Fungal Genomics

at Utrecht University

General Properties

Protein IDOphauB2|710
Gene name
LocationContig_113:52650..53762
Strand-
Gene length (bp)1112
Transcript length (bp)1050
Coding sequence length (bp)1050
Protein length (aa) 350

Your browser does not support drawing a protein figure.

PFAM Domains

(None)

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q9Y7D0|LOVC_ASPTE Enoyl reductase LovC OS=Aspergillus terreus GN=lovC PE=1 SV=1 24 347 2.0E-50
sp|P54006|TOXD_COCCA Protein TOXD OS=Cochliobolus carbonum GN=TOXD PE=3 SV=1 24 248 6.0E-29
sp|Q9P7F4|YKK1_SCHPO Zinc-type alcohol dehydrogenase-like protein C2E1P3.01 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC2E1P3.01 PE=3 SV=1 25 347 1.0E-20
sp|P53912|YNN4_YEAST Uncharacterized protein YNL134C OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=YNL134C PE=1 SV=1 11 345 4.0E-18
sp|P54007|YL460_YEAST Uncharacterized protein YLR460C OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=YLR460C PE=1 SV=1 11 345 9.0E-13
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q9Y7D0|LOVC_ASPTE Enoyl reductase LovC OS=Aspergillus terreus GN=lovC PE=1 SV=1 24 347 2.0E-50
sp|P54006|TOXD_COCCA Protein TOXD OS=Cochliobolus carbonum GN=TOXD PE=3 SV=1 24 248 6.0E-29
sp|Q9P7F4|YKK1_SCHPO Zinc-type alcohol dehydrogenase-like protein C2E1P3.01 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC2E1P3.01 PE=3 SV=1 25 347 1.0E-20
sp|P53912|YNN4_YEAST Uncharacterized protein YNL134C OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=YNL134C PE=1 SV=1 11 345 4.0E-18
sp|P54007|YL460_YEAST Uncharacterized protein YLR460C OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=YLR460C PE=1 SV=1 11 345 9.0E-13
sp|P25608|YCZ2_YEAST Uncharacterized protein YCR102C OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=YCR102C PE=3 SV=1 11 345 1.0E-11
sp|P39945|AST2_YEAST Protein AST2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=AST2 PE=1 SV=1 8 251 3.0E-09
sp|P35183|AST1_YEAST Protein AST1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=AST1 PE=4 SV=2 8 190 1.0E-08
sp|Q924D0|RT4I1_MOUSE Reticulon-4-interacting protein 1, mitochondrial OS=Mus musculus GN=Rtn4ip1 PE=1 SV=2 9 347 1.0E-08
sp|Q7T3C7|RT4I1_DANRE Reticulon-4-interacting protein 1 homolog, mitochondrial OS=Danio rerio GN=rtn4ip1 PE=2 SV=2 9 212 7.0E-08
sp|Q8WWV3|RT4I1_HUMAN Reticulon-4-interacting protein 1, mitochondrial OS=Homo sapiens GN=RTN4IP1 PE=1 SV=2 9 225 1.0E-07
sp|P43903|QOR_PSEAE Quinone oxidoreductase OS=Pseudomonas aeruginosa (strain ATCC 15692 / PAO1 / 1C / PRS 101 / LMG 12228) GN=qor PE=3 SV=2 8 215 2.0E-07
sp|Q0VC50|RT4I1_BOVIN Reticulon-4-interacting protein 1, mitochondrial OS=Bos taurus GN=RTN4IP1 PE=2 SV=1 9 347 9.0E-07
[Show less]

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 12 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >OphauB2|710
MDTEPALPLAVSYSVSVPDISSPNHVLVRVRAVGLNPTDYKMLKGFNTPGLGAGCDFCGTVELAGAHAAMPAGTR
ICGAVFPYHAGNAANGAFSQWLVADSRLLLKVPDSWTDEQAAGLGAVGWSTASLCLSDPQALALQGLPSKPAEKH
TPVVVYGGATATGLMAIQLLKRSGYAPIAVCSPASSPLVIDCGAVATVAYTSPDCVETVKSIAAGAPIRQALDCI
TQAESASVCFGAIARTGGRYACLEEFHDSWRTRRAVKVKVVMGFEIEGVTVDLEHQVYTRKARPELLDLGVVWAR
EMQGLLDAGAIKTQPIREVQGGLEGVIKGLSALQRGEARGHKLVARVFE*
Coding >OphauB2|710
ATGGACACCGAGCCGGCTCTGCCGCTAGCGGTTTCCTACTCTGTCTCTGTGCCTGATATCTCATCTCCTAATCAC
GTCCTCGTGCGCGTACGGGCCGTGGGTCTGAATCCGACCGACTACAAGATGCTAAAGGGGTTTAACACGCCCGGT
CTGGGCGCTGGATGCGACTTTTGCGGCACTGTTGAGCTGGCTGGCGCGCATGCCGCGATGCCAGCGGGAACGAGG
ATCTGCGGTGCTGTGTTTCCCTATCACGCCGGAAATGCAGCCAACGGCGCATTCTCGCAGTGGCTTGTTGCTGAT
TCCCGCCTCCTGCTAAAGGTTCCAGATTCCTGGACTGACGAGCAGGCCGCCGGGCTTGGCGCTGTTGGCTGGTCA
ACGGCCTCCCTATGCCTCTCGGATCCGCAGGCGCTGGCACTCCAAGGGCTGCCGTCTAAGCCTGCGGAGAAGCAT
ACGCCTGTTGTGGTATATGGCGGTGCGACGGCGACTGGCCTGATGGCAATCCAACTGCTCAAGCGATCAGGCTAC
GCACCTATTGCTGTCTGCTCGCCGGCGTCCTCGCCCCTGGTGATTGACTGCGGGGCCGTGGCAACAGTGGCGTAC
ACGTCACCGGACTGCGTCGAGACGGTCAAGTCAATTGCCGCCGGTGCACCAATCAGACAGGCCCTAGACTGCATC
ACGCAAGCCGAGTCTGCGTCTGTCTGCTTTGGGGCAATAGCCCGCACAGGAGGCCGCTATGCCTGCCTAGAAGAG
TTTCACGACTCGTGGCGCACAAGACGTGCTGTCAAGGTCAAGGTAGTCATGGGCTTTGAGATTGAGGGCGTGACG
GTCGACTTGGAGCACCAAGTGTACACTCGAAAGGCCAGGCCCGAGCTGCTCGACTTGGGCGTGGTCTGGGCCAGG
GAGATGCAGGGGCTGCTTGATGCGGGGGCCATCAAGACCCAGCCGATTCGTGAGGTGCAGGGAGGGCTTGAGGGC
GTCATCAAGGGCTTGAGTGCGCTTCAGAGGGGTGAGGCTCGGGGGCACAAGCTAGTGGCGAGGGTGTTTGAGTGA
Transcript >OphauB2|710
ATGGACACCGAGCCGGCTCTGCCGCTAGCGGTTTCCTACTCTGTCTCTGTGCCTGATATCTCATCTCCTAATCAC
GTCCTCGTGCGCGTACGGGCCGTGGGTCTGAATCCGACCGACTACAAGATGCTAAAGGGGTTTAACACGCCCGGT
CTGGGCGCTGGATGCGACTTTTGCGGCACTGTTGAGCTGGCTGGCGCGCATGCCGCGATGCCAGCGGGAACGAGG
ATCTGCGGTGCTGTGTTTCCCTATCACGCCGGAAATGCAGCCAACGGCGCATTCTCGCAGTGGCTTGTTGCTGAT
TCCCGCCTCCTGCTAAAGGTTCCAGATTCCTGGACTGACGAGCAGGCCGCCGGGCTTGGCGCTGTTGGCTGGTCA
ACGGCCTCCCTATGCCTCTCGGATCCGCAGGCGCTGGCACTCCAAGGGCTGCCGTCTAAGCCTGCGGAGAAGCAT
ACGCCTGTTGTGGTATATGGCGGTGCGACGGCGACTGGCCTGATGGCAATCCAACTGCTCAAGCGATCAGGCTAC
GCACCTATTGCTGTCTGCTCGCCGGCGTCCTCGCCCCTGGTGATTGACTGCGGGGCCGTGGCAACAGTGGCGTAC
ACGTCACCGGACTGCGTCGAGACGGTCAAGTCAATTGCCGCCGGTGCACCAATCAGACAGGCCCTAGACTGCATC
ACGCAAGCCGAGTCTGCGTCTGTCTGCTTTGGGGCAATAGCCCGCACAGGAGGCCGCTATGCCTGCCTAGAAGAG
TTTCACGACTCGTGGCGCACAAGACGTGCTGTCAAGGTCAAGGTAGTCATGGGCTTTGAGATTGAGGGCGTGACG
GTCGACTTGGAGCACCAAGTGTACACTCGAAAGGCCAGGCCCGAGCTGCTCGACTTGGGCGTGGTCTGGGCCAGG
GAGATGCAGGGGCTGCTTGATGCGGGGGCCATCAAGACCCAGCCGATTCGTGAGGTGCAGGGAGGGCTTGAGGGC
GTCATCAAGGGCTTGAGTGCGCTTCAGAGGGGTGAGGCTCGGGGGCACAAGCTAGTGGCGAGGGTGTTTGAGTGA
Gene >OphauB2|710
ATGGACACCGAGCCGGCTCTGCCGCTAGCGGTTTCCTACTCTGTCTCTGTGCCTGATATCTCATCTCCTAATCAC
GTCCTCGTGCGCGTACGGGCCGTGGGTCTGAATCCGACCGACTACAAGATGCTAAAGGGGTTTAACACGCCCGGT
CTGGGCGCTGGATGCGACTTTTGCGGCACTGTTGAGCTGGCTGGCGCGCATGCCGCGATGCCAGCGGGAACGAGG
ATCTGCGGTGCTGTGTTTCCCTATCACGCCGGAAATGCAGCCAACGGCGCATTCTCGCAGTGGCTTGTTGCTGAT
TCCCGCCTCCTGCTAAAGGTTCCAGATTCCTGGACTGACGAGCAGGCCGCCGGGCTTGGCGCTGTTGGCTGGTCA
ACGGCCTCCCTATGCCTCTCGGATCCGCAGGCGCTGGCACTCCAAGGGCTGCCGTCTAAGCCTGCGGAGAAGCAT
ACGCCTGTTGTGGTATATGGCGGTGCGACGGCGACTGGCCTGATGGCAATCCAACTGCTCAAGCGGTAAGTAGGT
CTGAGTCTGCTCATGCTTGTGAGTCAAGCTGAAAAAAAATGGCGCCCAACAGATCAGGCTACGCACCTATTGCTG
TCTGCTCGCCGGCGTCCTCGCCCCTGGTGATTGACTGCGGGGCCGTGGCAACAGTGGCGTACACGTCACCGGACT
GCGTCGAGACGGTCAAGTCAATTGCCGCCGGTGCACCAATCAGACAGGCCCTAGACTGCATCACGCAAGCCGAGT
CTGCGTCTGTCTGCTTTGGGGCAATAGCCCGCACAGGAGGCCGCTATGCCTGCCTAGAAGAGTTTCACGACTCGT
GGCGCACAAGACGTGCTGTCAAGGTCAAGGTAGTCATGGGCTTTGAGATTGAGGGCGTGACGGTCGACTTGGAGC
ACCAAGTGTACACTCGAAAGGCCAGGCCCGAGCTGCTCGACTTGGGCGTGGTCTGGGCCAGGGAGATGCAGGGGC
TGCTTGATGCGGGGGCCATCAAGACCCAGCCGATTCGTGAGGTGCAGGGAGGGCTTGAGGGCGTCATCAAGGGCT
TGAGTGCGCTTCAGAGGGGTGAGGCTCGGGGGCACAAGCTAGTGGCGAGGGTGTTTGAGTGA

© 2020 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail