseudoalteromonas atlantica (strain T6c / ATCC BAA-1087) GN=dnaJ PE=3 SV=1 77 148 1.0E-06
sp|B1ZGR2|DNAJ_METPB Chaperone protein DnaJ OS=Methylobacterium populi (strain ATCC BAA-705 / NCIMB 13946 / BJ001) GN=dnaJ PE=3 SV=1 77 143 1.0E-06
sp|A1WAR7|DNAJ_ACISJ Chaperone protein DnaJ OS=Acidovorax sp. (strain JS42) GN=dnaJ PE=3 SV=1 77 148 1.0E-06
sp|Q1MN12|DNAJ_RHIL3 Chaperone protein DnaJ OS=Rhizobium leguminosarum bv. viciae (strain 3841) GN=dnaJ PE=3 SV=1 73 143 1.0E-06
sp|Q87RX2|DNAJ_VIBPA Chaperone protein DnaJ OS=Vibrio parahaemolyticus serotype O3:K6 (strain RIMD 2210633) GN=dnaJ PE=3 SV=1 77 143 1.0E-06
sp|B7KSZ5|DNAJ_METC4 Chaperone protein DnaJ OS=Methylobacterium extorquens (strain CM4 / NCIMB 13688) GN=dnaJ PE=3 SV=1 77 143 1.0E-06
sp|A9W6R8|DNAJ_METEP Chaperone protein DnaJ OS=Methylobacterium extorquens (strain PA1) GN=dnaJ PE=3 SV=1 77 143 1.0E-06
sp|Q9FYB5|DNJ11_ARATH Chaperone protein dnaJ 11, chloroplastic OS=Arabidopsis thaliana GN=ATJ11 PE=1 SV=2 55 141 1.0E-06
sp|Q5FSL4|DNAJ_GLUOX Chaperone protein DnaJ OS=Gluconobacter oxydans (strain 621H) GN=dnaJ PE=3 SV=1 77 148 1.0E-06
sp|B5ZWQ1|DNAJ_RHILW Chaperone protein DnaJ OS=Rhizobium leguminosarum bv. trifolii (strain WSM2304) GN=dnaJ PE=3 SV=1 73 143 1.0E-06
sp|B3PXH2|DNAJ_RHIE6 Chaperone protein DnaJ OS=Rhizobium etli (strain CIAT 652) GN=dnaJ PE=3 SV=1 73 143 1.0E-06
sp|Q98DD2|DNAJ_RHILO Chaperone protein DnaJ OS=Rhizobium loti (strain MAFF303099) GN=dnaJ PE=3 SV=1 77 143 1.0E-06
sp|Q6VAY5|DNAJ_PSEST Chaperone protein DnaJ OS=Pseudomonas stutzeri GN=dnaJ PE=3 SV=1 77 150 1.0E-06
sp|A3QGW1|DNAJ_SHELP Chaperone protein DnaJ OS=Shewanella loihica (strain ATCC BAA-1088 / PV-4) GN=dnaJ PE=3 SV=1 77 148 2.0E-06
sp|Q0T8H5|DNAJ_SHIF8 Chaperone protein DnaJ OS=Shigella flexneri serotype 5b (strain 8401) GN=dnaJ PE=3 SV=1 73 143 2.0E-06
sp|Q4ZNP8|DNAJ_PSEU2 Chaperone protein DnaJ OS=Pseudomonas syringae pv. syringae (strain B728a) GN=dnaJ PE=3 SV=1 77 148 2.0E-06
sp|P08622|DNAJ_ECOLI Chaperone protein DnaJ OS=Escherichia coli (strain K12) GN=dnaJ PE=1 SV=3 73 143 2.0E-06
sp|B1XBE0|DNAJ_ECODH Chaperone protein DnaJ OS=Escherichia coli (strain K12 / DH10B) GN=dnaJ PE=3 SV=1 73 143 2.0E-06
sp|Q7UDU1|DNAJ_SHIFL Chaperone protein DnaJ OS=Shigella flexneri GN=dnaJ PE=3 SV=3 73 143 2.0E-06
sp|Q48E63|DNAJ_PSE14 Chaperone protein DnaJ OS=Pseudomonas savastanoi pv. phaseolicola (strain 1448A / Race 6) GN=dnaJ PE=3 SV=1 77 148 2.0E-06
sp|P22305|DNAJ_CAUCR Chaperone protein DnaJ OS=Caulobacter crescentus (strain ATCC 19089 / CB15) GN=dnaJ PE=3 SV=2 77 143 2.0E-06
sp|B5YYA8|DNAJ_ECO5E Chaperone protein DnaJ OS=Escherichia coli O157:H7 (strain EC4115 / EHEC) GN=dnaJ PE=3 SV=1 73 143 2.0E-06
sp|B1KRT1|DNAJ_SHEWM Chaperone protein DnaJ OS=Shewanella woodyi (strain ATCC 51908 / MS32) GN=dnaJ PE=3 SV=1 77 148 2.0E-06
sp|O34136|DNAJ_DEIPM Chaperone protein DnaJ OS=Deinococcus proteolyticus (strain ATCC 35074 / DSM 20540 / JCM 6276 / NBRC 101906 / NCIMB 13154 / VKM Ac-1939 / CCM 2703 / MRP) GN=dnaJ PE=3 SV=2 73 143 2.0E-06
sp|C3MC05|DNAJ_RHISN Chaperone protein DnaJ OS=Rhizobium sp. (strain NGR234) GN=dnaJ PE=3 SV=1 77 143 2.0E-06
sp|O33529|DNAJ_RHILE Chaperone protein DnaJ (Fragment) OS=Rhizobium leguminosarum GN=dnaJ PE=3 SV=1 73 143 2.0E-06
sp|C4ZPU1|DNAJ_ECOBW Chaperone protein DnaJ OS=Escherichia coli (strain K12 / MC4100 / BW2952) GN=dnaJ PE=3 SV=1 77 143 2.0E-06
sp|Q68XI3|DNAJ_RICTY Chaperone protein DnaJ OS=Rickettsia typhi (strain ATCC VR-144 / Wilmington) GN=dnaJ PE=3 SV=1 74 151 2.0E-06
sp|B9MDJ8|DNAJ_ACIET Chaperone protein DnaJ OS=Acidovorax ebreus (strain TPSY) GN=dnaJ PE=3 SV=1 77 148 3.0E-06
sp|C6DF09|DNAJ_PECCP Chaperone protein DnaJ OS=Pectobacterium carotovorum subsp. carotovorum (strain PC1) GN=dnaJ PE=3 SV=1 73 143 3.0E-06
sp|O87385|DNAJ_VIBHA Chaperone protein DnaJ OS=Vibrio harveyi GN=dnaJ PE=3 SV=1 77 143 3.0E-06
sp|B8CKF4|DNAJ_SHEPW Chaperone protein DnaJ OS=Shewanella piezotolerans (strain WP3 / JCM 13877) GN=dnaJ PE=3 SV=1 77 148 3.0E-06
sp|A1S8K6|DNAJ_SHEAM Chaperone protein DnaJ OS=Shewanella amazonensis (strain ATCC BAA-1098 / SB2B) GN=dnaJ PE=3 SV=1 77 148 3.0E-06
sp|Q4UJK6|DNAJ_RICFE Chaperone protein DnaJ OS=Rickettsia felis (strain ATCC VR-1525 / URRWXCal2) GN=dnaJ PE=3 SV=1 77 151 3.0E-06
sp|Q87BS9|DNAJ_XYLFT Chaperone protein DnaJ OS=Xylella fastidiosa (strain Temecula1 / ATCC 700964) GN=dnaJ PE=3 SV=1 77 143 3.0E-06
sp|B2I6F5|DNAJ_XYLF2 Chaperone protein DnaJ OS=Xylella fastidiosa (strain M23) GN=dnaJ PE=3 SV=1 77 143 3.0E-06
sp|Q7MN84|DNAJ_VIBVY Chaperone protein DnaJ OS=Vibrio vulnificus (strain YJ016) GN=dnaJ PE=3 SV=2 77 143 4.0E-06
sp|Q8DF67|DNAJ_VIBVU Chaperone protein DnaJ OS=Vibrio vulnificus (strain CMCP6) GN=dnaJ PE=3 SV=1 77 143 4.0E-06
sp|Q7N8Y3|DNAJ_PHOLL Chaperone protein DnaJ OS=Photorhabdus luminescens subsp. laumondii (strain TT01) GN=dnaJ PE=3 SV=1 73 143 4.0E-06
sp|B0U3J7|DNAJ_XYLFM Chaperone protein DnaJ OS=Xylella fastidiosa (strain M12) GN=dnaJ PE=3 SV=1 77 143 4.0E-06
sp|Q9PB06|DNAJ_XYLFA Chaperone protein DnaJ OS=Xylella fastidiosa (strain 9a5c) GN=dnaJ PE=3 SV=1 77 143 4.0E-06
sp|B8IHL2|DNAJ_METNO Chaperone protein DnaJ OS=Methylobacterium nodulans (strain ORS2060 / LMG 21967) GN=dnaJ PE=3 SV=1 77 143 4.0E-06
sp|A7MWW1|DNAJ_VIBCB Chaperone protein DnaJ OS=Vibrio campbellii (strain ATCC BAA-1116 / BB120) GN=dnaJ PE=3 SV=1 77 143 4.0E-06
sp|Q086J2|DNAJ_SHEFN Chaperone protein DnaJ OS=Shewanella frigidimarina (strain NCIMB 400) GN=dnaJ PE=3 SV=1 77 148 4.0E-06
sp|B8GNX2|DNAJ_THISH Chaperone protein DnaJ OS=Thioalkalivibrio sulfidiphilus (strain HL-EbGR7) GN=dnaJ PE=3 SV=1 77 148 4.0E-06
sp|Q5R9A4|DNJB9_PONAB DnaJ homolog subfamily B member 9 OS=Pongo abelii GN=DNAJB9 PE=2 SV=1 73 143 5.0E-06
sp|A4Y9Q2|DNAJ_SHEPC Chaperone protein DnaJ OS=Shewanella putrefaciens (strain CN-32 / ATCC BAA-453) GN=dnaJ PE=3 SV=1 77 148 5.0E-06
sp|A1RGN2|DNAJ_SHESW Chaperone protein DnaJ OS=Shewanella sp. (strain W3-18-1) GN=dnaJ PE=3 SV=1 77 148 5.0E-06
sp|B4F2V6|DNAJ_PROMH Chaperone protein DnaJ OS=Proteus mirabilis (strain HI4320) GN=dnaJ PE=3 SV=1 73 143 5.0E-06
sp|A9L0R7|DNAJ_SHEB9 Chaperone protein DnaJ OS=Shewanella baltica (strain OS195) GN=dnaJ PE=3 SV=1 77 148 6.0E-06
sp|A6WRU8|DNAJ_SHEB8 Chaperone protein DnaJ OS=Shewanella baltica (strain OS185) GN=dnaJ PE=3 SV=1 77 148 6.0E-06
sp|A3D7T3|DNAJ_SHEB5 Chaperone protein DnaJ OS=Shewanella baltica (strain OS155 / ATCC BAA-1091) GN=dnaJ PE=3 SV=1 77 148 6.0E-06
sp|B8E4S2|DNAJ_SHEB2 Chaperone protein DnaJ OS=Shewanella baltica (strain OS223) GN=dnaJ PE=3 SV=1 77 148 6.0E-06
sp|Q9UBS3|DNJB9_HUMAN DnaJ homolog subfamily B member 9 OS=Homo sapiens GN=DNAJB9 PE=1 SV=1 73 143 6.0E-06
sp|B0U833|DNAJ_METS4 Chaperone protein DnaJ OS=Methylobacterium sp. (strain 4-46) GN=dnaJ PE=3 SV=1 77 143 6.0E-06
sp|A8G9K9|DNAJ_SERP5 Chaperone protein DnaJ OS=Serratia proteamaculans (strain 568) GN=dnaJ PE=3 SV=1 73 143 7.0E-06
sp|Q6D0B8|DNAJ_PECAS Chaperone protein DnaJ OS=Pectobacterium atrosepticum (strain SCRI 1043 / ATCC BAA-672) GN=dnaJ PE=3 SV=1 73 143 8.0E-06
[Show less]

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 24 0.5

Transmembrane Domains

Domain # Start End Length
1 7 29 22

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >OphauB2|7131
MSQFLSYIGWWFLPNLVTSWVQAIYYAVVIRAGDPKPAPGSARHEYHQRIIKILVVAAYLVYSVYEADYELRAAP
TFYQELSLPVTASERDIKSRFRRLAALHHPDKAGSGSDNAAAAMFIHLKLASDTLQDAARRFAYERFGPDVVDWQ
KCVTIRDHVSRGVLSGILPHYAVIAAANYALGLAGYLSFGKFYRWLIVAIILVFELHTVTRPTFTPPINLLNAIV
TRLTSRPPYLPFQVIQLTRRISVTVYIAIVQIGPLLVQHFQGRQQLPPDSDMALQQGIQRLETMSRQLDTDATRL
MDTQLAPFKGDVEAINNLRGKVREWLVQNTIRADPMVRDALGSSLRRRRMDVPSGARGNR*
Coding >OphauB2|7131
ATGTCTCAGTTCCTCTCCTACATAGGCTGGTGGTTTCTGCCCAATTTGGTCACGTCATGGGTACAGGCAATCTAT
TATGCCGTCGTCATTCGCGCTGGTGACCCCAAGCCGGCTCCAGGCTCTGCCCGCCACGAGTACCACCAGCGAATC
ATCAAGATTCTCGTCGTTGCTGCCTACCTTGTCTACTCCGTTTACGAAGCCGACTATGAGTTGCGCGCCGCCCCT
ACCTTCTATCAAGAACTCTCGCTTCCTGTAACGGCCAGTGAACGAGACATCAAGTCCCGCTTCCGCCGTCTTGCC
GCTCTCCATCATCCCGACAAGGCCGGCTCTGGCAGCGACAATGCTGCTGCTGCCATGTTTATCCACCTCAAACTC
GCCAGCGACACCCTGCAAGATGCTGCTCGCCGCTTTGCCTATGAGCGCTTTGGCCCAGACGTGGTGGACTGGCAG
AAATGCGTCACGATTCGCGACCATGTCAGCCGTGGCGTCCTCTCGGGCATTTTGCCACACTATGCCGTCATAGCC
GCTGCAAACTATGCTCTGGGGCTCGCCGGCTATCTCAGCTTTGGCAAATTCTACCGCTGGCTCATTGTAGCCATC
ATCTTGGTCTTTGAGTTACACACGGTTACCCGCCCGACCTTTACGCCTCCAATCAATCTGCTCAATGCTATTGTC
ACGCGCCTGACGAGTCGCCCACCCTATCTTCCATTTCAAGTAATACAACTCACGCGCAGAATCTCCGTCACTGTG
TACATTGCCATTGTGCAGATTGGTCCTTTGCTGGTGCAGCATTTCCAAGGTCGGCAACAGCTCCCGCCAGATAGT
GACATGGCGCTGCAGCAAGGTATCCAACGCCTCGAGACCATGTCACGCCAGCTCGACACAGATGCTACACGCCTC
ATGGACACGCAGCTTGCGCCATTCAAGGGCGACGTTGAGGCCATTAACAATCTCCGAGGCAAAGTTCGCGAGTGG
CTGGTGCAGAATACGATACGCGCCGACCCCATGGTTCGAGACGCCCTGGGGTCATCGCTGCGCCGGAGACGGATG
GACGTTCCCAGCGGTGCTCGAGGCAATCGATAG
Transcript >OphauB2|7131
ATGTCTCAGTTCCTCTCCTACATAGGCTGGTGGTTTCTGCCCAATTTGGTCACGTCATGGGTACAGGCAATCTAT
TATGCCGTCGTCATTCGCGCTGGTGACCCCAAGCCGGCTCCAGGCTCTGCCCGCCACGAGTACCACCAGCGAATC
ATCAAGATTCTCGTCGTTGCTGCCTACCTTGTCTACTCCGTTTACGAAGCCGACTATGAGTTGCGCGCCGCCCCT
ACCTTCTATCAAGAACTCTCGCTTCCTGTAACGGCCAGTGAACGAGACATCAAGTCCCGCTTCCGCCGTCTTGCC
GCTCTCCATCATCCCGACAAGGCCGGCTCTGGCAGCGACAATGCTGCTGCTGCCATGTTTATCCACCTCAAACTC
GCCAGCGACACCCTGCAAGATGCTGCTCGCCGCTTTGCCTATGAGCGCTTTGGCCCAGACGTGGTGGACTGGCAG
AAATGCGTCACGATTCGCGACCATGTCAGCCGTGGCGTCCTCTCGGGCATTTTGCCACACTATGCCGTCATAGCC
GCTGCAAACTATGCTCTGGGGCTCGCCGGCTATCTCAGCTTTGGCAAATTCTACCGCTGGCTCATTGTAGCCATC
ATCTTGGTCTTTGAGTTACACACGGTTACCCGCCCGACCTTTACGCCTCCAATCAATCTGCTCAATGCTATTGTC
ACGCGCCTGACGAGTCGCCCACCCTATCTTCCATTTCAAGTAATACAACTCACGCGCAGAATCTCCGTCACTGTG
TACATTGCCATTGTGCAGATTGGTCCTTTGCTGGTGCAGCATTTCCAAGGTCGGCAACAGCTCCCGCCAGATAGT
GACATGGCGCTGCAGCAAGGTATCCAACGCCTCGAGACCATGTCACGCCAGCTCGACACAGATGCTACACGCCTC
ATGGACACGCAGCTTGCGCCATTCAAGGGCGACGTTGAGGCCATTAACAATCTCCGAGGCAAAGTTCGCGAGTGG
CTGGTGCAGAATACGATACGCGCCGACCCCATGGTTCGAGACGCCCTGGGGTCATCGCTGCGCCGGAGACGGATG
GACGTTCCCAGCGGTGCTCGAGGCAATCGATAG
Gene >OphauB2|7131
ATGTCTCAGTTCCTCTCCTACATAGGCTGGTGGTTTCTGCCCAATGTACTCGAGCACATCATTCTCCAGCTTGTC
TAGTTGCTGCTGACCACGAGCCACAGTTGGTCACGTCATGGGTACAGGCAATCTATTATGCCGTCGTCATTCGCG
CTGGTGACCCCAAGCCGGCTCCAGGCTCTGCCCGCCACGAGTACCACCAGCGAATCATCAAGATTCTCGTCGTTG
CTGCCTACCTTGTCTACTCCGTTTACGAAGCCGACTATGAGTTGCGCGCCGCCCCTACCTTCTATCAAGAACTCT
CGCTTCCTGTAACGGCCAGTGAACGAGACATCAAGTCCCGCTTCCGCCGTCTTGCCGCTCTCCATCATCCCGACA
AGGCCGGCTCTGGCAGCGACAATGCTGCTGCTGCCATGTTTATCCACCTCAAACTCGCCAGCGACACCCTGCAAG
ATGCTGCTCGCCGCTTTGCCTATGAGCGCTTTGGCCCAGACGTGGTGGACTGGCAGAAATGCGTCACGATTCGCG
ACCATGTCAGCCGTGGCGTCCTCTCGGGCATTTTGCCACACTATGCCGTCATAGCCGCTGCAAACTATGCTCTGG
GGCTCGCCGGCTATCTCAGCTTTGGCAAATTCTACCGCTGGCTCATTGTAGCCATCATCTTGGTCTTTGAGTTAC
ACACGGTTACCCGCCCGACCTTTACGCCTCCAATCAATCTGCTCAATGCTATTGTCACGCGCCTGACGAGTCGCC
CACCCTATCTTCCATTTCAAGTAATACAACTCACGCGCAGAATCTCCGTCACTGTGTACATTGCCATTGTGCAGA
TTGGTCCTTTGCTGGTGCAGCATTTCCAAGGTCGGCAACAGCTCCCGCCAGATAGTGACATGGCGCTGCAGCAAG
GTATCCAACGCCTCGAGACCATGTCACGCCAGCTCGACACAGATGCTACACGCCTCATGGACACGCAGCTTGCGC
CATTCAAGGGCGACGTTGAGGCCATTAACAATCTCCGAGGCAAAGTTCGCGAGTGGCTGGTGCAGAATACGATAC
GCGCCGACCCCATGGTTCGAGACGCCCTGGGGTCATCGCTGCGCCGGAGACGGATGGACGTTCCCAGCGGTGCTC
GAGGCAATCGATAG

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail