Fungal Genomics

at Utrecht University

General Properties

Protein IDOphauB2|7095
Gene name
LocationContig_70:94210..95620
Strand-
Gene length (bp)1410
Transcript length (bp)1410
Coding sequence length (bp)1410
Protein length (aa) 470

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF01266 DAO FAD dependent oxidoreductase 1.1E-38 8 403

Swissprot hits

Swissprot ID Swissprot Description Start End E-value
sp|O43029|FAP1_SCHPO L-pipecolate oxidase OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=fap1 PE=1 SV=1 7 421 4.0E-55
sp|Q9UTM9|FAP2_SCHPO L-saccharopine oxidase OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=fap2 PE=1 SV=1 7 421 6.0E-38
sp|Q9P0Z9|SOX_HUMAN Peroxisomal sarcosine oxidase OS=Homo sapiens GN=PIPOX PE=1 SV=2 6 398 3.0E-11
sp|B7LT77|MTOX_ESCF3 N-methyl-L-tryptophan oxidase OS=Escherichia fergusonii (strain ATCC 35469 / DSM 13698 / CDC 0568-73) GN=solA PE=3 SV=1 6 408 8.0E-07

GO

GO Term Description Terminal node
GO:0016491 oxidoreductase activity Yes
GO:0003824 catalytic activity No
GO:0003674 molecular_function No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 22 0.5

Transmembrane Domains

Domain # Start End Length
1 7 24 17

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >OphauB2|7095
MEQTPWSILVVGSGVFGLSTAWALTKRARFSMTTITVVDDGRGQFPAADAASVDTSRIVRGDYADAQYTMLASLA
QREWRKKGEDDLGGQGRYAESGLVLMAQQQDGNKACMAYVEESWRNVAEYAAQNGYADDTVQLLESREALNQSLG
ISGHAGDWGYLNKLSGWADAAKAMDWLYKRVEATGRVRFVDAKVQQLETKGERVVGARLANGHVMLADLVLVAAG
AWSGSLVDLRGRVEATGQLLSYVDIAEQELEVLSKQPIVLQLSQGLFIIPPRERVLKVGLHGYGYANPQLICTAL
PLSPSAARVPIVVSCPLTSRDGKLERLPDQDDAVMRAALRDLLPVSGIQDRPWREVRICWYADTTDADWLVDWHP
GWKGLFVATGDSGHAFKFLPVLGDKVVDCILGQGGELGHMWRWKDDAQVQAVTAQGRGEYCRLVASKDGSRGGEQ
PESFLSEALFLNKPPMSRK*
Coding >OphauB2|7095
ATGGAGCAGACGCCTTGGTCCATTCTCGTCGTCGGTTCGGGGGTGTTTGGGCTCAGCACAGCATGGGCGCTAACT
AAACGGGCTCGCTTCTCCATGACAACCATCACAGTGGTGGATGACGGACGGGGCCAGTTTCCTGCTGCTGACGCG
GCCAGTGTCGACACGTCGCGAATTGTCCGAGGCGACTATGCAGATGCACAATACACGATGCTGGCGTCGCTGGCG
CAACGTGAATGGCGCAAGAAGGGAGAAGATGATTTGGGGGGCCAAGGGCGATACGCAGAATCAGGCTTGGTCCTC
ATGGCGCAGCAGCAAGACGGCAACAAGGCTTGCATGGCGTACGTCGAGGAGAGCTGGAGGAACGTGGCCGAGTAT
GCGGCGCAGAATGGCTACGCGGATGATACGGTGCAGCTGCTCGAGAGCCGGGAGGCACTGAACCAGAGCTTGGGC
ATCAGTGGGCATGCGGGAGACTGGGGATACTTGAACAAGCTGTCCGGGTGGGCCGACGCGGCCAAGGCCATGGAT
TGGCTGTACAAACGGGTGGAAGCAACGGGCCGGGTGCGCTTCGTCGACGCCAAGGTACAACAGCTCGAGACCAAG
GGGGAGCGAGTCGTGGGCGCCAGACTAGCCAACGGCCATGTCATGCTGGCCGACTTGGTGCTTGTGGCGGCGGGA
GCCTGGTCGGGCTCTCTGGTCGATCTCAGAGGCCGCGTCGAGGCAACTGGGCAACTCCTCAGCTACGTGGACATT
GCCGAGCAGGAGCTTGAGGTGCTTTCCAAGCAGCCCATAGTGTTGCAGCTGTCGCAGGGACTCTTCATCATCCCG
CCACGAGAGCGAGTGCTCAAGGTTGGCCTTCATGGATACGGCTATGCTAACCCTCAGCTGATTTGCACGGCACTG
CCCCTCTCGCCGTCGGCGGCGCGCGTGCCAATCGTGGTGTCATGCCCCCTGACGAGCCGAGACGGCAAGCTGGAG
CGACTGCCGGACCAAGACGATGCCGTGATGCGGGCCGCGCTGCGAGACCTGCTGCCCGTCTCAGGCATCCAAGAC
CGGCCGTGGCGCGAGGTGCGCATCTGCTGGTATGCCGACACGACTGATGCTGACTGGCTTGTCGACTGGCACCCT
GGGTGGAAGGGACTCTTTGTGGCAACGGGGGACAGCGGACACGCCTTCAAGTTCCTGCCTGTGCTTGGAGACAAG
GTGGTGGACTGCATCTTGGGTCAAGGGGGAGAGCTGGGGCACATGTGGCGGTGGAAAGACGACGCACAAGTCCAA
GCTGTCACCGCACAAGGCCGTGGGGAGTATTGCCGACTCGTGGCCAGCAAAGACGGGAGTCGTGGTGGAGAGCAG
CCAGAGAGCTTCTTGAGCGAGGCTCTCTTCTTGAACAAGCCGCCAATGTCTCGAAAATAA
Transcript >OphauB2|7095
ATGGAGCAGACGCCTTGGTCCATTCTCGTCGTCGGTTCGGGGGTGTTTGGGCTCAGCACAGCATGGGCGCTAACT
AAACGGGCTCGCTTCTCCATGACAACCATCACAGTGGTGGATGACGGACGGGGCCAGTTTCCTGCTGCTGACGCG
GCCAGTGTCGACACGTCGCGAATTGTCCGAGGCGACTATGCAGATGCACAATACACGATGCTGGCGTCGCTGGCG
CAACGTGAATGGCGCAAGAAGGGAGAAGATGATTTGGGGGGCCAAGGGCGATACGCAGAATCAGGCTTGGTCCTC
ATGGCGCAGCAGCAAGACGGCAACAAGGCTTGCATGGCGTACGTCGAGGAGAGCTGGAGGAACGTGGCCGAGTAT
GCGGCGCAGAATGGCTACGCGGATGATACGGTGCAGCTGCTCGAGAGCCGGGAGGCACTGAACCAGAGCTTGGGC
ATCAGTGGGCATGCGGGAGACTGGGGATACTTGAACAAGCTGTCCGGGTGGGCCGACGCGGCCAAGGCCATGGAT
TGGCTGTACAAACGGGTGGAAGCAACGGGCCGGGTGCGCTTCGTCGACGCCAAGGTACAACAGCTCGAGACCAAG
GGGGAGCGAGTCGTGGGCGCCAGACTAGCCAACGGCCATGTCATGCTGGCCGACTTGGTGCTTGTGGCGGCGGGA
GCCTGGTCGGGCTCTCTGGTCGATCTCAGAGGCCGCGTCGAGGCAACTGGGCAACTCCTCAGCTACGTGGACATT
GCCGAGCAGGAGCTTGAGGTGCTTTCCAAGCAGCCCATAGTGTTGCAGCTGTCGCAGGGACTCTTCATCATCCCG
CCACGAGAGCGAGTGCTCAAGGTTGGCCTTCATGGATACGGCTATGCTAACCCTCAGCTGATTTGCACGGCACTG
CCCCTCTCGCCGTCGGCGGCGCGCGTGCCAATCGTGGTGTCATGCCCCCTGACGAGCCGAGACGGCAAGCTGGAG
CGACTGCCGGACCAAGACGATGCCGTGATGCGGGCCGCGCTGCGAGACCTGCTGCCCGTCTCAGGCATCCAAGAC
CGGCCGTGGCGCGAGGTGCGCATCTGCTGGTATGCCGACACGACTGATGCTGACTGGCTTGTCGACTGGCACCCT
GGGTGGAAGGGACTCTTTGTGGCAACGGGGGACAGCGGACACGCCTTCAAGTTCCTGCCTGTGCTTGGAGACAAG
GTGGTGGACTGCATCTTGGGTCAAGGGGGAGAGCTGGGGCACATGTGGCGGTGGAAAGACGACGCACAAGTCCAA
GCTGTCACCGCACAAGGCCGTGGGGAGTATTGCCGACTCGTGGCCAGCAAAGACGGGAGTCGTGGTGGAGAGCAG
CCAGAGAGCTTCTTGAGCGAGGCTCTCTTCTTGAACAAGCCGCCAATGTCTCGAAAATAA
Gene >OphauB2|7095
ATGGAGCAGACGCCTTGGTCCATTCTCGTCGTCGGTTCGGGGGTGTTTGGGCTCAGCACAGCATGGGCGCTAACT
AAACGGGCTCGCTTCTCCATGACAACCATCACAGTGGTGGATGACGGACGGGGCCAGTTTCCTGCTGCTGACGCG
GCCAGTGTCGACACGTCGCGAATTGTCCGAGGCGACTATGCAGATGCACAATACACGATGCTGGCGTCGCTGGCG
CAACGTGAATGGCGCAAGAAGGGAGAAGATGATTTGGGGGGCCAAGGGCGATACGCAGAATCAGGCTTGGTCCTC
ATGGCGCAGCAGCAAGACGGCAACAAGGCTTGCATGGCGTACGTCGAGGAGAGCTGGAGGAACGTGGCCGAGTAT
GCGGCGCAGAATGGCTACGCGGATGATACGGTGCAGCTGCTCGAGAGCCGGGAGGCACTGAACCAGAGCTTGGGC
ATCAGTGGGCATGCGGGAGACTGGGGATACTTGAACAAGCTGTCCGGGTGGGCCGACGCGGCCAAGGCCATGGAT
TGGCTGTACAAACGGGTGGAAGCAACGGGCCGGGTGCGCTTCGTCGACGCCAAGGTACAACAGCTCGAGACCAAG
GGGGAGCGAGTCGTGGGCGCCAGACTAGCCAACGGCCATGTCATGCTGGCCGACTTGGTGCTTGTGGCGGCGGGA
GCCTGGTCGGGCTCTCTGGTCGATCTCAGAGGCCGCGTCGAGGCAACTGGGCAACTCCTCAGCTACGTGGACATT
GCCGAGCAGGAGCTTGAGGTGCTTTCCAAGCAGCCCATAGTGTTGCAGCTGTCGCAGGGACTCTTCATCATCCCG
CCACGAGAGCGAGTGCTCAAGGTTGGCCTTCATGGATACGGCTATGCTAACCCTCAGCTGATTTGCACGGCACTG
CCCCTCTCGCCGTCGGCGGCGCGCGTGCCAATCGTGGTGTCATGCCCCCTGACGAGCCGAGACGGCAAGCTGGAG
CGACTGCCGGACCAAGACGATGCCGTGATGCGGGCCGCGCTGCGAGACCTGCTGCCCGTCTCAGGCATCCAAGAC
CGGCCGTGGCGCGAGGTGCGCATCTGCTGGTATGCCGACACGACTGATGCTGACTGGCTTGTCGACTGGCACCCT
GGGTGGAAGGGACTCTTTGTGGCAACGGGGGACAGCGGACACGCCTTCAAGTTCCTGCCTGTGCTTGGAGACAAG
GTGGTGGACTGCATCTTGGGTCAAGGGGGAGAGCTGGGGCACATGTGGCGGTGGAAAGACGACGCACAAGTCCAA
GCTGTCACCGCACAAGGCCGTGGGGAGTATTGCCGACTCGTGGCCAGCAAAGACGGGAGTCGTGGTGGAGAGCAG
CCAGAGAGCTTCTTGAGCGAGGCTCTCTTCTTGAACAAGCCGCCAATGTCTCGAAAATAA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail