Fungal Genomics

at Utrecht University

General Properties

Protein IDOphauB2|7091
Gene name
LocationContig_70:84743..85496
Strand-
Gene length (bp)753
Transcript length (bp)753
Coding sequence length (bp)753
Protein length (aa) 251

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF10294 Methyltransf_16 Lysine methyltransferase 1.7E-12 48 202
PF06325 PrmA Ribosomal protein L11 methyltransferase (PrmA) 6.4E-05 70 125

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q4I2X5|NNT1_GIBZE Protein N-methyltransferase NNT1 OS=Gibberella zeae (strain PH-1 / ATCC MYA-4620 / FGSC 9075 / NRRL 31084) GN=NNT1 PE=3 SV=2 3 244 9.0E-106
sp|Q7S634|NNT1_NEUCR Protein N-methyltransferase nnt1 OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=nnt-1 PE=3 SV=1 24 245 1.0E-78
sp|Q9UT28|NNT1_SCHPO Protein N-methyltransferase nnt1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=nnt1 PE=3 SV=1 2 245 2.0E-56
sp|Q5BAD0|NNT1_EMENI Protein N-methyltransferase nnt1 OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=nnt1 PE=3 SV=1 2 246 1.0E-54
sp|Q4WYS7|NNT1_ASPFU Protein N-methyltransferase nnt1 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=nnt1 PE=3 SV=1 10 244 2.0E-49
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q4I2X5|NNT1_GIBZE Protein N-methyltransferase NNT1 OS=Gibberella zeae (strain PH-1 / ATCC MYA-4620 / FGSC 9075 / NRRL 31084) GN=NNT1 PE=3 SV=2 3 244 9.0E-106
sp|Q7S634|NNT1_NEUCR Protein N-methyltransferase nnt1 OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=nnt-1 PE=3 SV=1 24 245 1.0E-78
sp|Q9UT28|NNT1_SCHPO Protein N-methyltransferase nnt1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=nnt1 PE=3 SV=1 2 245 2.0E-56
sp|Q5BAD0|NNT1_EMENI Protein N-methyltransferase nnt1 OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=nnt1 PE=3 SV=1 2 246 1.0E-54
sp|Q4WYS7|NNT1_ASPFU Protein N-methyltransferase nnt1 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=nnt1 PE=3 SV=1 10 244 2.0E-49
sp|Q74ZB5|NNT1_ASHGO Protein N-methyltransferase NNT1 OS=Ashbya gossypii (strain ATCC 10895 / CBS 109.51 / FGSC 9923 / NRRL Y-1056) GN=NNT1 PE=3 SV=1 31 242 2.0E-46
sp|Q6CUI0|NNT1_KLULA Protein N-methyltransferase NNT1 OS=Kluyveromyces lactis (strain ATCC 8585 / CBS 2359 / DSM 70799 / NBRC 1267 / NRRL Y-1140 / WM37) GN=NNT1 PE=3 SV=1 7 242 9.0E-46
sp|Q05874|NNT1_YEAST Protein N-methyltransferase NNT1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=NNT1 PE=1 SV=1 5 242 3.0E-43
sp|Q6FJ22|NNT1_CANGA Protein N-methyltransferase NNT1 OS=Candida glabrata (strain ATCC 2001 / CBS 138 / JCM 3761 / NBRC 0622 / NRRL Y-65) GN=NNT1 PE=3 SV=1 9 242 5.0E-40
sp|P0CP44|NNT1_CRYNJ Protein N-methyltransferase NNT1 OS=Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565) GN=NNT1 PE=3 SV=1 34 240 2.0E-38
sp|P0CP45|NNT1_CRYNB Protein N-methyltransferase NNT1 OS=Cryptococcus neoformans var. neoformans serotype D (strain B-3501A) GN=NNT1 PE=3 SV=1 34 240 2.0E-38
sp|Q6BKI8|NNT1_DEBHA Protein N-methyltransferase NNT1 OS=Debaryomyces hansenii (strain ATCC 36239 / CBS 767 / JCM 1990 / NBRC 0083 / IGC 2968) GN=NNT1 PE=3 SV=1 32 242 4.0E-35
sp|Q5A013|NNT1_CANAL Protein N-methyltransferase NNT1 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=NNT1 PE=3 SV=1 9 242 9.0E-35
sp|Q6CHE9|NNT1_YARLI Protein N-methyltransferase NNT1 OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=NNT1 PE=3 SV=1 7 242 1.0E-32
sp|Q28IN4|MT21B_XENTR Protein-lysine methyltransferase METTL21B OS=Xenopus tropicalis GN=mettl21b PE=2 SV=1 51 218 6.0E-11
sp|A6QP81|MT21C_BOVIN Protein-lysine methyltransferase METTL21C OS=Bos taurus GN=METTL21C PE=2 SV=1 2 190 2.0E-07
sp|Q8BLU2|MT21C_MOUSE Protein-lysine methyltransferase METTL21C OS=Mus musculus GN=Mettl21c PE=2 SV=1 6 170 5.0E-07
sp|Q5BLD8|MT21A_DANRE Protein N-lysine methyltransferase METTL21A OS=Danio rerio GN=mettl21a PE=2 SV=1 69 195 3.0E-06
[Show less]

GO

(None)

Deeploc

Deeploc data not available for this genome

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

No expression data available for this genome

Orthologs

Orthofinder run ID4
Orthogroup210
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|5530
Ophiocordyceps australis 1348a (Ghana) OphauG2|6206
Ophiocordyceps australis map64 (Brazil) OphauB2|7091 (this protein)
Ophiocordyceps australis map64 (Brazil) OphauB2|7092
Ophiocordyceps camponoti-floridani Ophcf2|01205
Ophiocordyceps camponoti-floridani Ophcf2|01206
Ophiocordyceps camponoti-rufipedis Ophun1|6976
Ophiocordyceps kimflemingae Ophio5|5592
Ophiocordyceps kimflemingae Ophio5|687
Ophiocordyceps subramaniannii Hirsu2|1451
Ophiocordyceps subramaniannii Hirsu2|1452

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >OphauB2|7091
MDNYEVASLLQEPQDYYPPSPPPTEQCHTLQDGRRVALHLVGHSATEAHHVWNGSRFVADLFEAEPERVRGRSVL
ELGAGAGLPSLVAGLLGARRVVMTDFPDPAIVAAMQRNVDEAAVQEVVRVLGFVWGGDAAPLLAALAPQDKGFDV
LVLADLLFRHSEHGALVRTICQTMRRTASSAAYVFFTSYRPWKQDADMAFFDVARAAGLAVRLLAERKLDAPLFA
DDPGDVEVQKTVRGFMVRWPDSASE*
Coding >OphauB2|7091
ATGGACAACTATGAGGTGGCATCTCTGCTGCAAGAGCCCCAAGACTATTACCCGCCGTCGCCTCCACCTACAGAG
CAATGCCACACGCTACAAGACGGACGGCGAGTAGCGCTGCACCTGGTAGGACACAGCGCAACCGAGGCGCACCAC
GTATGGAACGGCAGCCGCTTTGTGGCCGACTTGTTCGAGGCGGAGCCGGAGCGAGTGCGCGGGCGCAGCGTCTTG
GAGCTGGGTGCGGGAGCGGGCCTGCCGTCGCTGGTGGCAGGCCTGCTGGGCGCGCGGCGCGTCGTCATGACGGAT
TTTCCAGACCCAGCAATAGTAGCAGCCATGCAGCGCAACGTGGACGAGGCTGCGGTGCAAGAGGTGGTGCGTGTA
CTGGGGTTTGTCTGGGGAGGAGACGCGGCGCCGCTGCTGGCGGCTTTGGCTCCCCAAGACAAGGGCTTTGATGTG
CTAGTCCTGGCCGATCTTCTCTTCCGCCATTCTGAGCACGGCGCACTGGTGCGGACTATTTGCCAGACGATGCGC
CGCACGGCATCGAGTGCCGCCTACGTCTTTTTTACCTCGTATCGTCCCTGGAAGCAGGACGCCGACATGGCCTTT
TTCGACGTTGCCAGGGCTGCGGGCCTTGCAGTCCGTCTGCTTGCCGAGCGCAAACTAGATGCGCCGCTGTTTGCT
GACGATCCCGGCGACGTCGAGGTGCAGAAGACGGTTAGGGGCTTCATGGTGCGTTGGCCAGACAGTGCGTCAGAG
TGA
Transcript >OphauB2|7091
ATGGACAACTATGAGGTGGCATCTCTGCTGCAAGAGCCCCAAGACTATTACCCGCCGTCGCCTCCACCTACAGAG
CAATGCCACACGCTACAAGACGGACGGCGAGTAGCGCTGCACCTGGTAGGACACAGCGCAACCGAGGCGCACCAC
GTATGGAACGGCAGCCGCTTTGTGGCCGACTTGTTCGAGGCGGAGCCGGAGCGAGTGCGCGGGCGCAGCGTCTTG
GAGCTGGGTGCGGGAGCGGGCCTGCCGTCGCTGGTGGCAGGCCTGCTGGGCGCGCGGCGCGTCGTCATGACGGAT
TTTCCAGACCCAGCAATAGTAGCAGCCATGCAGCGCAACGTGGACGAGGCTGCGGTGCAAGAGGTGGTGCGTGTA
CTGGGGTTTGTCTGGGGAGGAGACGCGGCGCCGCTGCTGGCGGCTTTGGCTCCCCAAGACAAGGGCTTTGATGTG
CTAGTCCTGGCCGATCTTCTCTTCCGCCATTCTGAGCACGGCGCACTGGTGCGGACTATTTGCCAGACGATGCGC
CGCACGGCATCGAGTGCCGCCTACGTCTTTTTTACCTCGTATCGTCCCTGGAAGCAGGACGCCGACATGGCCTTT
TTCGACGTTGCCAGGGCTGCGGGCCTTGCAGTCCGTCTGCTTGCCGAGCGCAAACTAGATGCGCCGCTGTTTGCT
GACGATCCCGGCGACGTCGAGGTGCAGAAGACGGTTAGGGGCTTCATGGTGCGTTGGCCAGACAGTGCGTCAGAG
TGA
Gene >OphauB2|7091
ATGGACAACTATGAGGTGGCATCTCTGCTGCAAGAGCCCCAAGACTATTACCCGCCGTCGCCTCCACCTACAGAG
CAATGCCACACGCTACAAGACGGACGGCGAGTAGCGCTGCACCTGGTAGGACACAGCGCAACCGAGGCGCACCAC
GTATGGAACGGCAGCCGCTTTGTGGCCGACTTGTTCGAGGCGGAGCCGGAGCGAGTGCGCGGGCGCAGCGTCTTG
GAGCTGGGTGCGGGAGCGGGCCTGCCGTCGCTGGTGGCAGGCCTGCTGGGCGCGCGGCGCGTCGTCATGACGGAT
TTTCCAGACCCAGCAATAGTAGCAGCCATGCAGCGCAACGTGGACGAGGCTGCGGTGCAAGAGGTGGTGCGTGTA
CTGGGGTTTGTCTGGGGAGGAGACGCGGCGCCGCTGCTGGCGGCTTTGGCTCCCCAAGACAAGGGCTTTGATGTG
CTAGTCCTGGCCGATCTTCTCTTCCGCCATTCTGAGCACGGCGCACTGGTGCGGACTATTTGCCAGACGATGCGC
CGCACGGCATCGAGTGCCGCCTACGTCTTTTTTACCTCGTATCGTCCCTGGAAGCAGGACGCCGACATGGCCTTT
TTCGACGTTGCCAGGGCTGCGGGCCTTGCAGTCCGTCTGCTTGCCGAGCGCAAACTAGATGCGCCGCTGTTTGCT
GACGATCCCGGCGACGTCGAGGTGCAGAAGACGGTTAGGGGCTTCATGGTGCGTTGGCCAGACAGTGCGTCAGAG
TGA

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail