Fungal Genomics

at Utrecht University

General Properties

Protein IDOphauB2|7112
Gene name
LocationContig_71:57157..58438
Strand-
Gene length (bp)1281
Transcript length (bp)1281
Coding sequence length (bp)1281
Protein length (aa) 427

Your browser does not support drawing a protein figure.

PFAM Domains

(None)

Swissprot hits

Swissprot ID Swissprot Description Start End E-value
sp|D4AUX6|A8043_ARTBC Uncharacterized secreted protein ARB_08043 OS=Arthroderma benhamiae (strain ATCC MYA-4681 / CBS 112371) GN=ARB_08043 PE=1 SV=1 55 402 6.0E-122
sp|D4AK17|PLCX1_ARTBC PI-PLC X domain-containing protein 1 OS=Arthroderma benhamiae (strain ATCC MYA-4681 / CBS 112371) GN=ARB_04618 PE=1 SV=1 104 388 4.0E-61

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
Yes 1 - 21 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >OphauB2|7112
MALVWRQRLLLLLLPTAVVCQSVTFSGGTSDLTFVQGSRTESVSQPTGPPSGAYSTYASKVTLTGSPSNTNLTAT
MTSSSTMTTGTNSTQTASATEPPRNTQPCNNYLELCTRKYSNITNVAAHNSPFVRPGNSGSNQELPVKTQLNDGV
RFLQAQIQWPVNGSVPHFCHTTCDLLDAGPINEWLTQVREWIDVHPYDVVTILLGNGNYSTPDLYVPYIERSGIL
KYTYEAPFLPMALADWPTLEEMILRGKRVVMFLDYMADEHKYPWLLDQFSQMWETPFDPLDGNFPCTVQRPPDLA
PEAARDRLYLMNHNLNVEFNVFDAQILVPAVALLNETNAANGTGSVGLAANNCRAEWGRAPNFLNVDYYNYGSPP
GSVFEAAARVNNVTYNRPCCGKVSLAALVDYRSAWQPAMVTAAFLAVFLML*
Coding >OphauB2|7112
ATGGCTCTCGTGTGGCGGCAACGCTTGCTGCTGCTGCTGCTGCCGACCGCTGTTGTGTGCCAGTCGGTCACGTTT
AGCGGCGGCACTTCAGACCTGACCTTTGTCCAAGGATCACGCACCGAGTCGGTGTCGCAGCCCACGGGGCCGCCA
TCCGGCGCCTACAGCACTTATGCCTCCAAGGTGACGCTGACGGGGTCGCCGAGCAACACGAATCTGACAGCCACC
ATGACCTCGTCGAGCACAATGACGACGGGCACCAACTCGACGCAGACGGCATCGGCAACGGAGCCACCGCGCAAC
ACGCAGCCCTGCAACAACTATCTCGAGCTCTGTACGCGCAAGTACAGCAACATTACAAACGTGGCTGCCCACAAC
TCGCCCTTTGTACGGCCCGGCAACTCTGGCTCCAACCAGGAGCTGCCCGTCAAGACGCAGCTCAACGATGGCGTC
CGCTTCTTGCAGGCTCAGATTCAGTGGCCCGTCAATGGATCCGTGCCGCACTTTTGCCACACGACGTGCGACCTG
CTGGATGCCGGGCCCATCAACGAGTGGCTGACACAGGTTCGCGAATGGATCGACGTGCATCCCTATGATGTCGTC
ACCATTCTGCTGGGCAACGGCAACTACTCGACGCCCGACTTGTACGTGCCATATATTGAGCGCTCGGGCATTCTC
AAGTACACATACGAGGCGCCCTTTTTGCCCATGGCCTTGGCCGACTGGCCCACGCTCGAGGAAATGATTTTGCGC
GGCAAGCGCGTCGTCATGTTTCTCGACTACATGGCCGACGAGCACAAGTATCCCTGGCTGCTGGACCAGTTTTCG
CAAATGTGGGAGACTCCCTTTGATCCTCTAGATGGCAACTTTCCCTGTACCGTTCAGCGCCCGCCCGACCTGGCA
CCCGAGGCAGCGCGCGACCGTCTCTATCTCATGAACCACAACCTCAATGTCGAGTTTAATGTCTTTGACGCTCAG
ATCCTGGTGCCCGCTGTGGCTCTGCTCAACGAGACAAACGCGGCCAATGGCACCGGCAGTGTCGGCCTCGCGGCC
AATAACTGCCGCGCCGAATGGGGCCGCGCGCCCAATTTTCTCAATGTCGACTACTACAACTATGGCTCGCCGCCG
GGATCTGTCTTTGAGGCGGCGGCCCGCGTCAATAATGTCACATATAACCGGCCCTGCTGCGGCAAGGTCTCGCTG
GCGGCCCTGGTGGATTATAGAAGTGCATGGCAGCCAGCAATGGTTACGGCGGCCTTTTTGGCCGTCTTTTTGATG
TTGTGA
Transcript >OphauB2|7112
ATGGCTCTCGTGTGGCGGCAACGCTTGCTGCTGCTGCTGCTGCCGACCGCTGTTGTGTGCCAGTCGGTCACGTTT
AGCGGCGGCACTTCAGACCTGACCTTTGTCCAAGGATCACGCACCGAGTCGGTGTCGCAGCCCACGGGGCCGCCA
TCCGGCGCCTACAGCACTTATGCCTCCAAGGTGACGCTGACGGGGTCGCCGAGCAACACGAATCTGACAGCCACC
ATGACCTCGTCGAGCACAATGACGACGGGCACCAACTCGACGCAGACGGCATCGGCAACGGAGCCACCGCGCAAC
ACGCAGCCCTGCAACAACTATCTCGAGCTCTGTACGCGCAAGTACAGCAACATTACAAACGTGGCTGCCCACAAC
TCGCCCTTTGTACGGCCCGGCAACTCTGGCTCCAACCAGGAGCTGCCCGTCAAGACGCAGCTCAACGATGGCGTC
CGCTTCTTGCAGGCTCAGATTCAGTGGCCCGTCAATGGATCCGTGCCGCACTTTTGCCACACGACGTGCGACCTG
CTGGATGCCGGGCCCATCAACGAGTGGCTGACACAGGTTCGCGAATGGATCGACGTGCATCCCTATGATGTCGTC
ACCATTCTGCTGGGCAACGGCAACTACTCGACGCCCGACTTGTACGTGCCATATATTGAGCGCTCGGGCATTCTC
AAGTACACATACGAGGCGCCCTTTTTGCCCATGGCCTTGGCCGACTGGCCCACGCTCGAGGAAATGATTTTGCGC
GGCAAGCGCGTCGTCATGTTTCTCGACTACATGGCCGACGAGCACAAGTATCCCTGGCTGCTGGACCAGTTTTCG
CAAATGTGGGAGACTCCCTTTGATCCTCTAGATGGCAACTTTCCCTGTACCGTTCAGCGCCCGCCCGACCTGGCA
CCCGAGGCAGCGCGCGACCGTCTCTATCTCATGAACCACAACCTCAATGTCGAGTTTAATGTCTTTGACGCTCAG
ATCCTGGTGCCCGCTGTGGCTCTGCTCAACGAGACAAACGCGGCCAATGGCACCGGCAGTGTCGGCCTCGCGGCC
AATAACTGCCGCGCCGAATGGGGCCGCGCGCCCAATTTTCTCAATGTCGACTACTACAACTATGGCTCGCCGCCG
GGATCTGTCTTTGAGGCGGCGGCCCGCGTCAATAATGTCACATATAACCGGCCCTGCTGCGGCAAGGTCTCGCTG
GCGGCCCTGGTGGATTATAGAAGTGCATGGCAGCCAGCAATGGTTACGGCGGCCTTTTTGGCCGTCTTTTTGATG
TTGTGA
Gene >OphauB2|7112
ATGGCTCTCGTGTGGCGGCAACGCTTGCTGCTGCTGCTGCTGCCGACCGCTGTTGTGTGCCAGTCGGTCACGTTT
AGCGGCGGCACTTCAGACCTGACCTTTGTCCAAGGATCACGCACCGAGTCGGTGTCGCAGCCCACGGGGCCGCCA
TCCGGCGCCTACAGCACTTATGCCTCCAAGGTGACGCTGACGGGGTCGCCGAGCAACACGAATCTGACAGCCACC
ATGACCTCGTCGAGCACAATGACGACGGGCACCAACTCGACGCAGACGGCATCGGCAACGGAGCCACCGCGCAAC
ACGCAGCCCTGCAACAACTATCTCGAGCTCTGTACGCGCAAGTACAGCAACATTACAAACGTGGCTGCCCACAAC
TCGCCCTTTGTACGGCCCGGCAACTCTGGCTCCAACCAGGAGCTGCCCGTCAAGACGCAGCTCAACGATGGCGTC
CGCTTCTTGCAGGCTCAGATTCAGTGGCCCGTCAATGGATCCGTGCCGCACTTTTGCCACACGACGTGCGACCTG
CTGGATGCCGGGCCCATCAACGAGTGGCTGACACAGGTTCGCGAATGGATCGACGTGCATCCCTATGATGTCGTC
ACCATTCTGCTGGGCAACGGCAACTACTCGACGCCCGACTTGTACGTGCCATATATTGAGCGCTCGGGCATTCTC
AAGTACACATACGAGGCGCCCTTTTTGCCCATGGCCTTGGCCGACTGGCCCACGCTCGAGGAAATGATTTTGCGC
GGCAAGCGCGTCGTCATGTTTCTCGACTACATGGCCGACGAGCACAAGTATCCCTGGCTGCTGGACCAGTTTTCG
CAAATGTGGGAGACTCCCTTTGATCCTCTAGATGGCAACTTTCCCTGTACCGTTCAGCGCCCGCCCGACCTGGCA
CCCGAGGCAGCGCGCGACCGTCTCTATCTCATGAACCACAACCTCAATGTCGAGTTTAATGTCTTTGACGCTCAG
ATCCTGGTGCCCGCTGTGGCTCTGCTCAACGAGACAAACGCGGCCAATGGCACCGGCAGTGTCGGCCTCGCGGCC
AATAACTGCCGCGCCGAATGGGGCCGCGCGCCCAATTTTCTCAATGTCGACTACTACAACTATGGCTCGCCGCCG
GGATCTGTCTTTGAGGCGGCGGCCCGCGTCAATAATGTCACATATAACCGGCCCTGCTGCGGCAAGGTCTCGCTG
GCGGCCCTGGTGGATTATAGAAGTGCATGGCAGCCAGCAATGGTTACGGCGGCCTTTTTGGCCGTCTTTTTGATG
TTGTGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail