Fungal Genomics

at Utrecht University

General Properties

Protein IDOphauB2|7097
Gene name
LocationContig_71:476..1829
Strand-
Gene length (bp)1353
Transcript length (bp)1227
Coding sequence length (bp)1227
Protein length (aa) 409

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF01435 Peptidase_M48 Peptidase family M48 1.2E-33 179 369

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q9P7G4|OMA1_SCHPO Mitochondrial metalloendopeptidase OMA1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=oma1 PE=3 SV=1 117 382 3.0E-53
sp|P36163|OMA1_YEAST Mitochondrial metalloendopeptidase OMA1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=OMA1 PE=1 SV=2 195 392 4.0E-41
sp|E9QBI7|OMA1_DANRE Metalloendopeptidase OMA1, mitochondrial OS=Danio rerio GN=oma1 PE=3 SV=1 119 382 1.0E-32
sp|Q3SZN3|OMA1_BOVIN Metalloendopeptidase OMA1, mitochondrial OS=Bos taurus GN=OMA1 PE=2 SV=2 122 386 2.0E-31
sp|Q96E52|OMA1_HUMAN Metalloendopeptidase OMA1, mitochondrial OS=Homo sapiens GN=OMA1 PE=1 SV=1 122 386 1.0E-30
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q9P7G4|OMA1_SCHPO Mitochondrial metalloendopeptidase OMA1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=oma1 PE=3 SV=1 117 382 3.0E-53
sp|P36163|OMA1_YEAST Mitochondrial metalloendopeptidase OMA1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=OMA1 PE=1 SV=2 195 392 4.0E-41
sp|E9QBI7|OMA1_DANRE Metalloendopeptidase OMA1, mitochondrial OS=Danio rerio GN=oma1 PE=3 SV=1 119 382 1.0E-32
sp|Q3SZN3|OMA1_BOVIN Metalloendopeptidase OMA1, mitochondrial OS=Bos taurus GN=OMA1 PE=2 SV=2 122 386 2.0E-31
sp|Q96E52|OMA1_HUMAN Metalloendopeptidase OMA1, mitochondrial OS=Homo sapiens GN=OMA1 PE=1 SV=1 122 386 1.0E-30
sp|D3ZS74|OMA1_RAT Metalloendopeptidase OMA1, mitochondrial OS=Rattus norvegicus GN=Oma1 PE=3 SV=1 122 386 4.0E-30
sp|Q9D8H7|OMA1_MOUSE Metalloendopeptidase OMA1, mitochondrial OS=Mus musculus GN=Oma1 PE=1 SV=1 122 386 5.0E-29
sp|P66950|BEPA_SALTY Beta-barrel assembly-enhancing protease OS=Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) GN=bepA PE=3 SV=1 214 364 2.0E-11
sp|P66951|BEPA_SALTI Beta-barrel assembly-enhancing protease OS=Salmonella typhi GN=bepA PE=3 SV=1 214 364 2.0E-11
sp|Q8ZCC3|BEPA_YERPE Beta-barrel assembly-enhancing protease OS=Yersinia pestis GN=bepA PE=3 SV=1 214 364 4.0E-11
sp|P66949|BEPA_SHIFL Beta-barrel assembly-enhancing protease OS=Shigella flexneri GN=bepA PE=3 SV=1 190 364 2.0E-10
sp|P66948|BEPA_ECOLI Beta-barrel assembly-enhancing protease OS=Escherichia coli (strain K12) GN=bepA PE=1 SV=1 190 364 2.0E-10
sp|Q8XAD2|BEPA_ECO57 Beta-barrel assembly-enhancing protease OS=Escherichia coli O157:H7 GN=bepA PE=3 SV=1 190 364 2.0E-10
sp|Q9KQ40|BEPA_VIBCH Putative beta-barrel assembly-enhancing protease OS=Vibrio cholerae serotype O1 (strain ATCC 39315 / El Tor Inaba N16961) GN=VC_2164 PE=3 SV=1 211 368 4.0E-07
[Show less]

GO

GO Term Description Terminal node
GO:0006508 proteolysis Yes
GO:0004222 metalloendopeptidase activity Yes
GO:0008233 peptidase activity No
GO:0043170 macromolecule metabolic process No
GO:0004175 endopeptidase activity No
GO:0140096 catalytic activity, acting on a protein No
GO:0019538 protein metabolic process No
GO:1901564 organonitrogen compound metabolic process No
GO:0071704 organic substance metabolic process No
GO:0008152 metabolic process No
GO:0008150 biological_process No
GO:0016787 hydrolase activity No
GO:0008237 metallopeptidase activity No
GO:0003674 molecular_function No
GO:0006807 nitrogen compound metabolic process No
GO:0044238 primary metabolic process No
GO:0003824 catalytic activity No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 28 0.45

Transmembrane Domains

Domain # Start End Length
1 115 132 17
2 262 284 22

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >OphauB2|7097
MLARRFTQPSRCTKVAWALGVFASGRASRSGLTPLVVVCCRGLSHSPPQLARHPNHGHHDHDDRHGQAHQDHAYL
RQDHAYLRQHNELLRNARPLVSHSAVDRFSKVGSGRRQRLLVLGVIVLAVGYYLSSAQKVPATGRWRFNILSDDF
VAASYAGSDDKFIAAIRARGGRFLSNWDQRARMAERVMKRLISVSGMDHLDWKITIIDDPKTANAFVLPGGKVFI
FSGLLDVCGSEDALATVLGHEMAHNTASHCAERLSAAWVGNITLGSLFFLVGSMPGLLMFSMWNLIGGYYLQDLV
FYLPMGRKQESEADYIGLMMMAEACYDPRTAIGFWSRMQQLSQQAGFELPEMFSTHPTNEHRVAQMKKWMPAAMK
KRTESDCSGTSAFADRFRAHLRGGLPPVNTLWR*
Coding >OphauB2|7097
ATGTTGGCTCGCCGCTTCACGCAGCCAAGCCGCTGCACCAAGGTGGCTTGGGCTCTTGGAGTCTTTGCATCAGGC
CGTGCGAGTCGTAGCGGGTTGACGCCTCTGGTTGTGGTTTGTTGCCGAGGCTTGTCGCACTCGCCGCCGCAGCTT
GCCCGACACCCAAACCATGGCCACCACGACCACGACGACCGCCACGGCCAAGCGCACCAGGACCACGCCTATCTG
CGCCAGGATCACGCCTATCTGCGCCAGCACAACGAGCTCCTGCGCAATGCGCGTCCGCTGGTGTCGCACTCGGCT
GTTGATCGCTTCTCAAAGGTGGGCAGTGGCCGTAGACAACGCCTCCTTGTCCTTGGCGTGATTGTTTTGGCTGTG
GGCTACTATCTCTCGAGCGCGCAAAAGGTGCCTGCTACGGGTCGCTGGCGCTTCAACATTCTCTCGGATGACTTT
GTTGCCGCTTCGTATGCAGGCTCCGACGACAAGTTTATAGCAGCAATCAGGGCCCGAGGTGGCCGGTTCCTCTCC
AACTGGGACCAGCGCGCCCGGATGGCTGAGCGTGTCATGAAGCGCTTGATTTCTGTCAGCGGCATGGATCATTTG
GATTGGAAGATTACCATTATTGACGATCCAAAAACTGCCAATGCCTTTGTCTTGCCTGGTGGCAAGGTGTTCATC
TTTAGCGGCCTTTTGGATGTCTGTGGCAGCGAAGACGCCCTGGCCACGGTTCTCGGCCACGAGATGGCACACAAC
ACGGCATCGCATTGCGCTGAACGCCTCTCAGCCGCCTGGGTGGGCAACATTACGCTCGGCAGCCTCTTCTTCCTC
GTTGGCTCCATGCCGGGCCTCCTCATGTTTAGCATGTGGAATTTAATCGGGGGCTACTATCTCCAGGATTTGGTC
TTTTACCTTCCCATGGGCCGAAAGCAGGAAAGCGAGGCCGACTACATTGGCCTGATGATGATGGCTGAGGCATGC
TACGACCCGCGTACCGCCATTGGTTTCTGGAGTCGAATGCAACAATTGTCGCAACAGGCCGGCTTCGAGTTGCCC
GAGATGTTTAGCACGCATCCGACGAACGAACACAGGGTAGCCCAAATGAAGAAGTGGATGCCAGCGGCCATGAAG
AAGCGCACCGAAAGCGACTGCAGCGGAACATCTGCCTTTGCAGACCGCTTCAGAGCTCACTTGAGGGGAGGCTTA
CCCCCTGTAAACACTCTTTGGAGATGA
Transcript >OphauB2|7097
ATGTTGGCTCGCCGCTTCACGCAGCCAAGCCGCTGCACCAAGGTGGCTTGGGCTCTTGGAGTCTTTGCATCAGGC
CGTGCGAGTCGTAGCGGGTTGACGCCTCTGGTTGTGGTTTGTTGCCGAGGCTTGTCGCACTCGCCGCCGCAGCTT
GCCCGACACCCAAACCATGGCCACCACGACCACGACGACCGCCACGGCCAAGCGCACCAGGACCACGCCTATCTG
CGCCAGGATCACGCCTATCTGCGCCAGCACAACGAGCTCCTGCGCAATGCGCGTCCGCTGGTGTCGCACTCGGCT
GTTGATCGCTTCTCAAAGGTGGGCAGTGGCCGTAGACAACGCCTCCTTGTCCTTGGCGTGATTGTTTTGGCTGTG
GGCTACTATCTCTCGAGCGCGCAAAAGGTGCCTGCTACGGGTCGCTGGCGCTTCAACATTCTCTCGGATGACTTT
GTTGCCGCTTCGTATGCAGGCTCCGACGACAAGTTTATAGCAGCAATCAGGGCCCGAGGTGGCCGGTTCCTCTCC
AACTGGGACCAGCGCGCCCGGATGGCTGAGCGTGTCATGAAGCGCTTGATTTCTGTCAGCGGCATGGATCATTTG
GATTGGAAGATTACCATTATTGACGATCCAAAAACTGCCAATGCCTTTGTCTTGCCTGGTGGCAAGGTGTTCATC
TTTAGCGGCCTTTTGGATGTCTGTGGCAGCGAAGACGCCCTGGCCACGGTTCTCGGCCACGAGATGGCACACAAC
ACGGCATCGCATTGCGCTGAACGCCTCTCAGCCGCCTGGGTGGGCAACATTACGCTCGGCAGCCTCTTCTTCCTC
GTTGGCTCCATGCCGGGCCTCCTCATGTTTAGCATGTGGAATTTAATCGGGGGCTACTATCTCCAGGATTTGGTC
TTTTACCTTCCCATGGGCCGAAAGCAGGAAAGCGAGGCCGACTACATTGGCCTGATGATGATGGCTGAGGCATGC
TACGACCCGCGTACCGCCATTGGTTTCTGGAGTCGAATGCAACAATTGTCGCAACAGGCCGGCTTCGAGTTGCCC
GAGATGTTTAGCACGCATCCGACGAACGAACACAGGGTAGCCCAAATGAAGAAGTGGATGCCAGCGGCCATGAAG
AAGCGCACCGAAAGCGACTGCAGCGGAACATCTGCCTTTGCAGACCGCTTCAGAGCTCACTTGAGGGGAGGCTTA
CCCCCTGTAAACACTCTTTGGAGATGA
Gene >OphauB2|7097
ATGTTGGCTCGCCGCTTCACGCAGCCAAGCCGCTGCACCAAGGTGGCTTGGGCTCTTGGAGTCTTTGCATCAGGC
CGTGCGAGTCGTAGCGGGTTGACGCCTCTGGTTGTGGTTTGTTGCCGAGGCTTGTCGCACTCGCCGCCGCAGCTT
GCCCGACACCCAAACCATGGCCACCACGACCACGACGACCGCCACGGCCAAGCGCACCAGGACCACGCCTATCTG
CGCCAGGATCACGCCTATCTGCGCCAGCACAACGAGCTCCTGCGCAATGCGCGTCCGCTGGTGTCGCACTCGGCT
GTTGATCGCTTCTCAAAGGTGGGCAGTGGCCGTAGACAACGCCTCCTTGTCCTTGGCGTGATTGTTTTGGCTGTG
GGCTACTATCTCTCGAGCGCGCAAAAGGTGCCTGCTACGGGTCGCTGGCGCTTCAACATTCTCTCGGATGACTTT
GTTGCCGCTTCGTATGCAGGCTCCGACGACAAGTTTATAGCAGCAATCAGGGCCCGAGGTGGCCGGTTCCTCTCC
AACTGGGACCAGCGCGCCCGGATGGCTGAGCGTGTCATGAAGCGCTTGATTTCTGTCAGCGGCATGGATCATTTG
GATTGGAAGATTACCATTATTGACGATCCAAGTGCGTTGTTGTCCCAACCACTAGACGCTGCTGGCATGCTAACT
CATGGGCCTCGTTTTAGAAACTGCCAATGCCTTTGTCTTGCCTGGTGGCAAGGTGTTCATCTTTAGCGGCCTTTT
GGATGTCTGTGGCAGCGAAGACGCCCTGGCCACGGTTCTCGGCCACGAGATGGCACACAACACGGCATCGCATTG
CGCTGAACGCCTCTCAGCCGCCTGGGTGGGCAACATTACGCTCGGCAGCCTCTTCTTCCTCGTTGGCTCCATGCC
GGGCCTCCTCATGTTTAGCATGTGGAATTTAATCGGGGGCTACTATCTCCAGGATTTGGTCTTTTACCTTCCCAT
GGGCCGAAAGCAGGAAAGCGAGGCCGACTACATTGGCCTGATGATGATGGCTGAGGCATGCTACGACCCGCGTAC
CGCCATTGGTTTCTGGAGTCGAATGCAACAATTGTCGCAACAGGCCGGCTTCGAGTTGCCCGAGATGTTTAGCAC
GCATCCGACGGTAAGCACGCACATGACTCTTGCTTGGCAAGGTGGGGGAGAAGGGCCATGCTGACATGCAGGCAG
AACGAACACAGGGTAGCCCAAATGAAGAAGTGGATGCCAGCGGCCATGAAGAAGCGCACCGAAAGCGACTGCAGC
GGAACATCTGCCTTTGCAGACCGCTTCAGAGCTCACTTGAGGGGAGGCTTACCCCCTGTAAACACTCTTTGGAGA
TGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail